Cilia and flagella associated protein 298

Overview
NameCilia and flagella associated protein 298
Smed IDSMED30001235
Length (bp)1005
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia and flagella associated protein 298 (SMED30001235) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia and flagella associated protein 298 (SMED30001235) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia and flagella associated protein 298 (SMED30001235) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia and flagella associated protein 298 (SMED30001235) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001235

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30001235h1SMcG0012602 Contig45474newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001235h1SMcG0012602 Contig45474uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001235h1SMcG0012602 dd_Smed_v6_3612_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001235h1SMcG0012602 dd_Smed_v4_3612_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Human
Match: CFAP298 (cilia and flagella associated protein 298 [Source:HGNC Symbol;Acc:HGNC:1301])

HSP 1 Score: 365.54 bits (937), Expect = 1.182e-126
Identity = 168/290 (57.93%), Postives = 223/290 (76.90%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKV RL  E+ EL++HG+ LPP MQGLTD+QI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +T+EE+K +ISK  V+  VC+T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QAGL VI   EA LW++ KE+ R+K L D+ GKNEKTKIIAK+ ++  G P+REP+I + EQ+ +M YY+++QEE K+LE ND+DAYLNS WADN ALK   HG+ +I+  PR
Sbjct:    1 MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Human
Match: CFAP298 (cilia and flagella associated protein 298 [Source:HGNC Symbol;Acc:HGNC:1301])

HSP 1 Score: 310.842 bits (795), Expect = 1.418e-105
Identity = 153/290 (52.76%), Postives = 199/290 (68.62%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKV RL  E+ EL++HG+ LPP MQGLTD+QI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +T+EE+K +ISK  V+  VC+T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QAGL VI   EA LW++ KE+ R+K L D+ GKNEKTKIIAK+ ++                                LE ND+DAYLNS WADN ALK   HG+ +I+  PR
Sbjct:    1 MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQR--------------------------------LEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR 258          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Human
Match: C21orf59-TCP10L (C21orf59-TCP10L readthrough [Source:NCBI gene;Acc:110091775])

HSP 1 Score: 290.426 bits (742), Expect = 5.712e-97
Identity = 138/243 (56.79%), Postives = 181/243 (74.49%), Query Frame = 3
Query:  156 IYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLES-----NDEDAYLNSAWAD 869
            +YNG+LKV RL  E+ EL++HG+ LPP MQGLTD+QI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +T+EE+K +ISK  V+  VC+T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QAGL VI   EA LW++ KE+ R+K L D+ GKNEKTKIIAK+ ++  G P+REP+I + EQ+ +M YY+++QEE K L+      + E     S WAD
Sbjct:    2 VYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKPLQQQIIRLHQELGRQKSLWAD 244          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Human
Match: CFAP298 (cilia and flagella associated protein 298 [Source:HGNC Symbol;Acc:HGNC:1301])

HSP 1 Score: 280.026 bits (715), Expect = 1.223e-93
Identity = 132/225 (58.67%), Postives = 174/225 (77.33%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSS 731
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKV RL  E+ EL++HG+ LPP MQGLTD+QI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +T+EE+K +ISK  V+  VC+T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QAGL VI   EA LW++ KE+ R+K L D+ GKNEKTKIIAK+ + S+
Sbjct:    1 MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQVST 225          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Human
Match: C21orf59-TCP10L (C21orf59-TCP10L readthrough [Source:NCBI gene;Acc:110091775])

HSP 1 Score: 280.026 bits (715), Expect = 2.311e-93
Identity = 133/229 (58.08%), Postives = 176/229 (76.86%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTK--KSSGP 737
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKV RL  E+ EL++HG+ LPP MQGLTD+QI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +T+EE+K +ISK  V+  VC+T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QAGL VI   EA LW++ KE+ R+K L D+ GKNEKTKIIAK+ +  ++ GP
Sbjct:    1 MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQNVQTRGP 229          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Fly
Match: CG18675 (gene:FBgn0040696 transcript:FBtr0073218)

HSP 1 Score: 300.442 bits (768), Expect = 2.237e-101
Identity = 140/287 (48.78%), Postives = 197/287 (68.64%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRM 917
            MV L +K+GDE  FL+E+      DT++ EL +++NGQLK+ R+  EI EL++HG  +PP+M GL +EQ  ELKL D W +KCIPSGG+   KD + +RNG+ PT  M  +L   + ++K ++ + L K    +T   V+EA+++L+G VTIVYPM LPPH++IRMEF N EDL+G QA  EVI  ++A  WF+G +M+  K + D+ G N+KTK++ KL +   GPP RE VI    +R MMA  Y++QEE KKLE +D+D YLNS+WAD+ +LK Q HGL N+R 
Sbjct:    1 MVLLQVKRGDELIFLYETSVKEKTDTVLRELVALHNGQLKIQRVCMEIEELAEHGTMVPPEMIGLNEEQREELKLKDVWADKCIPSGGFTINKDPLLRRNGQQPTEAMQKVLAGAMNDAKAMVDRRLAKSSKTLTPKIVEEALNLLRGGVTIVYPMQLPPHDSIRMEFTNTEDLTGTQASKEVIEPSKAQFWFAGHQMLMGKLMSDYLGHNDKTKVVVKLNQIGEGPPGREAVISDPLRRQMMAEAYRRQEELKKLEQDDDDEYLNSSWADSGSLKRQAHGLENVRF 287          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Zebrafish
Match: cfap298 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:792532])

HSP 1 Score: 372.474 bits (955), Expect = 1.549e-129
Identity = 173/290 (59.66%), Postives = 223/290 (76.90%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+K+GDES+FLF +  D  I+TL +++C IYN +LKV R+  EI EL+ HG++LPP+MQGLTD+QIVELKL DEW E+CIPSGG    KD IG+RNG AP  KM D+L RT+EE+K LISK  ++ +VC+T   VKEA+D L+GAV IVYPMGLPPH+ IRME +N+EDL+G QA L+VI   EA LW++ KE+ R K L+D+ GKNEKTKII K+ K+  G P+REPV+  +EQ+ MM +YYK+QEE KKLE  D+D +L S W+D +ALK Q  GLTNI+ GPR
Sbjct:    1 MVQLHVKRGDESQFLFNTTVDVQIETLTQQICEIYNARLKVDRICTEIPELADHGISLPPKMQGLTDDQIVELKLKDEWEERCIPSGGAEFKKDEIGRRNGHAPNEKMKDVLRRTMEEAKALISKKQLQANVCVTMEMVKEALDQLRGAVMIVYPMGLPPHDPIRMEIENQEDLTGTQASLQVITNEEAQLWWASKELHRGKKLQDYIGKNEKTKIIVKIQKRGQGAPAREPVVSEDEQKQMMLHYYKRQEELKKLEEADDDTHLQSEWSDRQALKRQFQGLTNIKWGPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Zebrafish
Match: cfap298 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:792532])

HSP 1 Score: 372.474 bits (955), Expect = 1.549e-129
Identity = 173/290 (59.66%), Postives = 223/290 (76.90%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+K+GDES+FLF +  D  I+TL +++C IYN +LKV R+  EI EL+ HG++LPP+MQGLTD+QIVELKL DEW E+CIPSGG    KD IG+RNG AP  KM D+L RT+EE+K LISK  ++ +VC+T   VKEA+D L+GAV IVYPMGLPPH+ IRME +N+EDL+G QA L+VI   EA LW++ KE+ R K L+D+ GKNEKTKII K+ K+  G P+REPV+  +EQ+ MM +YYK+QEE KKLE  D+D +L S W+D +ALK Q  GLTNI+ GPR
Sbjct:    1 MVQLHVKRGDESQFLFNTTVDVQIETLTQQICEIYNARLKVDRICTEIPELADHGISLPPKMQGLTDDQIVELKLKDEWEERCIPSGGAEFKKDEIGRRNGHAPNEKMKDVLRRTMEEAKALISKKQLQANVCVTMEMVKEALDQLRGAVMIVYPMGLPPHDPIRMEIENQEDLTGTQASLQVITNEEAQLWWASKELHRGKKLQDYIGKNEKTKIIVKIQKRGQGAPAREPVVSEDEQKQMMLHYYKRQEELKKLEEADDDTHLQSEWSDRQALKRQFQGLTNIKWGPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Zebrafish
Match: cfap298 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:792532])

HSP 1 Score: 372.474 bits (955), Expect = 1.549e-129
Identity = 173/290 (59.66%), Postives = 223/290 (76.90%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+K+GDES+FLF +  D  I+TL +++C IYN +LKV R+  EI EL+ HG++LPP+MQGLTD+QIVELKL DEW E+CIPSGG    KD IG+RNG AP  KM D+L RT+EE+K LISK  ++ +VC+T   VKEA+D L+GAV IVYPMGLPPH+ IRME +N+EDL+G QA L+VI   EA LW++ KE+ R K L+D+ GKNEKTKII K+ K+  G P+REPV+  +EQ+ MM +YYK+QEE KKLE  D+D +L S W+D +ALK Q  GLTNI+ GPR
Sbjct:    1 MVQLHVKRGDESQFLFNTTVDVQIETLTQQICEIYNARLKVDRICTEIPELADHGISLPPKMQGLTDDQIVELKLKDEWEERCIPSGGAEFKKDEIGRRNGHAPNEKMKDVLRRTMEEAKALISKKQLQANVCVTMEMVKEALDQLRGAVMIVYPMGLPPHDPIRMEIENQEDLTGTQASLQVITNEEAQLWWASKELHRGKKLQDYIGKNEKTKIIVKIQKRGQGAPAREPVVSEDEQKQMMLHYYKRQEELKKLEEADDDTHLQSEWSDRQALKRQFQGLTNIKWGPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Xenopus
Match: ENSXETT00000029807.1 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:100380199])

HSP 1 Score: 326.25 bits (835), Expect = 4.049e-111
Identity = 155/290 (53.45%), Postives = 214/290 (73.79%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+KKGDES+FLF++     ++ L++++ +IYNG+LKV R+  E+ EL++HG+T+PP MQGL DEQI +LKL DEW E+C+PSGG +  KD IG+RNG AP   M  +L +T+EE+K LISK   + +VC+T   VKEA D L+GA  IVYPMGLPPH+ IRMEF+N EDLSG  AG  VI   E+ LW++GKE+ R + L D+ GKNEKTKII K+ K+  G P REPV+   EQ+ +M +YY++QEE KKLE +++ +Y+N+ WAD+ +LK Q  G+ +I+  PR
Sbjct:    1 MVRLHVKKGDESQFLFDTSVTVSVEELVKQITAIYNGRLKVERICSEMAELAEHGITMPPNMQGLADEQIEDLKLKDEWAERCVPSGGSVFKKDEIGRRNGHAPNDSMKKVLQKTMEEAKALISKKQAEANVCVTLEMVKEATDQLRGAAMIVYPMGLPPHDPIRMEFENNEDLSGTHAGQLVIEEPESQLWWAGKELQRKQKLSDYVGKNEKTKIIVKIQKRGQGAPGREPVVSEEEQKKLMMHYYRRQEELKKLEEDEDISYMNAEWADSNSLKRQFQGVKDIKWKPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Mouse
Match: Cfap298 (cilia and flagella associate protien 298 [Source:MGI Symbol;Acc:MGI:1915251])

HSP 1 Score: 360.147 bits (923), Expect = 1.250e-124
Identity = 166/290 (57.24%), Postives = 221/290 (76.21%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKVHRL  E+ EL++HG+ LPP MQGLTDEQI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +TVEE+K ++SK  V+  V +T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QA LEVI  +EA LW++ KE+ R+K L D+ GKNEKTKII K+ ++  G P+REPVI + E + +M +Y+++QEE KKLE ND+D+ LNS WADN ALK   HG+ +I+  PR
Sbjct:    1 MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCSEMEELAEHGVFLPPNMQGLTDEQIEELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGKNEKTKIIVKIQQRGQGAPAREPVISSEEHKQLMLFYHRRQEELKKLEENDDDSCLNSPWADNTALKRHFHGVKDIKWRPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Mouse
Match: Cfap298 (cilia and flagella associate protien 298 [Source:MGI Symbol;Acc:MGI:1915251])

HSP 1 Score: 240.35 bits (612), Expect = 7.533e-79
Identity = 118/215 (54.88%), Postives = 153/215 (71.16%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTK 701
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKVHRL                   GLTDEQI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +TVEE+K ++SK  V+  V +T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QA LEVI  +EA LW++ KE+ R+K L D+ GKNEKTK
Sbjct:    1 MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCS-----------------GLTDEQIEELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGKNEKTK 198          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Mouse
Match: Cfap298 (cilia and flagella associate protien 298 [Source:MGI Symbol;Acc:MGI:1915251])

HSP 1 Score: 192.971 bits (489), Expect = 4.439e-61
Identity = 91/147 (61.90%), Postives = 116/147 (78.91%), Query Frame = 3
Query:  198 ITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFS 638
            + EL++HG+ LPP MQGLTDEQI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +TVEE+K ++SK  V+  V +T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QA LEVI  +EA LW++
Sbjct:    4 MEELAEHGVFLPPNMQGLTDEQIEELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWA 150          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Mouse
Match: Cfap298 (cilia and flagella associate protien 298 [Source:MGI Symbol;Acc:MGI:1915251])

HSP 1 Score: 168.703 bits (426), Expect = 1.796e-51
Identity = 89/187 (47.59%), Postives = 116/187 (62.03%), Query Frame = 3
Query:  366 PTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            P  KM  +L +TVEE+K ++SK  V+  V +T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QA LEVI  +EA LW++ KE+ R+K L D+ GKNEKTKII K+                                 +KLE ND+D+ LNS WADN ALK   HG+ +I+  PR
Sbjct:    2 PNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGKNEKTKIIVKIQ--------------------------------QKLEENDDDSCLNSPWADNTALKRHFHGVKDIKWRPR 156          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Mouse
Match: Cfap298 (cilia and flagella associate protien 298 [Source:MGI Symbol;Acc:MGI:1915251])

HSP 1 Score: 139.813 bits (351), Expect = 1.969e-40
Identity = 62/102 (60.78%), Postives = 81/102 (79.41%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGK 362
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKVHRL  E+ EL++HG+ LPP MQGLTDEQI ELKL DEWGEKC+PSGG +  KD IG+RNG+
Sbjct:    1 MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCSEMEELAEHGVFLPPNMQGLTDEQIEELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQ 102          
BLAST of Cilia and flagella associated protein 298 vs. UniProt/SwissProt
Match: sp|Q6DRC3|CF298_DANRE (Cilia- and flagella-associated protein 298 OS=Danio rerio OX=7955 GN=cfap298 PE=1 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.696e-128
Identity = 173/290 (59.66%), Postives = 222/290 (76.55%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+K+GDES+FLF +  D  I+TL +++C IYN +LKV R+  EI EL+ HG++LPP MQGLTD+QIVELKL DEW E+CIPSGG    KD IG+RNG AP  KM D+L RT+EE+K LISK  ++ +VC+T   VKEA+D L+GAV IVYPMGLPPH+ IRME +N+EDL+G QA L+VI   EA LW++ KE+ R K L+D+ GKNEKTKII K+ K+  G P+REPV+  +EQ+ MM +YYK+QEE KKLE  D+D +L S W+D +ALK Q  GLTNI+ GPR
Sbjct:    1 MVQLHVKRGDESQFLFNTTVDVQIETLTQQICEIYNARLKVDRICTEIPELADHGISLPPNMQGLTDDQIVELKLKDEWEERCIPSGGAEFKKDEIGRRNGHAPNEKMKDVLRRTMEEAKALISKKQLQANVCVTMEMVKEALDQLRGAVMIVYPMGLPPHDPIRMEIENQEDLTGTQASLQVITNEEAQLWWASKELHRGKKLQDYIGKNEKTKIIVKIQKRGQGAPAREPVVSEDEQKQMMLHYYKRQEELKKLEEADDDTHLQSEWSDRQALKRQFQGLTNIKWGPR 290          
BLAST of Cilia and flagella associated protein 298 vs. UniProt/SwissProt
Match: sp|P57076|CF298_HUMAN (Cilia- and flagella-associated protein 298 OS=Homo sapiens OX=9606 GN=CFAP298 PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 5.677e-126
Identity = 168/290 (57.93%), Postives = 223/290 (76.90%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKV RL  E+ EL++HG+ LPP MQGLTD+QI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +T+EE+K +ISK  V+  VC+T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QAGL VI   EA LW++ KE+ R+K L D+ GKNEKTKIIAK+ ++  G P+REP+I + EQ+ +M YY+++QEE K+LE ND+DAYLNS WADN ALK   HG+ +I+  PR
Sbjct:    1 MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR 290          
BLAST of Cilia and flagella associated protein 298 vs. UniProt/SwissProt
Match: sp|Q8BL95|CF298_MOUSE (Cilia- and flagella-associated protein 298 OS=Mus musculus OX=10090 GN=Cfap298 PE=1 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 8.741e-124
Identity = 166/290 (57.24%), Postives = 221/290 (76.21%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKVHRL  E+ EL++HG+ LPP MQGLTDEQI ELKL DEWGEKC+PSGG +  KD IG+RNG+AP  KM  +L +TVEE+K ++SK  V+  V +T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QA LEVI  +EA LW++ KE+ R+K L D+ GKNEKTKII K+ ++  G P+REPVI + E + +M +Y+++QEE KKLE ND+D+ LNS WADN ALK   HG+ +I+  PR
Sbjct:    1 MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCSEMEELAEHGVFLPPNMQGLTDEQIEELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGKNEKTKIIVKIQQRGQGAPAREPVISSEEHKQLMLFYHRRQEELKKLEENDDDSCLNSPWADNTALKRHFHGVKDIKWRPR 290          
BLAST of Cilia and flagella associated protein 298 vs. UniProt/SwissProt
Match: sp|Q5U3Z0|CF298_RAT (Cilia- and flagella-associated protein 298 OS=Rattus norvegicus OX=10116 GN=Cfap298 PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 3.862e-123
Identity = 166/290 (57.24%), Postives = 220/290 (75.86%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K+GDES+FL ++P  T ++ L  ++  +YNG+LKVHRL  EI EL++HG+ LPP MQGLTDEQI ELKL DEWGEKC+PSGG +  KD IG+RNG AP  KM  +L +TVEE+K ++SK  V+  V +T   VK+A+D L+GAV IVYPMGLPP++ IRMEF+N+EDLSG QA LEVI  +EA LW++ KE+ R+K L D+ GKNEKTKII K+ ++  G P+REP+I + E + +M +Y+++QEE KKLE ND+D+ LNS WADN ALK   HG+ +I+  PR
Sbjct:    1 MVVLHVKRGDESQFLLQAPGSTELEELTAQVTRVYNGRLKVHRLCTEIEELAEHGVFLPPNMQGLTDEQIEELKLKDEWGEKCVPSGGSVFTKDDIGRRNGHAPNEKMKQVLKKTVEEAKAMVSKKQVEAGVFVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGKNEKTKIIVKIQQRGQGAPAREPLISSEEHKQLMLFYHRRQEELKKLEENDDDSCLNSPWADNTALKRHFHGVKDIKWRPR 290          
BLAST of Cilia and flagella associated protein 298 vs. UniProt/SwissProt
Match: sp|A0A1L8HCK2|C298A_XENLA (Cilia- and flagella-associated protein 298-A OS=Xenopus laevis OX=8355 GN=cfap298-a PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 3.695e-117
Identity = 157/290 (54.14%), Postives = 218/290 (75.17%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+KKGDES+FLF++     ++ L++++ +IYNG+LK+ R+  E+ EL++HG+T+PP MQGL DEQI ELKL DEW E+C+PSGG +  KD IG+RNG AP+  M  +L +T+EE+K LISK   + +VC+T   VKEA D L+GAV IVYPMGLPPH+ IRMEF+N EDLSG  AG  VI   E+ LW++GKE+ R + L D+ GKNEKT+II K+ K+  G P+REPVI   EQ+ +M +YY++QEE+KKLE +++ +YLN+ WAD+ +LK Q  G+ +I+  PR
Sbjct:    1 MVRLHVKKGDESQFLFDTSVTVPVEELVKQITAIYNGRLKIDRICSEMGELAEHGITMPPNMQGLADEQIEELKLKDEWEERCVPSGGSVFKKDEIGRRNGHAPSDSMKKVLQKTMEEAKALISKKQAEANVCVTLEMVKEATDQLRGAVMIVYPMGLPPHDPIRMEFENNEDLSGTHAGQLVIEEPESQLWWAGKELQRKQKLSDYVGKNEKTRIIVKIQKRGQGAPAREPVITQEEQKKLMMHYYRRQEEFKKLEEDEDISYLNAEWADSNSLKRQFQGVKDIKWKPR 290          
BLAST of Cilia and flagella associated protein 298 vs. TrEMBL
Match: A0A183B4S5 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS14209 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 3.317e-142
Identity = 186/290 (64.14%), Postives = 237/290 (81.72%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV++ +K+ D ++FL E P+ + I+ ++E  C IYNG LK+HR+  E+ +L+KHG++LPP MQGLTD+QIV+LKL DEWGEKCIPSGGY+ECKD IG+RNG+AP  KMA +L RT++E+K+LI +DLVKQD CM KA VKEA+ +L+GAV IVYPMGLPPH+ I++E DNEEDL+G  A  EV+   EA LWFSGKEM+R K L D+ GKNEKTKI+AKL+K+ +G P+REP+ID  +Q+ MM+YYYKKQEEWKKLESNDEDAYL+SAWA+   LK Q HGLTNI+ GPR
Sbjct:    1 MVRIVLKRNDAAQFLLEVPATSTIEEILELSCEIYNGFLKIHRICAEMDDLAKHGVSLPPNMQGLTDDQIVDLKLKDEWGEKCIPSGGYIECKDEIGRRNGRAPNEKMAQVLKRTIDETKQLIKRDLVKQDKCMDKATVKEALMMLQGAVMIVYPMGLPPHDPIKLELDNEEDLTGTHAAQEVVPFEEATLWFSGKEMLRGKLLSDYVGKNEKTKIVAKLSKRGAGAPAREPIIDEEQQKAMMSYYYKKQEEWKKLESNDEDAYLDSAWAEPGQLKRQFHGLTNIKWGPR 290          
BLAST of Cilia and flagella associated protein 298 vs. TrEMBL
Match: A0A183QTA9 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 6.945e-141
Identity = 185/290 (63.79%), Postives = 239/290 (82.41%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV++ +KKGD++ F+ + PS T I+ L+ E+C IYNG LK+HR+  E+ EL+KHG+TLPP MQGLTDEQI +LKL DEWG+KCIPSGGY+ECKD IG+RNG APT KM ++L RT++ESK+LIS+DLVK+D+ + K+ V+EA+ +L GAVTIVYPMGLPP++ I++EFDNEEDLSG  A  EVI A+ A+LWFSGKEM R K L D+ G+N+KTKIIAKL K+ SG P+REP+++  +QR MMAYYYK+QEEWKKLE++D+D YLNSAWA+   LK Q HGLTNI+ GP+
Sbjct:    1 MVRIVVKKGDQAFFMIDRPSSTPIEELLSEICEIYNGILKIHRICGELEELAKHGVTLPPNMQGLTDEQICDLKLEDEWGKKCIPSGGYVECKDEIGRRNGVAPTEKMVEVLKRTMDESKQLISRDLVKKDISIEKSVVREALMMLTGAVTIVYPMGLPPYDPIKLEFDNEEDLSGTHASQEVITADNASLWFSGKEMHRGKLLSDYVGRNDKTKIIAKLAKRGSGAPAREPIVNEEQQRAMMAYYYKRQEEWKKLEADDDDCYLNSAWAEPNQLKRQFHGLTNIKWGPK 290          
BLAST of Cilia and flagella associated protein 298 vs. TrEMBL
Match: A0A3Q0KHT4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.859e-140
Identity = 185/290 (63.79%), Postives = 239/290 (82.41%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV++ +KKGD++ F+ + PS T I+ L+ E+C IYNG LK+HR+  E+ EL+KHG+TLPP MQGLTDEQI +LKL DEWG+KCIPSGGY+ECKD IG+RNG APT KM ++L RT++ESK+LIS+DLVK+D+ + K+ ++EA+ +L GAVTIVYPMGLPP++ I++EFDNEEDLSG  A  EVI A+ A+LWFSGKEM R K L D+ G N+KTKIIAKLTK+ +G P+REP+I+  +QR MMAYYYK+QEEWKKLE++D+D YLNSAWA+   LK Q HGLTNI+ GP+
Sbjct:    1 MVRIVVKKGDQAFFMIDRPSSTPIEELLSEICEIYNGILKIHRICGEMEELAKHGVTLPPNMQGLTDEQICDLKLEDEWGKKCIPSGGYVECKDEIGRRNGVAPTEKMVEVLKRTMDESKQLISRDLVKKDISIEKSVIREALMMLTGAVTIVYPMGLPPYDPIKLEFDNEEDLSGTHASQEVITADNASLWFSGKEMHRGKLLSDYIGHNDKTKIIAKLTKRGTGAPAREPIINEEQQRAMMAYYYKRQEEWKKLEADDDDCYLNSAWAEPNQLKRQFHGLTNIKWGPK 290          
BLAST of Cilia and flagella associated protein 298 vs. TrEMBL
Match: A0A4Z2D2C2 (UPF0769 protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005289 PE=4 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 3.584e-140
Identity = 183/290 (63.10%), Postives = 236/290 (81.38%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV++ +KKGD+  F+ + PS T I+ LI ++C IYNG LK+HR+  E+ EL+KHG+TLPP MQGLTDEQ+ +LKL DEWG+KCIPSGGY+ECKD IG+RNG AP  KM +IL RT++ESK+LI +DLVKQD+C+ K+ V+EA+ +L GAVTIVYPMGLPP++ I++EFDNEEDLSG  A  +VI  ++A+LWFSGKEM R K L D+ G NEKTKIIAKL+K+  G P+REP+++  +QR MMAYYYKKQEEWKKLE++D+D YLNSAWA+   LK Q HGL+NI+ GP+
Sbjct:    1 MVRITVKKGDQVYFMIDRPSSTSIENLISDICEIYNGILKIHRICGEMEELAKHGVTLPPNMQGLTDEQVCDLKLEDEWGKKCIPSGGYVECKDEIGRRNGIAPNEKMVEILKRTMDESKQLICRDLVKQDICIEKSAVREALMMLIGAVTIVYPMGLPPYDPIKLEFDNEEDLSGTHARQDVIPCDDASLWFSGKEMFRGKILSDYVGCNEKTKIIAKLSKRGCGAPAREPIVNEEQQRAMMAYYYKKQEEWKKLEADDDDCYLNSAWAEPNQLKRQFHGLSNIKWGPK 290          
BLAST of Cilia and flagella associated protein 298 vs. TrEMBL
Match: Q5DDJ2 (SJCHGC00883 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 8.886e-140
Identity = 182/290 (62.76%), Postives = 236/290 (81.38%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV++ +KKGD+  F+ + PS T I+ LI ++C IYNG LK+HR+  E+ +L+KHG+TLPP MQGLTDEQ+ +LKL DEWG+KCIPSGGY+ECKD IG+RNG AP  KM +IL RT++ESK+LI +DLVKQD+C+ K+ V+EA+ +L GAVTIVYPMGLPP++ I++EFDNEEDLSG  A  +VI  ++A+LWFSGKEM R K L D+ G NEKTKIIAKL+K+  G P+REP+++  +QR MMAYYYKKQEEWKKLE++D+D YLNSAWA+   LK Q HGL+NI+ GP+
Sbjct:    1 MVRITVKKGDQVYFMIDRPSSTSIENLISDICEIYNGILKIHRICGEMEDLAKHGVTLPPNMQGLTDEQVCDLKLEDEWGKKCIPSGGYVECKDEIGRRNGIAPNEKMVEILKRTMDESKQLICRDLVKQDICIEKSAVREALMMLIGAVTIVYPMGLPPYDPIKLEFDNEEDLSGTHARQDVIPCDDASLWFSGKEMFRGKILSDYVGCNEKTKIIAKLSKRGCGAPAREPIVNEEQQRAMMAYYYKKQEEWKKLEADDDDCYLNSAWAEPNQLKRQFHGLSNIKWGPK 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Cavefish
Match: cfap298 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:792532])

HSP 1 Score: 307.76 bits (787), Expect = 1.439e-104
Identity = 151/290 (52.07%), Postives = 199/290 (68.62%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+K+G+ES+FLF + +D  I+TLI+++  IYN +LKV R+  EI EL+ HG+TLPP MQGLTD+QI++LKL DEW E+C PSGG    KD IG+RNG AP  +M  +L +T+EE+K LISK  V+ +VC+T   VKEA+D L+GAV IVYPMGLPPH+ IRME +N+EDLSG QA L+V+   EA LW++ KEM R K L+D+TGKNEKTKI+ KL                                 KKL+  ++D+YL S W+D +ALK Q  GL+NIR GP+
Sbjct:    1 MVQLHVKRGEESQFLFNTTADIPIETLIQQITEIYNSRLKVDRICSEIPELADHGITLPPNMQGLTDDQIIDLKLKDEWEERCTPSGGAEFNKDEIGRRNGHAPNERMKTVLRKTLEEAKALISKKQVQANVCVTMDLVKEALDQLRGAVMIVYPMGLPPHDPIRMELENKEDLSGTQASLQVLSEEEAQLWWASKEMQRGKKLQDYTGKNEKTKIVVKLQ--------------------------------KKLDEAEDDSYLQSEWSDRQALKRQFQGLSNIRWGPK 258          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Sea Lamprey
Match: cfap298 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:792532])

HSP 1 Score: 283.493 bits (724), Expect = 2.428e-95
Identity = 147/290 (50.69%), Postives = 199/290 (68.62%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV LH+K G+ES+FL ES +   +D L      IYNG+L+V RL   + EL+ HG  LPP MQGLT+EQ+VEL+L DEW E C+PSGG     D  G+R G+AP  KM ++L +T++E+K LISK+ V+ +V MT   V+EA+D L+GAVTIVYPM LPPH+ +RME ++  +L+G QAGL+VI   EA LW++GK +   K L D+ GKNEKTKII K+ K+  G P+REP++   +Q+ MM   Y++QEE KKLE  + D +L+S WAD  ALK    GL +I   P+
Sbjct:    1 MVLLHVKHGNESQFLLESDAQAPLDELTARATRIYNGRLRVERLCSGVEELASHGAALPPNMQGLTEEQLVELRLRDEWAESCVPSGGAQLSPDPCGRRGGQAPNEKMQEVLRKTIQEAKALISKNQVQANVFMTMEMVQEALDQLRGAVTIVYPMQLPPHDPVRMEIEDRAELAGMQAGLQVIDEKEAQLWWAGKHLQSDKKLSDYIGKNEKTKIIIKIQKRGQGAPAREPIVSEEQQKQMMLQAYRRQEELKKLEECESDDHLSSNWADAHALKRSFQGLRDISWRPK 290          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Nematostella
Match: EDO33865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR06])

HSP 1 Score: 351.288 bits (900), Expect = 9.111e-122
Identity = 165/289 (57.09%), Postives = 216/289 (74.74%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGP 923
            MVKLHIK+G+ES FL+E+     +  LI EL  I NG+LK+ RL  EI EL+KHG TLPP MQGLTD+QI +L+L DEW +KC+PSGGY+E  D + +RNG+AP   MA++L RT +E+   +SK+LVK D+C+T  KVK+A+D ++G+V IVYPMGLPPH+ I +EFDN+EDLSG Q  L+V+    A LW++GKE+ R K L+DF GKNEKTK++ KL KK  G P+RE V    E+++MMA+ Y+KQEE KKLE+ +EDAYLNSAWAD  +LK Q HGL N +  P
Sbjct:    1 MVKLHIKRGEESLFLYETTCSVELSELIPELVRISNGRLKIERLNYEIEELAKHGPTLPPNMQGLTDDQISDLRLKDEWEDKCVPSGGYVETTDPMSRRNGRAPKDNMAEVLNRTRQEAMAAVSKNLVKTDICLTMEKVKDALDQMRGSVMIVYPMGLPPHDNITLEFDNQEDLSGMQGSLQVLDEGTAQLWWAGKELQRGKKLQDFIGKNEKTKLVVKLQKKGQGAPAREQVFSEEERKHMMAHAYRKQEEMKKLENAEEDAYLNSAWADPNSLKRQFHGLGNFKWRP 289          
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Medaka
Match: cfap298 (cilia and flagella associated protein 298 [Source:NCBI gene;Acc:101169629])

HSP 1 Score: 347.436 bits (890), Expect = 1.052e-119
Identity = 160/290 (55.17%), Postives = 220/290 (75.86%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MV+LH+K+G ES+FLF + +   ++T+I+++ +IYNG+LKV RL  EI+EL+ HG+ LPP MQ LT EQI EL L DEW ++C+PSGG +  KD IG+RNG AP  KM ++L +TVEE+K LIS   +  +VC+T   VKEA+D L+GAVTIVYPMGLPP++ IRMEF++ EDLSG QA  +VI  +E  LW++ KE+ R K L+D+ GKNEKTK++ K+ KK  GPP+REP++   +Q+ MM +YY++QEE KKLE  ++D++L+S WAD +ALK Q  GLTNI+ GPR
Sbjct:    1 MVQLHVKRGQESQFLFNTTAQAPLETVIQQITAIYNGRLKVERLCSEISELADHGIMLPPNMQELTVEQIEELNLRDEWEDQCMPSGGAVFKKDEIGRRNGHAPNDKMKEVLMKTVEEAKALISNKQIPANVCVTMEMVKEALDQLRGAVTIVYPMGLPPYDPIRMEFEDLEDLSGTQASQQVITKDECQLWWAAKELQRGKKLQDYIGKNEKTKLVVKVQKKGHGPPAREPLVTNEQQKEMMKHYYRRQEELKKLEEANDDSHLDSEWADRQALKRQFQGLTNIKWGPR 290          
BLAST of Cilia and flagella associated protein 298 vs. Planmine SMEST
Match: SMESG000074029.1 (SMESG000074029.1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 288/290 (99.31%), Postives = 288/290 (99.31%), Query Frame = 3
Query:   57 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 926
            MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHE IRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVID NEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR
Sbjct:    1 MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITELSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRNGKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAVTIVYPMGLPPHETIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIRSKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDENEQRNMMAYYYKKQEEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR 290          
The following BLAST results are available for this feature:
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP2981.182e-12657.93cilia and flagella associated protein 298 [Source:... [more]
CFAP2981.418e-10552.76cilia and flagella associated protein 298 [Source:... [more]
C21orf59-TCP10L5.712e-9756.79C21orf59-TCP10L readthrough [Source:NCBI gene;Acc:... [more]
CFAP2981.223e-9358.67cilia and flagella associated protein 298 [Source:... [more]
C21orf59-TCP10L2.311e-9358.08C21orf59-TCP10L readthrough [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG186752.237e-10148.78gene:FBgn0040696 transcript:FBtr0073218[more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap2981.549e-12959.66cilia and flagella associated protein 298 [Source:... [more]
cfap2981.549e-12959.66cilia and flagella associated protein 298 [Source:... [more]
cfap2981.549e-12959.66cilia and flagella associated protein 298 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000029807.14.049e-11153.45cilia and flagella associated protein 298 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap2981.250e-12457.24cilia and flagella associate protien 298 [Source:M... [more]
Cfap2987.533e-7954.88cilia and flagella associate protien 298 [Source:M... [more]
Cfap2984.439e-6161.90cilia and flagella associate protien 298 [Source:M... [more]
Cfap2981.796e-5147.59cilia and flagella associate protien 298 [Source:M... [more]
Cfap2981.969e-4060.78cilia and flagella associate protien 298 [Source:M... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DRC3|CF298_DANRE1.696e-12859.66Cilia- and flagella-associated protein 298 OS=Dani... [more]
sp|P57076|CF298_HUMAN5.677e-12657.93Cilia- and flagella-associated protein 298 OS=Homo... [more]
sp|Q8BL95|CF298_MOUSE8.741e-12457.24Cilia- and flagella-associated protein 298 OS=Mus ... [more]
sp|Q5U3Z0|CF298_RAT3.862e-12357.24Cilia- and flagella-associated protein 298 OS=Ratt... [more]
sp|A0A1L8HCK2|C298A_XENLA3.695e-11754.14Cilia- and flagella-associated protein 298-A OS=Xe... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B4S53.317e-14264.14Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A183QTA96.945e-14163.79Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A3Q0KHT41.859e-14063.79Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2D2C23.584e-14063.10UPF0769 protein OS=Schistosoma japonicum OX=6182 G... [more]
Q5DDJ28.886e-14062.76SJCHGC00883 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap2981.439e-10452.07cilia and flagella associated protein 298 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap2982.428e-9550.69cilia and flagella associated protein 298 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO338659.111e-12257.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap2981.052e-11955.17cilia and flagella associated protein 298 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 298 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000074029.10.000e+099.31SMESG000074029.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001235 ID=SMED30001235|Name=Cilia and flagella associated protein 298|organism=Schmidtea mediterranea sexual|type=transcript|length=1005bp
TTTTTTTTGATTTCTAAGGTAACACTTAATTATCAATTACATTAAGTTGT
CTTTAGATGGTTAAATTACATATAAAAAAAGGGGATGAAAGCAGATTTTT
ATTTGAATCACCGTCAGATACTTTGATTGATACTCTTATTGAAGAACTCT
GTTCGATTTACAATGGACAGTTAAAAGTGCACCGACTAGCAGATGAAATC
ACTGAACTTTCCAAACATGGTTTAACGTTACCACCACAAATGCAAGGATT
AACCGATGAGCAAATTGTGGAATTAAAGTTAACAGATGAATGGGGAGAAA
AATGTATTCCCAGCGGTGGCTATTTAGAATGTAAAGATACTATTGGCAAA
AGAAATGGAAAAGCTCCAACTAGTAAAATGGCTGATATATTAACTAGAAC
TGTTGAAGAAAGTAAAAAATTGATTTCTAAAGATCTTGTAAAGCAAGATG
TGTGCATGACAAAAGCAAAAGTAAAAGAAGCAATTGATATCTTAAAAGGT
GCTGTGACTATTGTTTATCCTATGGGATTACCTCCTCATGAAGCTATTAG
AATGGAGTTTGATAATGAAGAAGATTTATCCGGGAAACAGGCCGGTTTGG
AAGTTATTGGAGCAAACGAAGCAGCGTTGTGGTTTTCAGGCAAGGAAATG
ATTAGATCTAAATTTCTGAGAGACTTCACCGGGAAAAATGAAAAAACAAA
AATTATTGCTAAATTAACGAAAAAATCAAGCGGTCCACCATCTAGAGAAC
CAGTGATTGATGCAAATGAACAACGAAACATGATGGCTTATTATTATAAA
AAGCAAGAAGAATGGAAAAAATTGGAAAGCAACGATGAAGATGCTTATTT
AAACTCTGCCTGGGCAGATAACAAAGCACTTAAAAACCAACTCCACGGAT
TGACTAATATCAGAATGGGGCCACGATGATTGCCAAAAATAAATGTTTAT
GTAGTTGAATTTAATCATTTAAAATTAAATGCTGATTTTTAATTAAATAT
TTCTG
back to top

protein sequence of SMED30001235-orf-1

>SMED30001235-orf-1 ID=SMED30001235-orf-1|Name=SMED30001235-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MVKLHIKKGDESRFLFESPSDTLIDTLIEELCSIYNGQLKVHRLADEITE
LSKHGLTLPPQMQGLTDEQIVELKLTDEWGEKCIPSGGYLECKDTIGKRN
GKAPTSKMADILTRTVEESKKLISKDLVKQDVCMTKAKVKEAIDILKGAV
TIVYPMGLPPHEAIRMEFDNEEDLSGKQAGLEVIGANEAALWFSGKEMIR
SKFLRDFTGKNEKTKIIAKLTKKSSGPPSREPVIDANEQRNMMAYYYKKQ
EEWKKLESNDEDAYLNSAWADNKALKNQLHGLTNIRMGPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0003352regulation of cilium movement
GO:0007368determination of left/right symmetry
GO:0044458motile cilium assembly
GO:0048793pronephros development
GO:0048858cell projection morphogenesis
GO:0060271cilium morphogenesis
GO:0072114pronephros morphogenesis
GO:0090660cerebrospinal fluid circulation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR021298CFAP298
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021298Cilia- and flagella-associated protein 298PFAMPF11069DUF2870coord: 189..285
e-value: 1.2E-42
score: 144.1
IPR021298Cilia- and flagella-associated protein 298PANTHERPTHR13238PROTEIN C21ORF59coord: 1..290
NoneNo IPR availablePANTHERPTHR13238:SF4UPF0769 PROTEIN C21ORF59coord: 1..290