PKD1L-2

Overview
NamePKD1L-2
Smed IDSMED30001229
Length (bp)353
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001229

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001229SMESG000014725.1 SMESG000014723.1 SmedASXL_014419SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30001229SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30001229SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001229SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal-ventral axis of the whole animalSMED30001229SMESG000014725.1 SMESG000014723.1 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30001229SMESG000014725.1 SMESG000014723.1 dd_Smed_v6_13975_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30001229SMESG000014725.1 SMESG000014723.1 dd_Smed_v6_13975_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD1L-2 vs. Ensembl Human
Match: THBS1 (thrombospondin 1 [Source:HGNC Symbol;Acc:HGNC:11785])

HSP 1 Score: 48.521 bits (114), Expect = 4.811e-7
Identity = 31/92 (33.70%), Postives = 46/92 (50.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV--PLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P+P   G+ C G + +T++C     P+N           +           G+ +RSRLCNNP P   G+DC G  T+ Q C
Sbjct:  455 VITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPIN-----GGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQIC 541          
BLAST of PKD1L-2 vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 47.7506 bits (112), Expect = 8.324e-7
Identity = 40/89 (44.94%), Postives = 53/89 (59.55%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G +    +CT +   CPV+G+W+ WS WS+CS  C       RSR C  P P N G+DCSG   D+++CT
Sbjct:  268 KRTRTCTNPAPLNGGAFCEGQAFQKTACTTI---CPVDGAWTEWSKWSACSTECAH----WRSRECMAPPPQNGGRDCSGTLLDSKNCT 349          
BLAST of PKD1L-2 vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 47.7506 bits (112), Expect = 8.331e-7
Identity = 40/89 (44.94%), Postives = 53/89 (59.55%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G +    +CT +   CPV+G+W+ WS WS+CS  C       RSR C  P P N G+DCSG   D+++CT
Sbjct:  268 KRTRTCTNPAPLNGGAFCEGQAFQKTACTTI---CPVDGAWTEWSKWSACSTECAH----WRSRECMAPPPQNGGRDCSGTLLDSKNCT 349          
BLAST of PKD1L-2 vs. Ensembl Human
Match: SEMA5A (semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736])

HSP 1 Score: 47.7506 bits (112), Expect = 8.815e-7
Identity = 42/90 (46.67%), Postives = 52/90 (57.78%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            I  R R+CNNP P   G  C G S + Q C  +P  CPV+G WS WS W+ CS +CG    M R+R C+NPAP+  G  C GL T+   C
Sbjct:  804 IRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILP--CPVDGVWSCWSPWTKCSATCGGGHYM-RTRSCSNPAPAYGGDICLGLHTEEALC 890          
BLAST of PKD1L-2 vs. Ensembl Human
Match: SEMA5A (semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736])

HSP 1 Score: 47.7506 bits (112), Expect = 8.815e-7
Identity = 42/90 (46.67%), Postives = 52/90 (57.78%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            I  R R+CNNP P   G  C G S + Q C  +P  CPV+G WS WS W+ CS +CG    M R+R C+NPAP+  G  C GL T+   C
Sbjct:  804 IRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILP--CPVDGVWSCWSPWTKCSATCGGGHYM-RTRSCSNPAPAYGGDICLGLHTEEALC 890          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 50.0618 bits (118), Expect = 8.756e-8
Identity = 31/90 (34.44%), Postives = 44/90 (48.89%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+DC+G   +T+ C   P  CP         +           G+ +R RLCN+PAP   G+DC G S   + C
Sbjct:   40 VITRIRLCNSPTPQMGGRDCAGEGRETEPCQQDP--CP-VNGGWGPWSLWDSCSVSCGGGLQRRHRLCNSPAPKYGGKDCVGDSKAARMC 126          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 49.6766 bits (117), Expect = 9.411e-8
Identity = 31/90 (34.44%), Postives = 44/90 (48.89%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+DC+G   +T+ C   P  CP         +           G+ +R RLCN+PAP   G+DC G S   + C
Sbjct:   40 VITRIRLCNSPTPQMGGRDCAGEGRETEPCQQDP--CP-VNGGWGPWSLWDSCSVSCGGGLQRRHRLCNSPAPKYGGKDCVGDSKAARMC 126          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs1b (thrombospondin 1b [Source:ZFIN;Acc:ZDB-GENE-020708-1])

HSP 1 Score: 48.9062 bits (115), Expect = 2.201e-7
Identity = 30/90 (33.33%), Postives = 42/90 (46.67%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+DC G    T+ C   P  CP         +           G+  R RLCNNP P + G++C G +  +Q C
Sbjct:  455 VITRIRLCNSPTPQMDGKDCQGEGRQTERCEKSP--CP-INGGWGPWSPWDTCSVTCGGGVQNRKRLCNNPVPKHGGKECVGDAKVSQIC 541          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs1b (thrombospondin 1b [Source:ZFIN;Acc:ZDB-GENE-020708-1])

HSP 1 Score: 48.9062 bits (115), Expect = 2.201e-7
Identity = 30/90 (33.33%), Postives = 42/90 (46.67%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+DC G    T+ C   P  CP         +           G+  R RLCNNP P + G++C G +  +Q C
Sbjct:  455 VITRIRLCNSPTPQMDGKDCQGEGRQTERCEKSP--CP-INGGWGPWSPWDTCSVTCGGGVQNRKRLCNNPVPKHGGKECVGDAKVSQIC 541          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs1b (thrombospondin 1b [Source:ZFIN;Acc:ZDB-GENE-020708-1])

HSP 1 Score: 48.9062 bits (115), Expect = 2.266e-7
Identity = 30/90 (33.33%), Postives = 42/90 (46.67%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+DC G    T+ C   P  CP         +           G+  R RLCNNP P + G++C G +  +Q C
Sbjct:  456 VITRIRLCNSPTPQMDGKDCQGEGRQTERCEKSP--CP-INGGWGPWSPWDTCSVTCGGGVQNRKRLCNNPVPKHGGKECVGDAKVSQIC 542          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: THBS2 (thrombospondin 2 [Source:NCBI gene;Acc:100494997])

HSP 1 Score: 52.373 bits (124), Expect = 1.813e-8
Identity = 30/89 (33.71%), Postives = 44/89 (49.44%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + R RLCN+P P   G++C+G   +T+ C  +PLN           +  S        G+ +RSRLCNNP P   G+ C G   + + C
Sbjct:  422 ITRIRLCNSPKPQLGGKNCTGAGRETKQCEGIPLN-----GKWGPWSPWSSCTVTCGGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 505          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: THBS2 (thrombospondin 2 [Source:NCBI gene;Acc:100494997])

HSP 1 Score: 49.6766 bits (117), Expect = 1.423e-7
Identity = 30/89 (33.71%), Postives = 44/89 (49.44%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + R RLCN+P P   G++C+G   +T+ C  +P  CP         +  S        G+ +RSRLCNNP P   G+ C G   + + C
Sbjct:  324 ITRIRLCNSPKPQLGGKNCTGAGRETKQCEGIP--CP-INGKWGPWSPWSSCTVTCGGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 409          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: THBS2 (thrombospondin 2 [Source:NCBI gene;Acc:100494997])

HSP 1 Score: 49.6766 bits (117), Expect = 1.624e-7
Identity = 30/89 (33.71%), Postives = 44/89 (49.44%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + R RLCN+P P   G++C+G   +T+ C  +P  CP         +  S        G+ +RSRLCNNP P   G+ C G   + + C
Sbjct:  454 ITRIRLCNSPKPQLGGKNCTGAGRETKQCEGIP--CP-INGKWGPWSPWSSCTVTCGGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 539          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: THBS2 (thrombospondin 2 [Source:NCBI gene;Acc:100494997])

HSP 1 Score: 49.2914 bits (116), Expect = 1.774e-7
Identity = 30/89 (33.71%), Postives = 44/89 (49.44%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + R RLCN+P P   G++C+G   +T+ C  +P  CP         +  S        G+ +RSRLCNNP P   G+ C G   + + C
Sbjct:  469 ITRIRLCNSPKPQLGGKNCTGAGRETKQCEGIP--CP-INGKWGPWSPWSSCTVTCGGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 554          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: THBS2 (thrombospondin 2 [Source:NCBI gene;Acc:100494997])

HSP 1 Score: 49.2914 bits (116), Expect = 1.781e-7
Identity = 30/89 (33.71%), Postives = 44/89 (49.44%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + R RLCN+P P   G++C+G   +T+ C  +P  CP         +  S        G+ +RSRLCNNP P   G+ C G   + + C
Sbjct:  362 ITRIRLCNSPKPQLGGKNCTGAGRETKQCEGIP--CP-INGKWGPWSPWSSCTVTCGGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 447          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Thbs1 (thrombospondin 1 [Source:MGI Symbol;Acc:MGI:98737])

HSP 1 Score: 48.1358 bits (113), Expect = 3.400e-7
Identity = 31/92 (33.70%), Postives = 46/92 (50.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV--PLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P+P   G+ C G + +T++C     P+N           +           G+ +RSRLCNNP P   G+DC G  T+ Q C
Sbjct:  456 VITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPIN-----GGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQVC 542          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Thbs2 (thrombospondin 2 [Source:MGI Symbol;Acc:MGI:98738])

HSP 1 Score: 48.1358 bits (113), Expect = 3.639e-7
Identity = 40/89 (44.94%), Postives = 56/89 (62.92%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + R RLCN+P P   G++C G   +T+ C   P  CP++G WS WS WS+C+V+C    I +RSR+CN+P P   G+DC G  T+ Q C
Sbjct:  458 VTRIRLCNSPVPQMGGKNCKGSGRETKPCQRDP--CPIDGRWSPWSPWSACTVTCAGG-IRERSRVCNSPEPQYGGKDCVGDVTEHQMC 543          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Unc5b (unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI:894703])

HSP 1 Score: 48.1358 bits (113), Expect = 3.804e-7
Identity = 41/89 (46.07%), Postives = 53/89 (59.55%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G +    +CT V   CPV+G+W+ WS WS+CS  C       RSR C  P P N G+DCSG   D+++CT
Sbjct:  268 KRTRTCTNPAPLNGGAFCEGQAFQKTACTTV---CPVDGAWTEWSKWSACSTECAH----WRSRECMAPPPQNGGRDCSGTLLDSKNCT 349          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Unc5b (unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI:894703])

HSP 1 Score: 48.1358 bits (113), Expect = 4.195e-7
Identity = 41/89 (46.07%), Postives = 53/89 (59.55%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G +    +CT V   CPV+G+W+ WS WS+CS  C       RSR C  P P N G+DCSG   D+++CT
Sbjct:  268 KRTRTCTNPAPLNGGAFCEGQAFQKTACTTV---CPVDGAWTEWSKWSACSTECAH----WRSRECMAPPPQNGGRDCSGTLLDSKNCT 349          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 48.1358 bits (113), Expect = 4.379e-7
Identity = 40/89 (44.94%), Postives = 51/89 (57.30%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G S    +CT +   CPV+G W+SWS WS+C   C       R R C  PAP N G+DC GL   +++CT
Sbjct:  208 KRTRTCTNPAPLNGGAFCEGQSVQKIACTTL---CPVDGRWTSWSKWSTCGTECTH----WRRRECTAPAPKNGGKDCDGLVLQSKNCT 289          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|C5IAW9|UN5BB_XENLA (Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 GN=unc5b-b PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.624e-6
Identity = 40/89 (44.94%), Postives = 52/89 (58.43%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G      +C  +   CPV+G W+ WS WS+CS  C       RSR CN P P N G+DCSG+  D+++CT
Sbjct:  271 KRTRTCTNPAPLNGGTMCEGQQYQKFACNTM---CPVDGGWTEWSKWSACSTECTH----WRSRECNAPTPKNGGKDCSGMLLDSKNCT 352          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q8JGT4|UN5BA_XENLA (Netrin receptor UNC5B-a OS=Xenopus laevis OX=8355 GN=unc5b-a PE=2 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 1.722e-6
Identity = 40/89 (44.94%), Postives = 52/89 (58.43%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C G      +C  +   CPV+G W+ WS WS+CS  C       RSR CN P P N G+DCSG+  D+++CT
Sbjct:  271 KRTRTCTNPAPLNGGTMCEGQQYQKFACNTM---CPVDGGWTEWSKWSACSTECTH----WRSRECNAPTPKNGGKDCSGMLLDSKNCT 352          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q28178|TSP1_BOVIN (Thrombospondin-1 OS=Bos taurus OX=9913 GN=THBS1 PE=2 SV=2)

HSP 1 Score: 48.521 bits (114), Expect = 2.180e-6
Identity = 41/90 (45.56%), Postives = 57/90 (63.33%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P+P   G+ C G + +T++C     +CP+NG W  WS W  CSV+CG   + +RSRLCNNP P   G+DC G  T+ Q C
Sbjct:  455 VITRIRLCNSPSPQMNGKPCEGKARETKACQKD--SCPINGGWGPWSPWDICSVTCGGG-VQKRSRLCNNPKPQFGGKDCVGDVTENQIC 541          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|P07996|TSP1_HUMAN (Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2)

HSP 1 Score: 48.521 bits (114), Expect = 2.310e-6
Identity = 31/92 (33.70%), Postives = 46/92 (50.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV--PLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P+P   G+ C G + +T++C     P+N           +           G+ +RSRLCNNP P   G+DC G  T+ Q C
Sbjct:  455 VITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPIN-----GGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQIC 541          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|P35441|TSP1_MOUSE (Thrombospondin-1 OS=Mus musculus OX=10090 GN=Thbs1 PE=1 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 2.333e-6
Identity = 31/92 (33.70%), Postives = 46/92 (50.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV--PLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P+P   G+ C G + +T++C     P+N           +           G+ +RSRLCNNP P   G+DC G  T+ Q C
Sbjct:  455 VITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPIN-----GGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQVC 541          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A0H3YFF8 (PKD1L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD1L-2 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.532e-18
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCS 323
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNG WSSWSTWSSCS SCG      R+R C+NP+P N G  CS
Sbjct:  276 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGT-RSRTRNCDNPSPLNGGLGCS 355          

HSP 2 Score: 77.411 bits (189), Expect = 5.141e-14
Identity = 67/88 (76.14%), Postives = 74/88 (84.09%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            RSR+C +   SN+G  C G   DTQ+C N  L CP+NG+WSSW+TWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  222 RSRVCIDS--SNSGLPCPGTDKDTQACGNSTL-CPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 306          
BLAST of PKD1L-2 vs. TrEMBL
Match: A7SKI9 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g121678 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 6.784e-10
Identity = 45/90 (50.00%), Postives = 63/90 (70.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            IM R+R C+NP P++ G++C G + +T++C   P  CPVNG WS +S WSSC+ SCG   IM R+R C NP P+N GQ+C G  T+T++C
Sbjct:   21 IMSRTRTCSNPKPAHGGKECEGDAKETKACGISP--CPVNGGWSDFSKWSSCTKSCGGG-IMSRTRTCTNPKPANGGQECKGDETETKAC 107          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A3M6UFN0 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00013779 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.041e-9
Identity = 46/89 (51.69%), Postives = 57/89 (64.04%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTD--TQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            R RLCNNP P + G+DCSGL  D  T+SCT     CPV+G W  WS WS CSV+CG   ++ R R CNNP P+  G+DC G   +T+ C
Sbjct: 2556 RDRLCNNPEPKDGGKDCSGLGKDSETKSCTPPIKKCPVDGGWGDWSDWSKCSVTCGGGELI-RERKCNNPKPAADGKDCEGDEAETKEC 2643          

HSP 2 Score: 55.4546 bits (132), Expect = 2.487e-6
Identity = 35/88 (39.77%), Postives = 43/88 (48.86%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGL--STDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQS 347
            R R C NP PS  G+DCSGL  S  ++ C+N   NCP      +     S        GI QR R C NP P + G+DCS L    Q+
Sbjct: 2406 RERTCTNPPPSAGGKDCSGLGPSKSSRECSN--QNCP-IDGGYTNWNGWSKCSVSCGGGIRQRDRQCTNPKPQHGGKDCSELGPIRQT 2490          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A3M6U2W8 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010651 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 8.967e-9
Identity = 45/90 (50.00%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            I  R R C NP P N G+DCSG   D Q C      CPVNGSW+ WS W SCS++CG  GI +R R C NP P+N G +C G   +T++C
Sbjct:  243 IQGRRRYCINPPPKNGGRDCSGKGYDVQRCNT--QGCPVNGSWTEWSDWGSCSLTCGDGGIKKRIRTCTNPPPANGGLECEGAGEETEAC 330          

HSP 2 Score: 54.6842 bits (130), Expect = 3.679e-6
Identity = 40/91 (43.96%), Postives = 56/91 (61.54%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            I +R R C NP P+N G +C G   +T++C      CPV+G W  WS W  CS SCG+  I  R R C+NP P++ G+ C G ST+T++C+
Sbjct:  301 IKKRIRTCTNPPPANGGLECEGAGEETEACK--AGECPVDGKWGEWSDWGVCSRSCGTG-IQSRFRDCDNPPPAHGGKQCPGSSTETRNCS 388          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A2B4STD3 (Plasma kallikrein OS=Stylophora pistillata OX=50429 GN=Klkb1 PE=3 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.393e-8
Identity = 35/87 (40.23%), Postives = 47/87 (54.02%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            RSR C+NPAP N G+ C+G ST++Q+C  +P   P            +        G M RSR C+NPAP N G+ C G S++T  C
Sbjct:  185 RSRTCSNPAPKNGGRACAGSSTESQACNTLPCKVP-VDGKWGVWGKWTTCSKTCGGGYMSRSRTCSNPAPQNGGRPCQGPSSETARC 270          

HSP 2 Score: 57.3806 bits (137), Expect = 4.574e-7
Identity = 41/89 (46.07%), Postives = 57/89 (64.04%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            M R R C+NPAP N G+ C+G S +   C   P   P+NG+W +W  WS+C+ +CG      RSR C+NPAP N G+ C+G ST++Q+C
Sbjct:  124 MSRRRTCSNPAPRNGGRTCTGASVNYYQCNRTPCKVPINGNWGAWRQWSTCTKTCGGGE-KSRSRTCSNPAPKNGGRACAGSSTESQAC 211          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: thbs1b (thrombospondin-1-like [Source:NCBI gene;Acc:103031445])

HSP 1 Score: 52.373 bits (124), Expect = 9.794e-9
Identity = 42/90 (46.67%), Postives = 53/90 (58.89%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+DC G    T+ C   P  CP+NG W  WS W  CS++CG      R RLCN+PAP   G+DC G +T TQ C
Sbjct:  463 VITRIRLCNSPTPQMGGKDCQGQGRQTEKCEKSP--CPINGGWGPWSPWDKCSLTCGGGT-QSRKRLCNDPAPKYGGKDCVGDATATQIC 549          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: ENSAMXT00000044661.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001762.1:6524:8010:-1 gene:ENSAMXG00000044078.1 transcript:ENSAMXT00000044661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.096e-8
Identity = 29/89 (32.58%), Postives = 42/89 (47.19%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            QR+RLC +PAP + G+ C G        +N P   P         +         + G M+R R C NP P+N G+ C+G  T+ Q C+
Sbjct:  122 QRTRLCASPAPQHGGRQCEGNDIHIDF-SNYPFTAPTVNGNWGPWSSWGSCSRTCNGGQMRRYRTCENPRPANGGRACAGADTEIQKCS 209          

HSP 2 Score: 48.9062 bits (115), Expect = 1.396e-7
Identity = 41/89 (46.07%), Postives = 55/89 (61.80%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            M+R R C NP P+N G+ C+G  T+ Q C+    +CPV+G+W  W  W  CS SCGS    +R R+CN+P+PSN G+ C G ST    C
Sbjct:  180 MRRYRTCENPRPANGGRACAGADTEIQKCSTE--SCPVDGNWGLWQPWGECSASCGSGE-QKRVRICNSPSPSNKGRPCPGDSTQLSKC 265          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 48.9062 bits (115), Expect = 1.493e-7
Identity = 41/91 (45.05%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            I +RSR C NPAP N G  C G+S    +CT+    CPV+G WS W+ WS CS  C      QR R C +P P + G+ C G + DT++CT
Sbjct:  245 IQRRSRTCTNPAPLNGGAFCEGMSVQKSTCTS---PCPVDGGWSGWTEWSVCSSECER----QRGRECTDPEPKHGGRLCDGAALDTENCT 328          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 48.9062 bits (115), Expect = 1.523e-7
Identity = 41/91 (45.05%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            I +RSR C NPAP N G  C G+S    +CT+    CPV+G WS W+ WS CS  C      QR R C +P P + G+ C G + DT++CT
Sbjct:  245 IQRRSRTCTNPAPLNGGAFCEGMSVQKSTCTS---PCPVDGGWSGWTEWSVCSSECER----QRGRECTDPEPKHGGRLCDGAALDTENCT 328          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 47.7506 bits (112), Expect = 4.165e-7
Identity = 42/89 (47.19%), Postives = 49/89 (55.06%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +RSR C NPAP N G  C G S  T +CT     CPV+G WS WS WS+C   C     M RSR C  PAP   G+ C GL   + +CT
Sbjct:  262 KRSRSCTNPAPLNGGTACEGQSVQTSACTA---TCPVDGGWSEWSKWSACGTDCT----MWRSRECTQPAPGTGGKSCQGLDLQSLNCT 343          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 46.2098 bits (108), Expect = 2.552e-7
Identity = 39/87 (44.83%), Postives = 52/87 (59.77%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            R RLCN+P P   G +C G   + Q C   P  CPV+G +  WS WS+C V+CG   + +R+RLCNNP P   G+DC G   +T+ C
Sbjct:  454 RIRLCNSPVPQMGGDECDGSGRENQKCEMEP--CPVDGQYGPWSPWSACPVTCGGA-LRERARLCNNPKPQYNGKDCLGSDRETEIC 537          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000917.1 (pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 8.396e-7
Identity = 36/90 (40.00%), Postives = 49/90 (54.44%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + +R R C  P P+  G+DC G  ++ + C      C  +G+WS WS W+ CS SCG  G+  R+R C+ PAP   G  C G   DTQ C
Sbjct:  963 VQRRYRFCTEPPPAGEGRDCGGPGSEERVCNT--HACTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQEC 1050          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000925.1 (pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 1.078e-6
Identity = 36/90 (40.00%), Postives = 49/90 (54.44%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            + +R R C  P P+  G+DC G  ++ + C      C  +G+WS WS W+ CS SCG  G+  R+R C+ PAP   G  C G   DTQ C
Sbjct:  800 VQRRYRFCTEPPPAGEGRDCGGPGSEERVCNT--HACTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQEC 887          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008404.1 (pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-1 gene:ENSPMAG00000007555.1 transcript:ENSPMAT00000008404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.2838 bits (103), Expect = 1.367e-6
Identity = 39/89 (43.82%), Postives = 51/89 (57.30%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R+R C NPAP N G  C+G  T    C+ +   CPV+G W  WS WS+C   C       RSR C+NPAP N G+DC G    +Q+C+
Sbjct:  231 KRTRSCTNPAPLNGGAVCNGQGTQKIPCSTI---CPVDGGWVEWSKWSTCGPDCTH----WRSRECSNPAPVNGGKDCHGSPLQSQNCS 312          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003861.1 (pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 gene:ENSPMAG00000003466.1 transcript:ENSPMAT00000003861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 2.222e-6
Identity = 39/89 (43.82%), Postives = 51/89 (57.30%), Query Frame = 3
Query:   87 QRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            +R R C NPAP N G  C G +++   CT+    CPV+G W  WS WS+C   C       RSR C+NPAP N G+DC G    +Q+C+
Sbjct:  257 KRIRTCTNPAPLNGGPFCDGQASENTPCTSA---CPVDGGWVEWSKWSTCGPDCTH----WRSRECSNPAPVNGGKDCHGSPLQSQNCS 338          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO35765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKI9])

HSP 1 Score: 62.003 bits (149), Expect = 9.382e-14
Identity = 45/90 (50.00%), Postives = 63/90 (70.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            IM R+R C+NP P++ G++C G + +T++C   P  CPVNG WS +S WSSC+ SCG   IM R+R C NP P+N GQ+C G  T+T++C
Sbjct:   21 IMSRTRTCSNPKPAHGGKECEGDAKETKACGISP--CPVNGGWSDFSKWSSCTKSCGGG-IMSRTRTCTNPKPANGGQECKGDETETKAC 107          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO48338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJU9])

HSP 1 Score: 51.6026 bits (122), Expect = 9.416e-10
Identity = 33/87 (37.93%), Postives = 42/87 (48.28%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            R R CNNPAPSN GQ C G   ++ SC    + CPV     S     S        G   R R C NP+P N G+ C G+   +++C
Sbjct:   28 RRRACNNPAPSNGGQQCLGDDVESGSCMTT-VACPVVDGGWSEYGPWSVCSKSCGGGERYRERTCTNPSPVNGGKTCDGIGMQSETC 113          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO49967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES9])

HSP 1 Score: 50.8322 bits (120), Expect = 2.021e-9
Identity = 33/87 (37.93%), Postives = 42/87 (48.28%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            R+R C NPAP   G+ C G STD QSC  +P          S  +           G   R+R CN+PAP N G+ C G S  T++C
Sbjct:   28 RTRTCTNPAPIGGGRSCYGSSTDKQSCNPIPCR---VDGQWSSWSGWDSCSMSCGGGTQSRTRACNSPAPRNGGRQCPGQSGQTRNC 111          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO49968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RET0])

HSP 1 Score: 50.0618 bits (118), Expect = 2.962e-9
Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            +  RSR+CN P+P + G+ C G + +T+SC +   +CP      S  +           G+ +R+R C NPAP   G+ C G S++ Q C
Sbjct:   21 VQARSRMCNKPSPRDGGRTCPGKTVETRSCNS--RDCP-IDGKWSSWSSWQTCSRTCGGGMRKRTRSCTNPAPKGGGRGCYGRSSEQQIC 107          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO49202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHC2])

HSP 1 Score: 49.2914 bits (116), Expect = 7.291e-9
Identity = 43/92 (46.74%), Postives = 58/92 (63.04%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGL--STDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            I QR+R C+NPAP N G  C  L  S +TQ+C + P  CPV+G +S W  ++ CSV+CG    M R R C NP P+N G+ C G +T+T+ C
Sbjct:   21 IQQRTRACSNPAPKNNGTSCESLGPSFETQACNSKP--CPVDGGFSEWGNYTECSVTCGGGTQM-RLRTCTNPQPANGGRPCLGETTETKDC 109          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: thbs1b (thrombospondin-1a [Source:NCBI gene;Acc:100302438])

HSP 1 Score: 52.7582 bits (125), Expect = 8.662e-9
Identity = 41/90 (45.56%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+ C G +  TQ C   P  CP+NG+W  WS W  C+++CG   +  R RLCNNPAP   G++C G +TD Q C
Sbjct:  450 VITRIRLCNSPTPQLGGKQCEGEARQTQKCQKSP--CPINGNWGPWSPWDLCTLTCGGG-VQTRKRLCNNPAPLYGGKECVGEATDRQMC 536          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: thbs1b (thrombospondin-1a [Source:NCBI gene;Acc:100302438])

HSP 1 Score: 52.373 bits (124), Expect = 1.010e-8
Identity = 41/90 (45.56%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+ C G +  TQ C   P  CP+NG+W  WS W  C+++CG   +  R RLCNNPAP   G++C G +TD Q C
Sbjct:  432 VITRIRLCNSPTPQLGGKQCEGEARQTQKCQKSP--CPINGNWGPWSPWDLCTLTCGGG-VQTRKRLCNNPAPLYGGKECVGEATDRQMC 518          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: thbs1b (thrombospondin-1a [Source:NCBI gene;Acc:100302438])

HSP 1 Score: 52.373 bits (124), Expect = 1.022e-8
Identity = 41/90 (45.56%), Postives = 55/90 (61.11%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            ++ R RLCN+P P   G+ C G +  TQ C   P  CP+NG+W  WS W  C+++CG   +  R RLCNNPAP   G++C G +TD Q C
Sbjct:  451 VITRIRLCNSPTPQLGGKQCEGEARQTQKCQKSP--CPINGNWGPWSPWDLCTLTCGGG-VQTRKRLCNNPAPLYGGKECVGEATDRQMC 537          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: ENSORLT00000035893.1 (pep primary_assembly:ASM223467v1:19:12271965:12274626:-1 gene:ENSORLG00000025797.1 transcript:ENSORLT00000035893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.091e-7
Identity = 30/88 (34.09%), Postives = 44/88 (50.00%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQS 347
            + R RLCNNP P   G+ C G++ +TQ C N    CP      +  +  S        G+  R R C NPAP + G+ C+G + D ++
Sbjct:   61 ITRVRLCNNPPPQKGGKACKGVAMETQPCKNTL--CP-IAGGWTAWSHWSECSMTCGGGLKSRQRQCLNPAPQHGGKPCAGEAADYEA 145          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: unc5da (netrin receptor UNC5D [Source:NCBI gene;Acc:101173079])

HSP 1 Score: 47.7506 bits (112), Expect = 3.714e-7
Identity = 40/91 (43.96%), Postives = 52/91 (57.14%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            + +RSR C NPAP N G  C G+S    +C  V   CPV+G W  WS WS+CS  C      QRSR C +P P + G+ C G++  T +CT
Sbjct:  272 VQKRSRTCTNPAPLNGGSFCEGMSVQKSTCNTV---CPVDGGWGDWSEWSACSSDCER----QRSRECTSPEPKHGGRLCDGVAVATDNCT 355          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 130.954 bits (328), Expect = 1.951e-36
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  278 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 368          

HSP 2 Score: 128.257 bits (321), Expect = 2.249e-35
Identity = 89/91 (97.80%), Postives = 90/91 (98.90%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV LNCPVNG+WSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  338 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 428          

HSP 3 Score: 85.8853 bits (211), Expect = 1.337e-20
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCS 323
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNG WSSWSTWSSCS SCG      R+R C+NP+P N G  CS
Sbjct:  398 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGT-RSRTRNCDNPSPLNGGLGCS 477          

HSP 4 Score: 76.6406 bits (187), Expect = 2.062e-17
Identity = 67/88 (76.14%), Postives = 74/88 (84.09%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            RSR+C +   SN+G  C G   DTQ+C N  L CP+NG+WSSW+TWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  224 RSRVCIDS--SNSGLPCPGTDKDTQACGNSTL-CPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 308          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 130.954 bits (328), Expect = 1.988e-36
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  276 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 366          

HSP 2 Score: 128.257 bits (321), Expect = 2.271e-35
Identity = 89/91 (97.80%), Postives = 90/91 (98.90%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV LNCPVNG+WSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  336 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 426          

HSP 3 Score: 85.8853 bits (211), Expect = 1.390e-20
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCS 323
            IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNG WSSWSTWSSCS SCG      R+R C+NP+P N G  CS
Sbjct:  396 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGT-RSRTRNCDNPSPLNGGLGCS 475          

HSP 4 Score: 76.6406 bits (187), Expect = 2.062e-17
Identity = 67/88 (76.14%), Postives = 74/88 (84.09%), Query Frame = 3
Query:   90 RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            RSR+C +   SN+G  C G   DTQ+C N  L CP+NG+WSSW+TWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT
Sbjct:  222 RSRVCIDS--SNSGLPCPGTDKDTQACGNSTL-CPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 306          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000024603.1 (SMESG000024603.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.064e-8
Identity = 40/93 (43.01%), Postives = 58/93 (62.37%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXX---XXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            +M R RLCN+P P   G++C+ + T+T +C N P   P++G+WS WS WS+CS +     S  +  RSRLCNNP P + G  C G S +++ C
Sbjct:  142 LMTRFRLCNSPPPQLGGKNCTVIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFC 234          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014728.1 (SMESG000014728.1)

HSP 1 Score: 44.669 bits (104), Expect = 3.568e-6
Identity = 21/36 (58.33%), Postives = 24/36 (66.67%), Query Frame = 3
Query:   84 MQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNC 191
            +QR+R CNNP PSN G +CSG S D Q C N   NC
Sbjct:  272 IQRTRECNNPFPSNGGVNCSGPSVDNQMCFNYSQNC 307          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 43.8986 bits (102), Expect = 6.585e-6
Identity = 29/90 (32.22%), Postives = 43/90 (47.78%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 350
            I Q++R C+NP P   G +C G +   + C  +P  CP      S     S   +   +G+ +R R C  P+P+  GQ C G S + Q C
Sbjct: 3261 IKQKARRCDNPTPKFGGANCVGTNIKKEKCNELP--CP-VHGQWSNWGSWSECSTECGSGLQERDRTCTEPSPNFGGQWCRGPSKEVQKC 3347          

HSP 2 Score: 43.8986 bits (102), Expect = 7.991e-6
Identity = 40/92 (43.48%), Postives = 58/92 (63.04%), Query Frame = 3
Query:   81 IMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT-NVPLNCPXXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 353
            I QR+R C+NP PSN G+ C G + +   C  N+P  CP+NG+WS W  W+ CS++CG  G  +R R CN+P P N G+ C G   + ++C+
Sbjct: 3145 IRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLP--CPINGAWSEWKPWTVCSITCGFGGSQRRDRSCNSPEPKNNGKFCDGKELEVRACS 3234          
The following BLAST results are available for this feature:
BLAST of PKD1L-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THBS14.811e-733.70thrombospondin 1 [Source:HGNC Symbol;Acc:HGNC:1178... [more]
UNC5B8.324e-744.94unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5B8.331e-744.94unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
SEMA5A8.815e-746.67semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736][more]
SEMA5A8.815e-746.67semaphorin 5A [Source:HGNC Symbol;Acc:HGNC:10736][more]
back to top
BLAST of PKD1L-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thbs1a8.756e-834.44thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
thbs1a9.411e-834.44thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
thbs1b2.201e-733.33thrombospondin 1b [Source:ZFIN;Acc:ZDB-GENE-020708... [more]
thbs1b2.201e-733.33thrombospondin 1b [Source:ZFIN;Acc:ZDB-GENE-020708... [more]
thbs1b2.266e-733.33thrombospondin 1b [Source:ZFIN;Acc:ZDB-GENE-020708... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THBS21.813e-833.71thrombospondin 2 [Source:NCBI gene;Acc:100494997][more]
THBS21.423e-733.71thrombospondin 2 [Source:NCBI gene;Acc:100494997][more]
THBS21.624e-733.71thrombospondin 2 [Source:NCBI gene;Acc:100494997][more]
THBS21.774e-733.71thrombospondin 2 [Source:NCBI gene;Acc:100494997][more]
THBS21.781e-733.71thrombospondin 2 [Source:NCBI gene;Acc:100494997][more]
back to top
BLAST of PKD1L-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Thbs13.400e-733.70thrombospondin 1 [Source:MGI Symbol;Acc:MGI:98737][more]
Thbs23.639e-744.94thrombospondin 2 [Source:MGI Symbol;Acc:MGI:98738][more]
Unc5b3.804e-746.07unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI... [more]
Unc5b4.195e-746.07unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI... [more]
Unc5c4.379e-744.94unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of PKD1L-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|C5IAW9|UN5BB_XENLA1.624e-644.94Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 ... [more]
sp|Q8JGT4|UN5BA_XENLA1.722e-644.94Netrin receptor UNC5B-a OS=Xenopus laevis OX=8355 ... [more]
sp|Q28178|TSP1_BOVIN2.180e-645.56Thrombospondin-1 OS=Bos taurus OX=9913 GN=THBS1 PE... [more]
sp|P07996|TSP1_HUMAN2.310e-633.70Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 ... [more]
sp|P35441|TSP1_MOUSE2.333e-633.70Thrombospondin-1 OS=Mus musculus OX=10090 GN=Thbs1... [more]
back to top
BLAST of PKD1L-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFF85.532e-1880.25PKD1L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD1... [more]
A7SKI96.784e-1050.00Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A3M6UFN03.041e-951.69Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A3M6U2W88.967e-950.00Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2B4STD32.393e-840.23Plasma kallikrein OS=Stylophora pistillata OX=5042... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thbs1b9.794e-946.67thrombospondin-1-like [Source:NCBI gene;Acc:103031... [more]
ENSAMXT00000044661.12.096e-832.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
unc5da1.493e-745.05unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5da1.523e-745.05unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5a4.165e-747.19unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thbs1a2.552e-744.83thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
ENSPMAT00000000917.18.396e-740.00pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gen... [more]
ENSPMAT00000000925.11.078e-640.00pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 ge... [more]
ENSPMAT00000008404.11.367e-643.82pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-... [more]
ENSPMAT00000003861.12.222e-643.82pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 g... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO357659.382e-1450.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483389.416e-1037.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499672.021e-937.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499682.962e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492027.291e-946.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thbs1b8.662e-945.56thrombospondin-1a [Source:NCBI gene;Acc:100302438][more]
thbs1b1.010e-845.56thrombospondin-1a [Source:NCBI gene;Acc:100302438][more]
thbs1b1.022e-845.56thrombospondin-1a [Source:NCBI gene;Acc:100302438][more]
ENSORLT00000035893.11.091e-734.09pep primary_assembly:ASM223467v1:19:12271965:12274... [more]
unc5da3.714e-743.96netrin receptor UNC5D [Source:NCBI gene;Acc:101173... [more]
back to top
BLAST of PKD1L-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014725.11.951e-36100.00SMESG000014725.1[more]
SMESG000014725.11.988e-36100.00SMESG000014725.1[more]
SMESG000024603.11.064e-843.01SMESG000024603.1[more]
SMESG000014728.13.568e-658.33SMESG000014728.1[more]
SMESG000021248.16.585e-632.22SMESG000021248.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001229 ID=SMED30001229|Name=PKD1L-2|organism=Schmidtea mediterranea sexual|type=transcript|length=353bp
CATTGAATTGTCCAGTTAATGGAAGTTGGAGTTCATGGAGTACATGGTCA
TCATGCTCGGTTTCGTGTGGATCCAATGGCATTATGCAAAGAAGCCGCCT
ATGTAACAATCCGGCACCGTCAAACGCTGGACAGGACTGTTCTGGTCTTT
CAACTGATACTCAAAGCTGTACAAATGTTCCATTGAATTGTCCAGTTAAT
GGAAGTTGGAGTTCATGGAGTACATGGTCATCATGCTCGGTTTCGTGTGG
ATCCAATGGCATTATGCAAAGAAGCCGCCTATGTAACAATCCGGCACCGT
CAAACGCTGGACAGGACTGTTCTGGTCTTTCAACTGATACTCAAAGCTGT
ACA
back to top

protein sequence of SMED30001229-orf-1

>SMED30001229-orf-1 ID=SMED30001229-orf-1|Name=SMED30001229-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
LNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLS
TDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPS
NAGQDCSGLSTDTQSCT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004096catalase activity
GO:0020037heme binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0098869cellular oxidant detoxification
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0007520dorsal-ventral axis of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR000884TSP1_rpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01705TSP1REPEATcoord: 3..16
score: 54.27
coord: 22..33
score: 44.35
coord: 41..52
score: 34.23
NoneNo IPR availablePANTHERPTHR22906:SF11PROPERDINcoord: 2..112
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 2..112
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 5..60
e-value: 2.5E-11
score: 53.6
coord: 65..113
e-value: 3.9E-7
score: 39.7
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 6..54
e-value: 2.8E-13
score: 49.8
coord: 66..113
e-value: 3.4E-12
score: 46.4
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 2..60
score: 12.901
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 62..113
score: 12.112
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 62..113
e-value: 3.5E-18
score: 67.6
coord: 2..56
e-value: 1.8E-18
score: 68.4
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 1..52
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 59..112