persulfide dioxygenase ETHE1, mitochondrial

Overview
Namepersulfide dioxygenase ETHE1, mitochondrial
Smed IDSMED30001222
Length (bp)968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of persulfide dioxygenase ETHE1, mitochondrial (SMED30001222) t-SNE clustered cells

Violin plots show distribution of expression levels for persulfide dioxygenase ETHE1, mitochondrial (SMED30001222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of persulfide dioxygenase ETHE1, mitochondrial (SMED30001222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for persulfide dioxygenase ETHE1, mitochondrial (SMED30001222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30001222h1SMcG0008525 dd_Smed_v4_4089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001222h1SMcG0008525 dd_Smed_v4_4089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001222h1SMcG0008525 dd_Smed_v4_4089_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30001222h1SMcG0008525 dd_Smed_v4_4089_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: ETHE1 (ETHE1 persulfide dioxygenase [Source:HGNC Symbol;Acc:HGNC:23287])

HSP 1 Score: 287.345 bits (734), Expect = 1.277e-96
Identity = 132/229 (57.64%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  129 SDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            +  L RQ+FEPVSCT+TYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y +NTH HADHITGSG L+S  P  +SVIS  SGA+AD+ + D D + FG+F L  + +PGHT GC+T++ ++  MAFTGD+LLIRGCGRTDFQ+G A  L+ +VH  I +LP   L+YPAHDY G  V+TV+EE   NPRLT + EEF+ IM NLNL  P+QID A+PAN+ CG+
Sbjct:   21 APILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGV 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: ETHE1 (ETHE1 persulfide dioxygenase [Source:HGNC Symbol;Acc:HGNC:23287])

HSP 1 Score: 271.937 bits (694), Expect = 1.779e-90
Identity = 126/221 (57.01%), Postives = 161/221 (72.85%), Query Frame = 3
Query:  129 SDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRAL 791
            +  L RQ+FEPVSCT+TYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y +NTH HADHITGSG L+S  P  +SVIS  SGA+AD+ + D D + FG+F L  + +PGHT GC+T++ ++  MAFTGD+LLIRGCGRTDFQ+G A  L+ +VH  I +LP   L+YPAHDY G  V+TV+EE   NPRLT + EEF+ IM NLNL  P+QI   L
Sbjct:   21 APILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIGEQL 241          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: ETHE1 (ETHE1 persulfide dioxygenase [Source:HGNC Symbol;Acc:HGNC:23287])

HSP 1 Score: 76.6406 bits (187), Expect = 5.375e-17
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  138 LFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSK 365
            L RQ+FEPVSCT+TYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y            G G     +PH +
Sbjct:   24 LLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLY-----------AGVGDQGQPWPHPR 88          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: ETHE1 (ETHE1 persulfide dioxygenase [Source:HGNC Symbol;Acc:HGNC:23287])

HSP 1 Score: 76.6406 bits (187), Expect = 5.375e-17
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  138 LFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSK 365
            L RQ+FEPVSCT+TYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y            G G     +PH +
Sbjct:   24 LLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLY-----------AGVGDQGQPWPHPR 88          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Match: PNKD (PNKD metallo-beta-lactamase domain containing [Source:HGNC Symbol;Acc:HGNC:9153])

HSP 1 Score: 69.707 bits (169), Expect = 6.478e-13
Identity = 55/174 (31.61%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  162 VSCTYTYLLGDKNKKEAILIDPVFETVARDVKL-INQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADV-KLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFD-----ELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            +S  Y+YL+ D   + A+ +DP   +  R V+  I +  V L  I+ TH H DH  G+  L       +   S   G       L   DVV  G+ ++    TPGHT G + Y+ D          F+GD L + GCGRT   EG+A  +  ++   +L L    LL+P H+Y 
Sbjct:   67 LSDNYSYLIIDTQAQLAVAVDP---SDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTF--EGNAETMLSSLD-TVLGLGDDTLLWPGHEYA 234          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Celegans
Match: ethe-1 (ETHE1 (Human ETHylmalonic Encephalopathy) homolog [Source:UniProtKB/TrEMBL;Acc:O17636])

HSP 1 Score: 261.536 bits (667), Expect = 4.850e-87
Identity = 120/222 (54.05%), Postives = 164/222 (73.87%), Query Frame = 3
Query:  138 LFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANL 803
            +FRQL E  S TYTY++G     +A++IDPV +TV+RD+++I  L ++L Y +NTHVHADHITG+  LK+ FP  KSV+SS SG +AD  + D +++E G  KL  + TPGHTNGC+TY+   L  AFTGD+LLIR CGRTDFQ+G+   LFD+VH  I +LP  +++Y  H+Y G + TTV EE   NPRLTK++++F+ IM+NL L YPKQID+A+PAN+
Sbjct:   10 IFRQLIEFKSSTYTYIIGCHKTGKAVIIDPVVDTVSRDIQIIRDLNLDLIYGLNTHVHADHITGTNSLKTVFPTMKSVLSSKSGGEADKYVSDGEIIEIGGLKLEVRETPGHTNGCLTYVEHSLRSAFTGDALLIRACGRTDFQQGNPASLFDSVHDKIFTLPEDYVVYVGHNYNGVLQTTVWEEKNLNPRLTKSKDQFVEIMKNLKLNYPKQIDKAVPANM 231          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Celegans
Match: Y17G7B.3 (pep chromosome:WBcel235:II:11989024:11992823:1 gene:WBGene00012459.1 transcript:Y17G7B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y17G7B.3)

HSP 1 Score: 71.633 bits (174), Expect = 3.134e-14
Identity = 46/160 (28.75%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  204 KEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFD-------ELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            + A+L+D V E   ++  L ++  +++  ++ TH H DH  G+   +  FP+   +         D  +   D+ EF   ++ C  TP HT+G + Y            G+ FTGD+L I GCGR  F EG A ++   ++  + +LP    ++P H+YT
Sbjct:   25 RAALLVDLVNEEDYKE--LADKENIDITAVLTTHHHYDHCGGNEGFRRQFPNVMILGGDSRIPAMDRHVKHGDMAEFAGLQIKCLSTPCHTSGHICYHITNPAADSTSPGVVFTGDTLFIAGCGR--FFEGTAPQMDVALNEILKNLPVETQIFPGHEYT 180          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: CG30022 (gene:FBgn0050022 transcript:FBtr0289990)

HSP 1 Score: 278.485 bits (711), Expect = 5.195e-93
Identity = 132/232 (56.90%), Postives = 165/232 (71.12%), Query Frame = 3
Query:  123 FKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
            F  DF FRQLF+  S TY+YLL D    +A++IDPV E   RD +L+  L   LKY INTH+HADHITGSG L+      +SVI++ SGAKAD  L + D ++FG   +    TPGHTNGCMTY+  + G  FTGD+LLIRGCGRTDFQEG    L++NVH  I +LP +F +YPAHDY GQM ++V EE +YNPRLTK  EEF+ IM+NLNL YPK+ID +LPAN  CG++
Sbjct:   44 FSPDFFFRQLFDGESSTYSYLLADLKNGQAVIIDPVLEQAKRDAQLVKDLGFELKYAINTHMHADHITGSGWLRK-LTGCQSVIAAASGAKADRHLNEGDRIDFGTHVIDALATPGHTNGCMTYVIKDQGCVFTGDTLLIRGCGRTDFQEGCPRNLYENVHSKIFTLPENFRIYPAHDYKGQMESSVWEEKRYNPRLTKDIEEFVKIMENLNLPYPKKIDASLPANRECGVY 274          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: tzn (gene:FBgn0037024 transcript:FBtr0078252)

HSP 1 Score: 73.1738 bits (178), Expect = 1.259e-14
Identity = 51/174 (29.31%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDEL-----GMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQ 668
            Y YL+ D   +EA ++DPV   +   +K + + ++ L  ++ TH H DH  G+ KL   +     V   Y G       + K+  +D    G   + C  TP HT G + Y          G  FTGD+L   GCGR  F EG   ++++ +   + +LP    ++  H+YT Q
Sbjct:   25 YMYLIVDTKTREAAVVDPVEPELV--IKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELDV---YGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQ 191          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: tzn (gene:FBgn0037024 transcript:FBtr0078253)

HSP 1 Score: 73.559 bits (179), Expect = 1.410e-14
Identity = 51/174 (29.31%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDEL-----GMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQ 668
            Y YL+ D   +EA ++DPV   +   +K + + ++ L  ++ TH H DH  G+ KL   +     V   Y G       + K+  +D    G   + C  TP HT G + Y          G  FTGD+L   GCGR  F EG   ++++ +   + +LP    ++  H+YT Q
Sbjct:   59 YMYLIVDTKTREAAVVDPVEPELV--IKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELDV---YGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQ 225          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Match: tzn (gene:FBgn0037024 transcript:FBtr0078254)

HSP 1 Score: 73.9442 bits (180), Expect = 1.716e-14
Identity = 51/174 (29.31%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDEL-----GMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQ 668
            Y YL+ D   +EA ++DPV   +   +K + + ++ L  ++ TH H DH  G+ KL   +     V   Y G       + K+  +D    G   + C  TP HT G + Y          G  FTGD+L   GCGR  F EG   ++++ +   + +LP    ++  H+YT Q
Sbjct:  102 YMYLIVDTKTREAAVVDPVEPELV--IKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELDV---YGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQ 268          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 296.975 bits (759), Expect = 4.112e-100
Identity = 140/226 (61.95%), Postives = 173/226 (76.55%), Query Frame = 3
Query:  138 LFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            LFRQLFE  SCTYTYLL D + +EA+LIDPV ETV RD++LI QL +NL   +NTH HADHITG+G LK      KS IS +SGA AD++L D D + FG+  LM + TPGHT+GC+TY+  +  MAFTGD+LLIRGCGRTDFQ+G   +L+++VH+ I SLP H  +YPAHDY GQ V+TVDEE K+NPRLTKT EEF+ IM NLNL  PK+ID ++PANL CG+
Sbjct:   51 LFRQLFESESCTYTYLLADPDTREAVLIDPVLETVDRDLQLIQQLGLNLTVALNTHCHADHITGTGLLKKKVFGLKSGISKHSGAAADIQLSDGDSITFGKHCLMVRETPGHTDGCVTYVTGDQRMAFTGDALLIRGCGRTDFQQGSPHRLYESVHQKIFSLPGHCFIYPAHDYKGQTVSTVDEEKKFNPRLTKTVEEFVKIMDNLNLPKPKKIDISVPANLVCGL 276          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:336977])

HSP 1 Score: 82.0333 bits (201), Expect = 1.866e-17
Identity = 59/194 (30.41%), Postives = 91/194 (46.91%), Query Frame = 3
Query:  108 RKMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIF-----DELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            RK SL +   +  +L   ++  Y YLL D+  KEA ++DPV     + V  + +  V LK ++ TH H DH  G+ KL    P     ++ Y G         K+   +  + G   + C  TP HT+G + Y        E    FTGD+L + GCG+  F EG A +++  +   +  LP    +Y  H+YT
Sbjct:   34 RKSSLVEQSDMKVELLPALTDNYMYLLIDEETKEAAIVDPV--EPQKVVDAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLMPG----LTVYGGDDRVGALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKENSTEAPAVFTGDTLFVAGCGK--FFEGTADEMYKALIEVLGRLPPETRVYCGHEYT 219          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:336977])

HSP 1 Score: 82.0333 bits (201), Expect = 1.866e-17
Identity = 59/194 (30.41%), Postives = 91/194 (46.91%), Query Frame = 3
Query:  108 RKMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIF-----DELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            RK SL +   +  +L   ++  Y YLL D+  KEA ++DPV     + V  + +  V LK ++ TH H DH  G+ KL    P     ++ Y G         K+   +  + G   + C  TP HT+G + Y        E    FTGD+L + GCG+  F EG A +++  +   +  LP    +Y  H+YT
Sbjct:   34 RKSSLVEQSDMKVELLPALTDNYMYLLIDEETKEAAIVDPV--EPQKVVDAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLMPG----LTVYGGDDRVGALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKENSTEAPAVFTGDTLFVAGCGK--FFEGTADEMYKALIEVLGRLPPETRVYCGHEYT 219          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Match: pnkd (PNKD metallo-beta-lactamase domain containing [Source:ZFIN;Acc:ZDB-GENE-050208-278])

HSP 1 Score: 70.8626 bits (172), Expect = 2.396e-13
Identity = 53/175 (30.29%), Postives = 84/175 (48.00%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLE-VNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVK-----LFDNDVVEFG-QFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            Y+Y++ D     A+++DP      + V+   + E V L+ ++ TH H DH  G+  LK  +    S    Y  A  ++      L D D ++FG Q      +TPGHT G M Y+ D   +      F+GD + + GCGR    EG+A  +  ++   + SL    LL+P H+Y 
Sbjct:  106 YSYVVIDTASNTAVVVDPA---DPQPVQACLEAEGVALQAVLCTHKHWDHSGGNRALKRRY----SSCRVYGNAMDNIPGLTHPLLDKDTIDFGTQLHFRAFYTPGHTVGHMIYLLDGRAIGGPSSLFSGDLVFLSGCGR--MFEGNASTMLSSLD-TVGSLNDDTLLWPGHEYA 270          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: ethe1 (ethylmalonic encephalopathy 1 [Source:NCBI gene;Acc:448221])

HSP 1 Score: 301.597 bits (771), Expect = 3.476e-102
Identity = 144/242 (59.50%), Postives = 177/242 (73.14%), Query Frame = 3
Query:   93 LTKLKRKMSLFKSD-FLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            L++ +R  ++  S+  +FRQLFEPVSCTYTYLL DKN KEAILIDPV E   RD KLI  L  N+ +  NTH HADHITG+G LK   P  KSVIS  SGA+ADV + + D ++FG+F +  + TPGHT+GC+TY+ ++  MAFTGD+LLIRGCGRTDFQ+G    L+ +VH  I SLP   LLYP HDYTGQ V++V+EE + NPRLTK   EF+ IM NLNL  PKQID A+PANL CGI
Sbjct:   11 LSQCRRYSAMAASNGLVFRQLFEPVSCTYTYLLADKNTKEAILIDPVLEKAERDAKLIKDLGFNMIFAANTHCHADHITGTGVLKKLLPGCKSVISKDSGARADVYIQEGDQIKFGKFWVEARSTPGHTDGCLTYVLNDQSMAFTGDALLIRGCGRTDFQQGCPKTLYHSVHTKIFSLPDSCLLYPGHDYTGQTVSSVEEEKRLNPRLTKDEAEFVKIMNNLNLPKPKQIDVAVPANLKCGI 252          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: ethe1 (ethylmalonic encephalopathy 1 [Source:NCBI gene;Acc:448221])

HSP 1 Score: 290.812 bits (743), Expect = 3.122e-98
Identity = 138/222 (62.16%), Postives = 164/222 (73.87%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            LFEPVSCTYTYLL DKN KEAILIDPV E   RD KLI  L  N+ +  NTH HADHITG+G LK   P  KSVIS  SGA+ADV + + D ++FG+F +  + TPGHT+GC+TY+ ++  MAFTGD+LLIRGCGRTDFQ+G    L+ +VH  I SLP   LLYP HDYTGQ V++V+EE + NPRLTK   EF+ IM NLNL  PKQID A+PANL CGI
Sbjct:    8 LFEPVSCTYTYLLADKNTKEAILIDPVLEKAERDAKLIKDLGFNMIFAANTHCHADHITGTGVLKKLLPGCKSVISKDSGARADVYIQEGDQIKFGKFWVEARSTPGHTDGCLTYVLNDQSMAFTGDALLIRGCGRTDFQQGCPKTLYHSVHTKIFSLPDSCLLYPGHDYTGQTVSSVEEEKRLNPRLTKDEAEFVKIMNNLNLPKPKQIDVAVPANLKCGI 229          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: mrps12 (mitochondrial ribosomal protein S12 [Source:Xenbase;Acc:XB-GENE-969291])

HSP 1 Score: 72.4034 bits (176), Expect = 4.670e-14
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 3
Query:  252 VKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEF 734
            ++++ +   NLK I+ TH H DH  G+  L   FP  +   +         ++  N  ++FG   + C  TP HT+G M +   E G       F+GD+L I GCG   F EG A ++  N+   + SLP+   ++  H+YT   V  +   LK  P   K +E+ 
Sbjct:    5 LEIVPKEGANLKAILTTHHHLDHSRGNVDLLQRFPELRVYGADDRIGGLTHRVVHNQELKFGGINVRCLFTPCHTSGHMCFYMWEDGCPDAPALFSGDTLFIGGCGM--FYEGTAEQMHKNLSETLGSLPKDTKVFCGHEYT---VRNLKFALKVEPSNEKVKEKL 165          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: mrps12 (mitochondrial ribosomal protein S12 [Source:Xenbase;Acc:XB-GENE-969291])

HSP 1 Score: 72.4034 bits (176), Expect = 5.128e-14
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 3
Query:  252 VKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEF 734
            ++++ +   NLK I+ TH H DH  G+  L   FP  +   +         ++  N  ++FG   + C  TP HT+G M +   E G       F+GD+L I GCG   F EG A ++  N+   + SLP+   ++  H+YT   V  +   LK  P   K +E+ 
Sbjct:   22 LEIVPKEGANLKAILTTHHHLDHSRGNVDLLQRFPELRVYGADDRIGGLTHRVVHNQELKFGGINVRCLFTPCHTSGHMCFYMWEDGCPDAPALFSGDTLFIGGCGM--FYEGTAEQMHKNLSETLGSLPKDTKVFCGHEYT---VRNLKFALKVEPSNEKVKEKL 182          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:100216043])

HSP 1 Score: 70.8626 bits (172), Expect = 2.049e-13
Identity = 51/177 (28.81%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  147 QLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIF-----DELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            +L   ++  Y YLL D+  KEA ++DPV     + V  + +  V L  ++ TH H DH  G+ KL       K             K+      + G   + C +TP HT+G + Y        E    FTGD+L + GCG+  F EG   +++  +   +  LP    +Y  H+YT
Sbjct:   26 ELIPALTDNYMYLLIDEESKEAAIVDPV--QPQKVVDAVKKHGVKLTTVLTTHHHWDHAGGNEKLVKMVSGLKVYGGDSRIGALTQKVSHLTTFQVGSLHVKCLYTPCHTSGHICYYVTKPNSTEPPAVFTGDTLFVAGCGK--FFEGTPEEMYAALIEVLGRLPPETRVYCGHEYT 198          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Ethe1 (ethylmalonic encephalopathy 1 [Source:MGI Symbol;Acc:MGI:1913321])

HSP 1 Score: 286.574 bits (732), Expect = 1.820e-96
Identity = 131/235 (55.74%), Postives = 172/235 (73.19%), Query Frame = 3
Query:  111 KMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            + S   +  L RQ+FEP SCTYTYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y +NTH HADHITG+G L+S  P  +SVIS  SGA+AD+ + + D + FG+F L  + +PGHT GC+T++ ++  MAFTGD+LLIRGCGRTDFQ+G A  L+ +VH  I +LP + L+YPAHDY G  V+TV+EE   NPRLT + EEFI +M NLNL  P+QID A+PAN+ CG+
Sbjct:   15 QQSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHRDAQLIKELGLKLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHIGEGDSIRFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNLNLPKPQQIDIAVPANMRCGV 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Hagh (hydroxyacyl glutathione hydrolase [Source:MGI Symbol;Acc:MGI:95745])

HSP 1 Score: 77.7962 bits (190), Expect = 7.160e-16
Identity = 53/190 (27.89%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  108 RKMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            RK    + D +  +L   ++  Y YL+ D++ +EA ++DPV     + ++   +  V L  ++ TH H DH  G+ KL    P  K             K+     ++ G   + C  TP HT+G + Y   + G +     FTGD+L + GCG+  F EG A +++  +   +  LP    +Y  H+YT
Sbjct:   40 RKNLTVQQDIMKVELLPALTDNYMYLIIDEDTQEAAIVDPV--QPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGK--FYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 225          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Hagh (hydroxyacyl glutathione hydrolase [Source:MGI Symbol;Acc:MGI:95745])

HSP 1 Score: 73.9442 bits (180), Expect = 4.662e-15
Identity = 50/177 (28.25%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  147 QLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            +L   ++  Y YL+ D++ +EA ++DPV     + ++   +  V L  ++ TH H DH  G+ KL    P  K             K+     ++ G   + C  TP HT+G + Y   + G +     FTGD+L + GCG+  F EG A +++  +   +  LP    +Y  H+YT
Sbjct:    4 ELLPALTDNYMYLIIDEDTQEAAIVDPV--QPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGK--FYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 176          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Hagh (hydroxyacyl glutathione hydrolase [Source:MGI Symbol;Acc:MGI:95745])

HSP 1 Score: 74.7146 bits (182), Expect = 5.088e-15
Identity = 50/177 (28.25%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  147 QLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            +L   ++  Y YL+ D++ +EA ++DPV     + ++   +  V L  ++ TH H DH  G+ KL    P  K             K+     ++ G   + C  TP HT+G + Y   + G +     FTGD+L + GCG+  F EG A +++  +   +  LP    +Y  H+YT
Sbjct:    4 ELLPALTDNYMYLIIDEDTQEAAIVDPV--QPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVFTGDTLFVAGCGK--FYEGTADEMYKALLEVLGRLPPDTKVYCGHEYT 176          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Match: Haghl (hydroxyacylglutathione hydrolase-like [Source:MGI Symbol;Acc:MGI:1919877])

HSP 1 Score: 70.8626 bits (172), Expect = 7.585e-14
Identity = 48/197 (24.37%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDE-----LGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT------GQMVTTVDEELKYNPRLTKTREE 731
            Y YL+ +++ +EA+ ID       R +++  +  V+L  +++TH H DH  G+ +L    P    + +         +L   + ++FG   + C  TPGHT+G M+Y   E         F+GD+L + GCG     E  A +++ ++ + + +LP    ++  H++T       Q V   +E ++      + R++
Sbjct:   13 YMYLIIEEHTREAVAID--VAVAERLLEIAGREGVSLTMVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTRRLEHGEGLQFGAIHVRCLLTPGHTSGHMSYFLWEDDCPDSPALFSGDALSVAGCGW--HLEDTAQQMYQSLAKTLGTLPPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDD 205          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|O95571|ETHE1_HUMAN (Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2)

HSP 1 Score: 287.345 bits (734), Expect = 6.131e-96
Identity = 132/229 (57.64%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  129 SDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            +  L RQ+FEPVSCT+TYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y +NTH HADHITGSG L+S  P  +SVIS  SGA+AD+ + D D + FG+F L  + +PGHT GC+T++ ++  MAFTGD+LLIRGCGRTDFQ+G A  L+ +VH  I +LP   L+YPAHDY G  V+TV+EE   NPRLT + EEF+ IM NLNL  P+QID A+PAN+ CG+
Sbjct:   21 APILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGV 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9DCM0|ETHE1_MOUSE (Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus OX=10090 GN=Ethe1 PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 1.273e-95
Identity = 131/235 (55.74%), Postives = 172/235 (73.19%), Query Frame = 3
Query:  111 KMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            + S   +  L RQ+FEP SCTYTYLLGD+  +EA+LIDPV ET  RD +LI +L + L Y +NTH HADHITG+G L+S  P  +SVIS  SGA+AD+ + + D + FG+F L  + +PGHT GC+T++ ++  MAFTGD+LLIRGCGRTDFQ+G A  L+ +VH  I +LP + L+YPAHDY G  V+TV+EE   NPRLT + EEFI +M NLNL  P+QID A+PAN+ CG+
Sbjct:   15 QQSASGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAHRDAQLIKELGLKLLYAVNTHCHADHITGTGVLRSLLPGCQSVISRLSGAQADLHIGEGDSIRFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNLNLPKPQQIDIAVPANMRCGV 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3T094|ETHE1_BOVIN (Persulfide dioxygenase ETHE1, mitochondrial OS=Bos taurus OX=9913 GN=ETHE1 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 7.774e-95
Identity = 130/229 (56.77%), Postives = 169/229 (73.80%), Query Frame = 3
Query:  129 SDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            +  L RQ+FEP SCTYTYLLGD+  +EA+LIDPV ET  RD +L+ +L + L Y +NTH HADHITGSG L+S  P  +SVIS  SGA+AD  + D D ++FG+F L  + +PGHT GC+T++ ++  MAFTGD+LLIRGCGRTDFQ+G A  L+ +VH  I +LP + L+YPAHDY G  V+TV+EE   NPRLT + EEF+ +M  LNL  P+QID A+PAN+ CGI
Sbjct:   21 APVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAQRDAQLVKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADWHIEDGDSIQFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAETLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFVKVMDKLNLPKPQQIDFAVPANMRCGI 249          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9C8L4|ETHE1_ARATH (Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLY3 PE=1 SV=3)

HSP 1 Score: 266.544 bits (680), Expect = 3.626e-87
Identity = 133/235 (56.60%), Postives = 169/235 (71.91%), Query Frame = 3
Query:  135 FLFRQLFEPVSCTYTYLLGDKN--KKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELG------MAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
             LFRQLFE  S T+TYLL D +   K A+LIDPV +TV RD+KLI++L + L Y +NTHVHADH+TG+G LK+  P  KSVIS  SG+KAD+ L   D V  G   L  + TPGHT GC+TY+  E        MAFTGD++LIRGCGRTDFQEG + +L+++VH  I +LP+  L+YPAHDY G  V+TV EE+++NPRLTK +E F  IM NLNL+YPK ID A+PAN+ CG+
Sbjct:   52 LLFRQLFENESSTFTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGVKSVISKASGSKADLFLEPGDKVSIGDIYLEVRATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLSYPKMIDVAVPANMVCGL 286          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3JRV4|Y2304_BURP1 (Probable metallo-hydrolase BURPS1710b_2304 OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=BURPS1710b_2304 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.275e-24
Identity = 77/270 (28.52%), Postives = 123/270 (45.56%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFE---------TVARD--VKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSV-------------------ISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDE--------LGMAFTGDSLLIR--GCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTG-----QMVTTVDEELKYNPRLTK--TREEFINI--MQNLNLAYPKQIDRALPANLNCG 812
             F+P +CT +YLL D    E  LID V +         T + D  +  +  L   +++++ THVHADH++ +  LK+      ++                     ++ G++ D  L D D +  G   +   HTPGHT  CMTY+  E           AF GD+L +   G  R DF  GDA  L+ ++ R +LSLP    LY  HDY       Q  +TV +EL+ N  + +  T ++F+ +   ++  L  P  +  ++  N+  G
Sbjct:    6 FFDPATCTISYLLFDSGSGECALIDSVLDYDPKSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSI-RKVLSLPPATRLYMCHDYQPNGRAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPVLMLPSVQVNMRAG 274          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A1S3I1Y3 (persulfide dioxygenase ETHE1, mitochondrial isoform X2 OS=Lingula unguis OX=7574 GN=LOC106160274 PE=4 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 3.952e-109
Identity = 153/228 (67.11%), Postives = 185/228 (81.14%), Query Frame = 3
Query:  135 FLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
            F+FRQLF+  S TY+YL+ D N KEA+LIDPV+E V+RD+K+IN+L +NLK  +NTH+HADH+TGSGKLK      KSVIS YSGA+AD+ L D D  EFG+FK+  K TPGHT+GCMT+I+ E G+AFTGD+LLIRGCGRTDFQ+G+ G L+D+VH  ILSLP   LLYPAHDYTGQ VTTV EE K NPRLTK++EEFI IM+NLNL YPKQIDRA+P N  CG+F
Sbjct:   58 FIFRQLFDHTSFTYSYLIADANSKEAVLIDPVYELVSRDLKVINELGLNLKLTVNTHMHADHVTGSGKLKQEIAGCKSVISKYSGAQADIYLDDGDTFEFGKFKMEAKKTPGHTDGCMTFIWHEQGIAFTGDALLIRGCGRTDFQQGNPGTLYDSVHNVILSLPPDTLLYPAHDYTGQSVTTVAEEKKCNPRLTKSKEEFIKIMENLNLPYPKQIDRAIPLNKVCGVF 285          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A1S3I365 (persulfide dioxygenase ETHE1, mitochondrial isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160274 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 8.393e-109
Identity = 154/228 (67.54%), Postives = 184/228 (80.70%), Query Frame = 3
Query:  135 FLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
            F+FRQLF+  S TY+YL+ D N KEA+LIDPV+E V+RD+K+IN+L +NLK  +NTH+HADH+TGSGKLK      KSVIS YSGA+AD+ L D D  EFG+FK+  K TPGHT+GCMT+I+ E G+AFTGD+LLIRGCGRTDFQ+G+ G L+D+VH  ILSLP   LLYPAHDYTGQ VTTV EE K NPRLTK++EEFI IM+NLNL YPKQID ALP N  CGIF
Sbjct:   58 FIFRQLFDHTSFTYSYLIADANSKEAVLIDPVYELVSRDLKVINELGLNLKLTVNTHMHADHVTGSGKLKQEIAGCKSVISKYSGAQADIYLDDGDTFEFGKFKMEAKKTPGHTDGCMTFIWHEQGIAFTGDALLIRGCGRTDFQQGNPGTLYDSVHNVILSLPPDTLLYPAHDYTGQSVTTVAEEKKCNPRLTKSKEEFIKIMENLNLPYPKQIDHALPKNQVCGIF 285          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A1S3HCF0 (persulfide dioxygenase ETHE1, mitochondrial OS=Lingula unguis OX=7574 GN=LOC106154017 PE=4 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 2.517e-105
Identity = 144/228 (63.16%), Postives = 180/228 (78.95%), Query Frame = 3
Query:  135 FLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
             +FRQLFE VS TYTY+L D+  KEA++IDPV ET  RD +L+ +L + LKY +NTHVHADH+TG+G+LK      KSVIS  +GAKAD+ L + D VEFG++ L  + TPGHTNGCMTY+ ++   AFTGD+LLIRGCGRTDFQ+G    L+++VH  ILSLP+  LLYPAHDY G+ VT+V EELK+NPRLTK++EEF NIM NLNL YPKQIDRA+PAN+NCG+F
Sbjct:    3 LIFRQLFESVSSTYTYILADEETKEAVIIDPVMETAERDAQLVEELGLTLKYAVNTHVHADHVTGTGELKKRIAGCKSVISKAAGAKADMFLNNGDKVEFGKYHLEARSTPGHTNGCMTYVLNDKSRAFTGDALLIRGCGRTDFQQGSPLTLYESVHTQILSLPQDCLLYPAHDYKGRTVTSVGEELKFNPRLTKSKEEFANIMNNLNLNYPKQIDRAVPANMNCGVF 230          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A210PEX6 (Persulfide dioxygenase ETHE1, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22214 PE=4 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.627e-104
Identity = 152/240 (63.33%), Postives = 180/240 (75.00%), Query Frame = 3
Query:  108 RKMSLFKS---DFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
            +KMS F     D++FRQL +  S TYTYLL D   KEA+LIDPV+E V RD+ L+  L ++LK+ INTHVHADHITG+G +K   P  KSVI+  SGA ADVK  D   +EFG+F L    TPGHTNGC TY++ E GMAFTGD+LLIRGCGRTDFQEGDA  L+++VH  I +LP  F LYPAHDYTGQ VTTV EE  +NPRLTK++E F+ IM NLNL YPKQIDRALPANL CG+F
Sbjct:   77 KKMSDFTGKGKDYIFRQLLDYKSFTYTYLLADPVSKEAVLIDPVYELVERDLNLVKALGLDLKFAINTHVHADHITGTGDIKKRVPSCKSVITEVSGASADVKTKDGTKLEFGKFSLEVARTPGHTNGCCTYVWREKGMAFTGDTLLIRGCGRTDFQEGDAATLYESVHTKIFTLPPDFSLYPAHDYTGQTVTTVAEEKAFNPRLTKSKEAFVEIMGNLNLPYPKQIDRALPANLVCGVF 316          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Match: A0A131YQU3 (Sulfur dioxygenase OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.841e-104
Identity = 151/231 (65.37%), Postives = 178/231 (77.06%), Query Frame = 3
Query:  123 FKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
             KSD LFRQLF+  SCTY+YLL D+N KEAILIDPV E V RD KLIN+L + L Y  NTHVHADHITGSGKLK    + +SVIS+ S AKAD  L   DV   G  KL  + TPGHTNGCMTY++ E   AFTGD+LLIRGCGRTDFQEG+  +L+D+VH  ILSLP  + LYPAHDY GQ  TTV EELK+NPRLTK++EEF++IM NLNL+YPK ID+A+PAN+ CG+
Sbjct:   56 MKSDVLFRQLFDQKSCTYSYLLADQNTKEAILIDPVLEQVDRDAKLINELGLRLAYAANTHVHADHITGSGKLKEMIQNCRSVISAASKAKADDHLNPGDVFGVGCIKLEARATPGHTNGCMTYVWHEQKKAFTGDALLIRGCGRTDFQEGNPERLYDSVHSQILSLPLDYNLYPAHDYKGQTTTTVGEELKHNPRLTKSKEEFVDIMNNLNLSYPKMIDKAVPANMVCGL 286          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 218.009 bits (554), Expect = 2.829e-70
Identity = 110/222 (49.55%), Postives = 141/222 (63.51%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            LFE  S TY+YLL D    EA+LIDPV ET         Q    L                          KS IS +SGA AD+ L + D ++FGQ  L  + TPGHT+GC+T++  +  MAFTGD+LLIRGCGRTDFQ+G + KL+++VH+ I +LP H L+YPAHDY GQ V++VDEE K+NPRLTK+ +EF+ IM NLNL  P +ID A+PANL CG+
Sbjct:   16 LFEAESSTYSYLLADAGSGEAVLIDPVLET---------QRVFGL--------------------------KSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIDIAVPANLVCGL 202          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 217.238 bits (552), Expect = 4.416e-70
Identity = 110/222 (49.55%), Postives = 141/222 (63.51%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            LFE  S TY+YLL D    EA+LIDPV ET         Q    L                          KS IS +SGA AD+ L + D ++FGQ  L  + TPGHT+GC+T++  +  MAFTGD+LLIRGCGRTDFQ+G + KL+++VH+ I +LP H L+YPAHDY GQ V++VDEE K+NPRLTK+ +EF+ IM NLNL  P +ID A+PANL CG+
Sbjct:   12 LFEAESSTYSYLLADAGSGEAVLIDPVLET---------QRVFGL--------------------------KSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIDIAVPANLVCGL 198          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 216.468 bits (550), Expect = 1.469e-69
Identity = 110/222 (49.55%), Postives = 141/222 (63.51%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            LFE  S TY+YLL D    EA+LIDPV ET  R   L                                  KS IS +SGA AD+ L + D ++FGQ  L  + TPGHT+GC+T++  +  MAFTGD+LLIRGCGRTDFQ+G + KL+++VH+ I +LP H L+YPAHDY GQ V++VDEE K+NPRLTK+ +EF+ IM NLNL  P +ID A+PANL CG+
Sbjct:   26 LFEAESSTYSYLLADAGSGEAVLIDPVLET-QRVFGL----------------------------------KSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIDIAVPANLVCGL 212          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 203.756 bits (517), Expect = 1.090e-64
Identity = 104/215 (48.37%), Postives = 133/215 (61.86%), Query Frame = 3
Query:  144 RQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRA 788
            R LFE  S TY+YLL D    EA+LIDPV ET         Q    L                          KS IS +SGA AD+ L + D ++FGQ  L  + TPGHT+GC+T++  +  MAFTGD+LLIRGCGRTDFQ+G + KL+++VH+ I +LP H L+YPAHDY GQ V++VDEE K+NPRLTK+ +EF+ IM NLNL  P +I  A
Sbjct:    6 RSLFEAESSTYSYLLADAGSGEAVLIDPVLET---------QRVFGL--------------------------KSAISVHSGASADIMLSEGDTIKFGQQSLTVRETPGHTDGCVTFVTGDQTMAFTGDALLIRGCGRTDFQQGCSKKLYESVHQQIFTLPGHCLIYPAHDYKGQTVSSVDEEKKFNPRLTKSLQEFVKIMDNLNLPKPAKIGTA 185          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Match: hagh (hydroxyacylglutathione hydrolase [Source:NCBI gene;Acc:103027791])

HSP 1 Score: 83.5741 bits (205), Expect = 5.660e-18
Identity = 60/200 (30.00%), Postives = 96/200 (48.00%), Query Frame = 3
Query:   90 FLTKLKRKMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIF-----DELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            F + + RK SL +   +  +L   ++  Y YLL D++ KEA ++DPV     + V+ + +  V LK ++ TH H DH  G+ KL    P     ++ Y G         K+   +  + G   + C  TP HT+G + Y        E    FTGD+L + GCG+  F EG A +++  +   +  LP    +Y  H+YT
Sbjct:   32 FFSSVVRKSSLVEQSDMKIELLPALTDNYMYLLIDEDTKEAAIVDPVEPN--KVVEAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLIPG----LTVYGGDDRVGALTKKVTHYNTFKVGSLNVKCLFTPCHTSGHICYYVTKENSSEPPAVFTGDTLFVAGCGK--FFEGTADEMYKALIDVLGRLPPETRVYCGHEYT 223          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-GENE-040426-2503])

HSP 1 Score: 290.041 bits (741), Expect = 1.123e-98
Identity = 135/223 (60.54%), Postives = 168/223 (75.34%), Query Frame = 3
Query:  147 QLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            QLFE VS TYTYLL D + +EA+LIDPV ETV RD+++IN++ V L Y  NTH HADH+TG+G LK      KS+IS  SGA AD+ + + D ++FG+F L  + TPGHT+GC+TY+  +  MAFTGD+LLIRGCGRTDFQ+GDA KL+ +VH  ILSLP    LYPAHDYTGQ ++TV EE K+NPR TK   +F+ +M NLNL  PKQIDRA+PANL CGI
Sbjct:   28 QLFEHVSSTYTYLLADADSREAVLIDPVLETVDRDLRIINEIGVKLVYAANTHCHADHVTGTGMLKKKLSDCKSIISGQSGAIADIHIKEGDTIKFGKFTLEVRSTPGHTDGCLTYVLSDHSMAFTGDALLIRGCGRTDFQQGDATKLYQSVHEKILSLPGDCALYPAHDYTGQTMSTVAEEKKFNPRFTKPLPQFVELMNNLNLPKPKQIDRAVPANLLCGI 250          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Match: pnkd (PNKD metallo-beta-lactamase domain containing [Source:ZFIN;Acc:ZDB-GENE-050208-278])

HSP 1 Score: 59.3066 bits (142), Expect = 2.072e-10
Identity = 51/173 (29.48%), Postives = 78/173 (45.09%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSF-------PHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHD 656
            Y Y++ D   + A+++D   +  A +V  I Q  V L+ I+ TH H DH  G+  L+  +       PH    I   +   AD      + + FG+     + TPGHT G M Y+ D          F+GD L + GCGR    EG    +  ++   + SL    LL+P H+
Sbjct:   54 YGYMVTDLESRTAVVLD-ASDPQAIEV-CIEQEGVTLEAILATHKHWDHSGGNQVLRKIYKCPVYGCPHDN--IPGLTNPVAD-----GEELRFGRLCFRARFTPGHTVGHMVYVLDGQPFGAPDCLFSGDLLFLAGCGR--MFEGTPETMLSSLD-IVSSLADSTLLFPGHE 214          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Match: LACTB2 (lactamase beta 2 [Source:HGNC Symbol;Acc:HGNC:18512])

HSP 1 Score: 50.8322 bits (120), Expect = 1.202e-7
Identity = 59/215 (27.44%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  171 TYTYLLGDKNKKEAILIDP----VFETVARDVKLINQLEVNLKYIINTHVHADHI-----------TGSG----KLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSL-------PRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFI 737
            T TYL+G  +++  +LID     + E VA     + QL  +++ II TH H DH+            G+G    KL    P  + V+    G +    L D DVV      L   +TPGHT+  M  + +E G  F+GD L            G+   +F++++  + SL       P+  L+YP H   G +V    E+++      + RE  +
Sbjct:   31 TNTYLVGTGSRR--VLIDTGEPNIPEYVANLQMALAQLGSSVQEIILTHWHHDHVGGISDVCRALAIGTGVRLSKLPRVPPRREEVLDG-EGLEYTF-LRDGDVVTTEGATLRVVYTPGHTDDHMVLLLEEEGSVFSGDCL------------GEGTAVFEDLYTYMRSLDLLLNLKPK--LIYPGH---GPVVQDAQEKIRGYVSHRQARERAV 224          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Yeast
Match: GLO2 (Cytoplasmic glyoxalase II; catalyzes the hydrolysis of S-D-lactoylglutathione into glutathione and D-lactate; GLO2 has a paralog, GLO4, that arose from the whole genome duplication [Source:SGD;Acc:S000002680])

HSP 1 Score: 69.707 bits (169), Expect = 3.179e-14
Identity = 60/200 (30.00%), Postives = 87/200 (43.50%), Query Frame = 3
Query:  141 FRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGK----LKSSFPHSKSVISSYSGAKADVKLFDNDV--VEFGQFKLMCKHTPGHTNGCMTYIF-----DELGMAFTGDSLLIRGCGRTDFQEGDAGKL--------FDNVHRNILSLPRHFLLYPAHDYTGQMVTTV 683
             +  +E     Y YLL D   K++ LIDP  E      +L    +++++ I+NTH H DH  G+      LK   P SK  +   S     V +   ++  +  G  ++ C  TP HT   + Y       DE  + FTGD+L   GCGR  F EG   ++         + V R   S  R   +YP H+YT   V  V
Sbjct:    6 IKMRWESGGVNYCYLLSDSKNKKSWLIDPA-EPPEVLPELTEDEKISVEAIVNTHHHYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPCHTRDSICYYVKDPTTDERCI-FTGDTLFTAGCGR--FFEGTGEEMDIALNNSILETVGRQNWSKTR---VYPGHEYTSDNVKFV 198          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Yeast
Match: GLO4 (Mitochondrial glyoxalase II; catalyzes the hydrolysis of S-D-lactoylglutathione into glutathione and D-lactate; GLO4 has a paralog, GLO2, that arose from the whole genome duplication [Source:SGD;Acc:S000005566])

HSP 1 Score: 67.781 bits (164), Expect = 1.467e-13
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKS-----SFPHSKSVISSYSGAKADVKLFDN-DVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNIL------SLPRHFLLYPAHDYTGQMVTTVDEEL 695
            Y+YLL  ++++ + LIDP  E +    KL  + + ++  I+NTH H DH  G+  L S     +  H   +I     +    ++ DN      G  ++ C  TP HT   + Y   +L       FTGD+L I GCGR  F EG  G+  D     I+      +      +YP H+YT   V+ +  ++
Sbjct:   27 YSYLLSTEDRRNSWLIDPA-EPLEVSPKLSAEEKKSIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGR--FFEG-TGRDMDMALNQIMLRAVGETNWNKVKIYPGHEYTKGNVSFIRAKI 212          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO42013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J6])

HSP 1 Score: 266.544 bits (680), Expect = 3.326e-89
Identity = 133/228 (58.33%), Postives = 163/228 (71.49%), Query Frame = 3
Query:  129 SDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCG 812
            S  +FRQLF+  S T+TYLLG    ++A++IDPV   V RD KLI++LE+ L Y +NTHVHADHITG+G LK      +S+IS  SGA ADV + D D V FG   L    TPGHTNGC+T++     MAFTGD+LLIR CGRTDFQEG A KL+++VH  ILSLPR F LYP HDYTG   TTVDEELK+NPRLTK++ +F+ IM  L L  PK+ID A+P N+ CG
Sbjct:    3 SRLVFRQLFDYESYTFTYLLGCGRTRQAVIIDPVDTQVKRDTKLIDELELKLIYAMNTHVHADHITGTGLLKG-MTACQSIISKNSGAIADVFVNDGDKVVFGDESLEVLATPGHTNGCITFVSHMHKMAFTGDALLIRACGRTDFQEGSAEKLYESVHSKILSLPRDFTLYPGHDYTGMSSTTVDEELKHNPRLTKSKGDFVEIMSKLGLTKPKRIDEAVPVNMMCG 229          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO29820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J2])

HSP 1 Score: 164.081 bits (414), Expect = 6.790e-50
Identity = 93/183 (50.82%), Postives = 132/183 (72.13%), Query Frame = 3
Query:  147 QLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEG----DAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTV 683
            QLF+  +CTYTY+LG  + ++A++IDPV   V+RD +L+N+L++ L++ +NTHVHADH+TGSG LK      KS I++ S AKAD  L   DV+++G+  L  + TPGHT+GCMT++     MAFTGD+LL+R CGRTDFQ+G    DA  L+ ++H  ILSLP  +LLYP HDY G+ ++T+
Sbjct:    5 QLFDSETCTYTYILGCMSSRKAVIIDPVDTKVSRDARLLNELKLELEWAVNTHVHADHVTGSGYLKGLIG-CKSAIAAASKAKADKHLNHGDVLQYGEQALEARATPGHTHGCMTFVDHAHRMAFTGDALLVRACGRTDFQQGMARSDATVLYKSIHDQILSLPGDYLLYPGHDYKGKYMSTI 186          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO44424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP5])

HSP 1 Score: 79.337 bits (194), Expect = 7.066e-17
Identity = 53/177 (29.94%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKA---------DVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTY-----IFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            Y+Y++ D     A+++DP      +DV  +N+ ++ L+ ++ TH H DH  G+  LK+ FP      S    A           D+  F   V    Q       TPGHT G + Y     +F+ +   F+GD L + GCGR    EG  G++ +++ + + SL    LL+P HDY 
Sbjct:   63 YSYIIVDITTSSAVVVDPSDPEAVKDV--LNKEKLQLEAVLTTHKHWDHSGGNTSLKADFPSVAVYGSELDDAPGLTHTRKPLCDISNFSGKV---SQLSFTAFSTPGHTAGHVVYLLHGAVFNSVDSLFSGDLLFLGGCGR--IFEGAPGEMLESL-QTVSSLKDDTLLWPGHDYA 231          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO47915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI7])

HSP 1 Score: 68.5514 bits (166), Expect = 1.851e-13
Identity = 53/180 (29.44%), Postives = 85/180 (47.22%), Query Frame = 3
Query:  147 QLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTY-IFDELG---MAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            +L   +S  Y YLL D   KEA ++DPV     + V  + +  V L  ++ TH H DH  G+  L        S ++ Y G         K+  ++  + G   + C  TP HT+G + + +  + G     FTGD+L   GCGR  F EG   +++  +   + SLP +  ++  H+YT
Sbjct:    4 RLLPALSDNYMYLLVDPKTKEAAVVDPV--EPEKVVTAVQEEGVKLTTVLTTHHHWDHAGGNEGLVKLV----SGLTVYGGDERIGALSKKVSHDEEFKVGSLHVKCLFTPCHTSGHICFHVTGDAGKPTAVFTGDTLFSGGCGR--FFEGSPPEMYSALIEVLGSLPENTRVFCGHEYT 175          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Match: EDO27917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7X9])

HSP 1 Score: 63.929 bits (154), Expect = 7.929e-12
Identity = 52/182 (28.57%), Postives = 85/182 (46.70%), Query Frame = 3
Query:  108 RKMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSG----AKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTY-IFDELG---MAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPR 629
            +++++ + D   R L   +S  Y YLL D   KEA ++DPV     + V  + +  V L  ++ TH H DH  G+  L        S ++ Y G         K+  ++  + G   + C  TP HT+G + + +  + G     FTGD+L   GCGR  F EG   +++  +   + SLP 
Sbjct:    5 KEVTMVQDDMKIR-LLPALSDNYMYLLVDPKTKEAAVVDPV--EPEKVVTAVQEEGVKLTTVLTTHHHWDHAGGNEGLVKLV----SGLTVYGGDERIGALSKKVSHDEEFKVGSLHVKCLFTPCHTSGHICFHVTGDAGKPTAVFTGDTLFSGGCGR--FFEGSPPEMYSALIEVLGSLPE 177          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc:101159221])

HSP 1 Score: 289.656 bits (740), Expect = 3.767e-97
Identity = 133/231 (57.58%), Postives = 170/231 (73.59%), Query Frame = 3
Query:  123 FKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
             +   LF+QLFE  SCTYTYLL D   K+A++IDPV E + RDVKL+ +L +NL   +NTH HADHIT +G +K      KS IS +SGA AD++L + D + FG+  L+ K TPGHT+GC T + D+  MAFTGD+LLIRGCGRTDFQ+G + KL+D++H+ I +LP   L+YPAHDY GQ V+TV EE K NPRLTK++EEFI IM NLNL  PK+ID A+PANL CG+
Sbjct:   62 MRQGLLFKQLFESESCTYTYLLADTETKDAVIIDPVLEKLDRDVKLVQELGLNLTVAVNTHCHADHITSTGLMKKRILGLKSAISKFSGASADIQLSEGDKIPFGKHYLVVKETPGHTDGCSTLVLDDELMAFTGDALLIRGCGRTDFQQGSSSKLYDSIHQKIFTLPEQCLIYPAHDYLGQTVSTVGEERKLNPRLTKSKEEFIKIMDNLNLPKPKKIDIAVPANLVCGL 292          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: ethe1 (ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc:101159221])

HSP 1 Score: 272.322 bits (695), Expect = 4.962e-91
Identity = 128/222 (57.66%), Postives = 163/222 (73.42%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGI 815
            LFE  SCTYTYLL D   K+A++IDPV E + RDVKL+ +L +NL   +NTH HADHIT +G +K      KS IS +SGA AD++L + D + FG+ +     TPGHT+GC T + D+  MAFTGD+LLIRGCGRTDFQ+G + KL+D++H+ I +LP   L+YPAHDY GQ V+TV EE K NPRLTK++EEFI IM NLNL  PK+ID A+PANL CG+
Sbjct:   24 LFESESCTYTYLLADTETKDAVIIDPVLEKLDRDVKLVQELGLNLTVAVNTHCHADHITSTGLMKKRILGLKSAISKFSGASADIQLSEGDKIPFGKHE-----TPGHTDGCSTLVLDDELMAFTGDALLIRGCGRTDFQQGSSSKLYDSIHQKIFTLPEQCLIYPAHDYLGQTVSTVGEERKLNPRLTKSKEEFIKIMDNLNLPKPKKIDIAVPANLVCGL 240          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: hagh (hydroxyacylglutathione hydrolase, mitochondrial [Source:NCBI gene;Acc:101161407])

HSP 1 Score: 84.7297 bits (208), Expect = 2.482e-18
Identity = 58/190 (30.53%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  108 RKMSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            RK  L K   +  +L   +S  Y YLL D++ KEA ++DPV E + + V+ + +  V L  ++ TH H DH  G+ K+    P  K             K+  ++ ++ G   + C  TP HT G + Y     G +     FTGD+L + GCG+  F EG A ++++ +   + +LP    +Y  H+YT
Sbjct:   40 RKPHLVKQADMRVELLPALSDNYMYLLIDEDSKEAAIVDPV-EPI-KVVEAVRKHGVKLTTVLTTHHHWDHAGGNEKMVKLMPGLKVCGGDDRVDAITKKVSHSNTLKLGSLSIKCLFTPCHTTGHICYYVTREGSSEPPAVFTGDTLFVAGCGK--FFEGTAEQMYEALIEILGNLPPETRVYCGHEYT 225          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: HAGHL (hydroxyacylglutathione hydrolase-like protein [Source:NCBI gene;Acc:105354603])

HSP 1 Score: 77.411 bits (189), Expect = 5.047e-16
Identity = 51/168 (30.36%), Postives = 83/168 (49.40%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDE-----LGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            Y YL+ D+  K+AI +DP      R ++++ + E++L  ++ TH H DH  G+  L    P  +             K+ +   ++F    + C  TP HT+G M Y   E         FTGD+L I GCG+  F EG A ++  N+ + + SLP+   ++  H+YT
Sbjct:   13 YMYLVIDEESKQAIAVDPAVP--HRLLEIVKREELSLTAVLTTHHHWDHARGNEALLKELPDLRVYGGDDRIGGLTDKVTNAQELKFSSINVRCLFTPCHTSGHMCYFVWEDECTDAPAVFTGDTLFIGGCGQ--FFEGTAEQMHYNLTQVLGSLPQDTKVFCGHEYT 176          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Match: pnkd (probable hydrolase PNKD [Source:NCBI gene;Acc:101175554])

HSP 1 Score: 71.633 bits (174), Expect = 1.190e-13
Identity = 52/171 (30.41%), Postives = 80/171 (46.78%), Query Frame = 3
Query:  174 YTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLK---SSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMA-----FTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            Y+YL+ D     A+++DP    + + V  +      L+ I+ TH H DH  G+  LK   S+ P   S + +  G      L D D V+ G+       TPGHT G M Y+ D   +      F+GD + + GCGR    EG +  +  ++   + SL    LL+P H+Y 
Sbjct:  105 YSYLIVDTTSSVAVVVDPADPQLVQAV--LEDQGAMLEAILCTHKHWDHSGGNKGLKRLHSACPVYGSAVDNIPGLTH--PLSDKDSVKVGRMHFKALFTPGHTVGHMIYLLDGQAVGAPSSLFSGDLVFLSGCGR--MFEGSSTTMLSSLD-TVASLSDGTLLWPGHEYA 268          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000065858.1 (SMESG000065858.1)

HSP 1 Score: 387.497 bits (994), Expect = 2.006e-136
Identity = 176/231 (76.19%), Postives = 213/231 (92.21%), Query Frame = 3
Query:  126 KSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
            KS+ +FRQ+FEP+SCTY+YLL DK+ ++AILIDPV+ETV RD KLI QL+VNLK+I+NTHVHADH+TGSGKLKS FP+SKSVISSYS AK DV +  +D V+FG+FKL+CKHTPGHT+GC+TY+F+E+GMAFTGD+LLIRGCGRTDFQ+GDAGKL+D VH+ ILSLP +FLLYPAHDY+GQMVTTV+EELK+NPRLTK+R+EFINIM NLNL+YPKQID+ALPAN+ CGIF
Sbjct:   29 KSNLIFRQVFEPISCTYSYLLADKSTRDAILIDPVYETVERDKKLIKQLDVNLKFILNTHVHADHVTGSGKLKSIFPNSKSVISSYSKAKVDVAVSHDDEVKFGEFKLICKHTPGHTDGCLTYVFEEMGMAFTGDALLIRGCGRTDFQQGDAGKLYDVVHKYILSLPPYFLLYPAHDYSGQMVTTVEEELKHNPRLTKSRDEFINIMNNLNLSYPKQIDKALPANMACGIF 259          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000066719.1 (SMESG000066719.1)

HSP 1 Score: 244.973 bits (624), Expect = 2.542e-82
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 3
Query:  114 MSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPG 470
            MSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPG
Sbjct:    1 MSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLFDNDVVEFGQFKLMCKHTPG 119          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000066710.1 (SMESG000066710.1)

HSP 1 Score: 233.417 bits (594), Expect = 7.412e-78
Identity = 110/111 (99.10%), Postives = 111/111 (100.00%), Query Frame = 3
Query:  486 MTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF 818
            MTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQID+ALPANLNCGIF
Sbjct:    1 MTYIFDELGMAFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRLTKTREEFINIMQNLNLAYPKQIDQALPANLNCGIF 111          
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Match: SMESG000081975.1 (SMESG000081975.1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.226e-16
Identity = 55/179 (30.73%), Postives = 90/179 (50.28%), Query Frame = 3
Query:  150 LFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLINQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKA-DVKLFDNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGM-------AFTGDSLLIRGCGRTDFQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYT 662
            +F+ +S  + Y+L DK+  +  +IDPV     + V      ++ + YI+ TH H DH  G+  L S   ++ +V+       + + K+F  D++  G  ++ C  TP HT+G M Y F +L          FTGD+L I GCGR  F EG   +++  +   +  LP    +Y  H+YT
Sbjct:    5 VFKALSDNFMYILLDKHTNKCAVIDPV--EPQKIVDFAQSRKLFITYILTTHHHWDHAGGNKVLTSLLENNVTVVGGDDRIDSLNKKVFHKDILNVGNIEIECLFTPCHTSGHMCY-FAKLTQDKVQDYAVFTGDTLFIAGCGR--FFEGTPVQMYHALIEILAVLPYTTKIYCGHEYT 178          
The following BLAST results are available for this feature:
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETHE11.277e-9657.64ETHE1 persulfide dioxygenase [Source:HGNC Symbol;A... [more]
ETHE11.779e-9057.01ETHE1 persulfide dioxygenase [Source:HGNC Symbol;A... [more]
ETHE15.375e-1747.37ETHE1 persulfide dioxygenase [Source:HGNC Symbol;A... [more]
ETHE15.375e-1747.37ETHE1 persulfide dioxygenase [Source:HGNC Symbol;A... [more]
PNKD6.478e-1331.61PNKD metallo-beta-lactamase domain containing [Sou... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ethe-14.850e-8754.05ETHE1 (Human ETHylmalonic Encephalopathy) homolog ... [more]
Y17G7B.33.134e-1428.75pep chromosome:WBcel235:II:11989024:11992823:1 gen... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG300225.195e-9356.90gene:FBgn0050022 transcript:FBtr0289990[more]
tzn1.259e-1429.31gene:FBgn0037024 transcript:FBtr0078252[more]
tzn1.410e-1429.31gene:FBgn0037024 transcript:FBtr0078253[more]
tzn1.716e-1429.31gene:FBgn0037024 transcript:FBtr0078254[more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ethe14.112e-10061.95ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
hagh1.866e-1730.41hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
hagh1.866e-1730.41hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
pnkd2.396e-1330.29PNKD metallo-beta-lactamase domain containing [Sou... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ethe13.476e-10259.50ethylmalonic encephalopathy 1 [Source:NCBI gene;Ac... [more]
ethe13.122e-9862.16ethylmalonic encephalopathy 1 [Source:NCBI gene;Ac... [more]
mrps124.670e-1430.12mitochondrial ribosomal protein S12 [Source:Xenbas... [more]
mrps125.128e-1430.12mitochondrial ribosomal protein S12 [Source:Xenbas... [more]
hagh2.049e-1328.81hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ethe11.820e-9655.74ethylmalonic encephalopathy 1 [Source:MGI Symbol;A... [more]
Hagh7.160e-1627.89hydroxyacyl glutathione hydrolase [Source:MGI Symb... [more]
Hagh4.662e-1528.25hydroxyacyl glutathione hydrolase [Source:MGI Symb... [more]
Hagh5.088e-1528.25hydroxyacyl glutathione hydrolase [Source:MGI Symb... [more]
Haghl7.585e-1424.37hydroxyacylglutathione hydrolase-like [Source:MGI ... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95571|ETHE1_HUMAN6.131e-9657.64Persulfide dioxygenase ETHE1, mitochondrial OS=Hom... [more]
sp|Q9DCM0|ETHE1_MOUSE1.273e-9555.74Persulfide dioxygenase ETHE1, mitochondrial OS=Mus... [more]
sp|Q3T094|ETHE1_BOVIN7.774e-9556.77Persulfide dioxygenase ETHE1, mitochondrial OS=Bos... [more]
sp|Q9C8L4|ETHE1_ARATH3.626e-8756.60Persulfide dioxygenase ETHE1 homolog, mitochondria... [more]
sp|Q3JRV4|Y2304_BURP11.275e-2428.52Probable metallo-hydrolase BURPS1710b_2304 OS=Burk... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I1Y33.952e-10967.11persulfide dioxygenase ETHE1, mitochondrial isofor... [more]
A0A1S3I3658.393e-10967.54persulfide dioxygenase ETHE1, mitochondrial isofor... [more]
A0A1S3HCF02.517e-10563.16persulfide dioxygenase ETHE1, mitochondrial OS=Lin... [more]
A0A210PEX61.627e-10463.33Persulfide dioxygenase ETHE1, mitochondrial OS=Miz... [more]
A0A131YQU32.841e-10465.37Sulfur dioxygenase OS=Rhipicephalus appendiculatus... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ethe12.829e-7049.55ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
ethe14.416e-7049.55ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
ethe11.469e-6949.55ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
ethe11.090e-6448.37ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
hagh5.660e-1830.00hydroxyacylglutathione hydrolase [Source:NCBI gene... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ethe11.123e-9860.54ETHE1 persulfide dioxygenase [Source:ZFIN;Acc:ZDB-... [more]
pnkd2.072e-1029.48PNKD metallo-beta-lactamase domain containing [Sou... [more]
LACTB21.202e-727.44lactamase beta 2 [Source:HGNC Symbol;Acc:HGNC:1851... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GLO23.179e-1430.00Cytoplasmic glyoxalase II; catalyzes the hydrolysi... [more]
GLO41.467e-1328.95Mitochondrial glyoxalase II; catalyzes the hydroly... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420133.326e-8958.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298206.790e-5050.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444247.066e-1729.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479151.851e-1329.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279177.929e-1228.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ethe13.767e-9757.58ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc... [more]
ethe14.962e-9157.66ETHE1 persulfide dioxygenase [Source:NCBI gene;Acc... [more]
hagh2.482e-1830.53hydroxyacylglutathione hydrolase, mitochondrial [S... [more]
HAGHL5.047e-1630.36hydroxyacylglutathione hydrolase-like protein [Sou... [more]
pnkd1.190e-1330.41probable hydrolase PNKD [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of persulfide dioxygenase ETHE1, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000065858.12.006e-13676.19SMESG000065858.1[more]
SMESG000066719.12.542e-82100.00SMESG000066719.1[more]
SMESG000066710.17.412e-7899.10SMESG000066710.1[more]
SMESG000081975.11.226e-1630.73SMESG000081975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001222 ID=SMED30001222|Name=persulfide dioxygenase ETHE1, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=968bp
CAAAACAGATCAAATTTCAATAGTCACATTATAGTCACTTAGAGTGACAA
CCTAGCCGTACAATCTGCTAATAATATTGAGATAGATTATTTCTCACAAA
ATTAAAACGCAAAATGAGTTTATTTAAATCGGATTTTTTATTTCGACAAC
TTTTTGAACCGGTTTCTTGCACGTATACTTATCTTTTAGGTGATAAAAAT
AAAAAAGAAGCAATTTTAATTGATCCTGTTTTTGAAACGGTTGCACGAGA
TGTCAAACTGATAAATCAATTGGAGGTCAATTTAAAATATATTATAAATA
CTCATGTTCACGCTGATCATATAACCGGAAGCGGGAAATTAAAATCTTCA
TTTCCACATAGTAAAAGTGTCATAAGCTCATACAGTGGTGCAAAAGCGGA
TGTTAAACTTTTCGATAATGATGTTGTTGAATTTGGCCAATTCAAATTAA
TGTGTAAGCACACTCCAGGCCACACAAATGGATGCATGACATATATATTC
GATGAATTGGGAATGGCATTTACTGGAGATTCTTTACTTATCCGAGGATG
TGGGCGGACGGATTTCCAAGAAGGCGATGCTGGTAAACTGTTCGATAATG
TTCACAGAAATATCCTTAGTTTACCTCGCCATTTCTTGCTTTACCCGGCC
CATGATTACACAGGGCAAATGGTGACCACCGTTGACGAAGAACTGAAATA
TAATCCTCGATTGACAAAGACTCGGGAGGAATTTATCAACATCATGCAAA
ATCTAAATTTGGCTTACCCTAAACAAATCGATCGAGCTCTTCCTGCCAAC
TTGAATTGCGGAATATTTTAATGAGTTAATAAGTTTTCTTTTCACAATTT
TCTACTAAAAACATGTTTTTATAATAAAATTAGAGATTGTTTGTGTTTAT
TTACTCATTTTGTTCCATCTATGGAAAACTCAGTTTTTGGGACCTGATTT
CAGATAGTAACATTATAA
back to top

protein sequence of SMED30001222-orf-1

>SMED30001222-orf-1 ID=SMED30001222-orf-1|Name=SMED30001222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MSLFKSDFLFRQLFEPVSCTYTYLLGDKNKKEAILIDPVFETVARDVKLI
NQLEVNLKYIINTHVHADHITGSGKLKSSFPHSKSVISSYSGAKADVKLF
DNDVVEFGQFKLMCKHTPGHTNGCMTYIFDELGMAFTGDSLLIRGCGRTD
FQEGDAGKLFDNVHRNILSLPRHFLLYPAHDYTGQMVTTVDEELKYNPRL
TKTREEFINIMQNLNLAYPKQIDRALPANLNCGIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
Vocabulary: INTERPRO
TermDefinition
IPR036866RibonucZ/Hydroxyglut_hydro
IPR001279Metallo-B-lactamas
Vocabulary: molecular function
TermDefinition
GO:0051213dioxygenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001279Metallo-beta-lactamaseSMARTSM00849Lactamase_B_5acoord: 19..180
e-value: 1.5E-25
score: 100.8
IPR001279Metallo-beta-lactamasePFAMPF00753Lactamase_Bcoord: 21..157
e-value: 5.8E-15
score: 55.8
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeGENE3DG3DSA:3.60.15.10coord: 4..234
e-value: 3.1E-80
score: 270.4
IPR036866Ribonuclease Z/Hydroxyacylglutathione hydrolase-likeSUPERFAMILYSSF56281Metallo-hydrolase/oxidoreductasecoord: 12..233
NoneNo IPR availablePANTHERPTHR43084FAMILY NOT NAMEDcoord: 5..234
NoneNo IPR availablePANTHERPTHR43084:SF1PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIALcoord: 5..234
NoneNo IPR availableCDDcd07724POD-like_MBL-foldcoord: 9..182
e-value: 2.29524E-77
score: 228.823