Squamous cell carcinoma antigen recognized by T-cells 3

Overview
NameSquamous cell carcinoma antigen recognized by T-cells 3
Smed IDSMED30001214
Length (bp)2515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Squamous cell carcinoma antigen recognized by T-cells 3 (SMED30001214) t-SNE clustered cells

Violin plots show distribution of expression levels for Squamous cell carcinoma antigen recognized by T-cells 3 (SMED30001214) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Squamous cell carcinoma antigen recognized by T-cells 3 (SMED30001214) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Squamous cell carcinoma antigen recognized by T-cells 3 (SMED30001214) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001214

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001214SMESG000061682.1 SMESG000051647.1 SMESG000047714.1 SMESG000041707.1 SMESG000038659.1 SMESG000027214.1 SMESG000026760.1 SMESG000022177.1 SMESG000013251.1 SMESG000008868.1 SmedASXL_018298SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001214SMESG000061682.1 SMESG000051647.1 SMESG000047714.1 SMESG000041707.1 SMESG000038659.1 SMESG000027214.1 SMESG000026760.1 SMESG000022177.1 SMESG000013251.1 SMESG000008868.1 SmedASXL_018298SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000073202.1 SMESG000072548.1 SMESG000072546.1 SMESG000063196.1 SMESG000061682.1 SMESG000051647.1 SMESG000047714.1 SMESG000046897.1 SMESG000045052.1 SMESG000044505.1 SMESG000041707.1 SMESG000038659.1 SMESG000024483.1 SMESG000022177.1 SMESG000016676.1 SMESG000014115.1 SMESG000008868.1 SMESG000005784.1 SMESG000005706.1 Contig37562newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000073202.1 SMESG000072548.1 SMESG000072546.1 SMESG000063196.1 SMESG000061682.1 SMESG000051647.1 SMESG000047714.1 SMESG000046897.1 SMESG000045052.1 SMESG000044505.1 SMESG000041707.1 SMESG000038659.1 SMESG000024483.1 SMESG000022177.1 SMESG000016676.1 SMESG000014115.1 SMESG000008868.1 SMESG000005784.1 SMESG000005706.1 Contig37562uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000070399.1 SMESG000066419.1 SMESG000063196.1 SMESG000061682.1 SMESG000052711.1 SMESG000051647.1 SMESG000051412.1 SMESG000047714.1 SMESG000046897.1 SMESG000044505.1 SMESG000041707.1 SMESG000039936.1 SMESG000038659.1 SMESG000026760.1 SMESG000024483.1 SMESG000022177.1 SMESG000016928.1 SMESG000016676.1 SMESG000016652.1 SMESG000014115.1 SMESG000013431.1 SMESG000013251.1 SMESG000012925.1 SMESG000008868.1 SMESG000005784.1 SMESG000005706.1 Contig53550newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000070399.1 SMESG000066419.1 SMESG000063196.1 SMESG000061682.1 SMESG000052711.1 SMESG000051647.1 SMESG000051412.1 SMESG000047714.1 SMESG000046897.1 SMESG000044505.1 SMESG000041707.1 SMESG000039936.1 SMESG000038659.1 SMESG000026760.1 SMESG000024483.1 SMESG000022177.1 SMESG000016928.1 SMESG000016676.1 SMESG000016652.1 SMESG000014115.1 SMESG000013431.1 SMESG000013251.1 SMESG000012925.1 SMESG000008868.1 SMESG000005784.1 SMESG000005706.1 Contig53550uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000008868.1 Contig49250newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000008868.1 Contig49250uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30001214SMESG000008868.1 dd_Smed_v4_6820_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001214SMESG000008868.1 dd_Smed_v4_6820_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001214SMESG000008868.1 dd_Smed_v4_6820_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001214SMESG000008868.1 dd_Smed_v4_6820_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001214SMESG000008868.1 dd_Smed_v4_6820_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001214SMESG000008868.1 dd_Smed_v4_6820_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000078113.1 SMESG000077700.1 SMESG000077543.1 SMESG000073202.1 SMESG000068883.1 SMESG000065750.1 SMESG000065674.1 SMESG000063581.1 SMESG000061682.1 SMESG000057238.1 SMESG000056863.1 SMESG000055411.1 SMESG000051647.1 SMESG000051412.1 SMESG000051204.1 SMESG000047714.1 SMESG000046897.1 SMESG000045052.1 SMESG000044505.1 SMESG000042145.1 SMESG000041707.1 SMESG000039936.1 SMESG000038929.1 SMESG000038659.1 SMESG000035066.1 SMESG000034883.1 SMESG000028188.1 SMESG000026760.1 SMESG000022177.1 SMESG000017179.1 SMESG000016928.1 SMESG000016676.1 SMESG000013251.1 SMESG000012925.1 SMESG000008868.1 SMESG000062819.1 Contig12485newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001214SMESG000078113.1 SMESG000077700.1 SMESG000077543.1 SMESG000073202.1 SMESG000068883.1 SMESG000065750.1 SMESG000065674.1 SMESG000063581.1 SMESG000061682.1 SMESG000057238.1 SMESG000056863.1 SMESG000055411.1 SMESG000051647.1 SMESG000051412.1 SMESG000051204.1 SMESG000047714.1 SMESG000046897.1 SMESG000045052.1 SMESG000044505.1 SMESG000042145.1 SMESG000041707.1 SMESG000039936.1 SMESG000038929.1 SMESG000038659.1 SMESG000035066.1 SMESG000034883.1 SMESG000028188.1 SMESG000026760.1 SMESG000022177.1 SMESG000017179.1 SMESG000016928.1 SMESG000016676.1 SMESG000013251.1 SMESG000012925.1 SMESG000008868.1 SMESG000062819.1 Contig12485uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Human
Match: SART3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:HGNC Symbol;Acc:HGNC:16860])

HSP 1 Score: 357.836 bits (917), Expect = 7.014e-109
Identity = 257/900 (28.56%), Postives = 441/900 (49.00%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSD---KDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-----IENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK----------------PQKRKT---------PDYKSSGLKAKKVKFSEELSTETVT-----------ASVSIEQPIERCEEK-------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIG--MIPRTVG----------LKPMATQKKIIHGASSDSQDG-----------NIAEAKKSNADFRKFLM 2496
            ++I+   E +  N  DY+ H  LI  L+   ++ + R +R+ M   +PL+ E+W++W++DE S+  D   ++ +  +F +A++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  +W  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+             +   +  + Q+L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RA+RN   ++ LW  Y+  ME +      I  TF           T ++ +WQAYLD+ +R++D +   + +L  +R  F + +      +E   +   DP C +++ W  IEA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   +                P+KR            D +    K ++V+ S   + ET             A+V +E P ++ E+                    T+FVSNL YS+ E D  LR  FE CG++ +IR    +    RG+ +++F  + +  +AL+++R+ +  RPMFVS C   +K+     F YS   +E +KLF+  LP + TK  LE I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + +I+V +S PP ++ P+K           K P G  ++P+T G          L P A Q+     A+  +++G                K SNADF K  +
Sbjct:   96 LEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYDMEATFAEY--EEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTS-LEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETR-------KAPGGPMLLPQTYGARGKGRTQLSLLPRALQRP--SAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFL 961          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Human
Match: SART3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:HGNC Symbol;Acc:HGNC:16860])

HSP 1 Score: 357.836 bits (917), Expect = 1.064e-108
Identity = 259/914 (28.34%), Postives = 444/914 (48.58%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSD---KDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEK-------------SPFVDDGS-NEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-----IENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK----------------PQKRKT---------PDYKSSGLKAKKVKFSEELSTETVT-----------ASVSIEQPIERCEEK-------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIG--MIPRTVG----------LKPMATQKKIIHGASSDSQDG-----------NIAEAKKSNADFRKFLM 2496
            ++I+   E +  N  DY+ H  LI  L+   ++ + R +R+ M   +PL+ E+W++W++DE S+  D   ++ +  +F +A++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  +W  Y  +E              SPF  + + + Q E+++ ++ RQL++ L   + T  E+             +   +  + Q+L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RA+RN   ++ LW  Y+  ME +      I  TF           T ++ +WQAYLD+ +R++D +   + +L  +R  F + +      +E   +   DP C +++ W  IEA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   +                P+KR            D +    K ++V+ S   + ET             A+V +E P ++ E+                    T+FVSNL YS+ E D  LR  FE CG++ +IR    +    RG+ +++F  + +  +AL+++R+ +  RPMFVS C   +K+     F YS   +E +KLF+  LP + TK  LE I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + +I+V +S PP ++ P+K           K P G  ++P+T G          L P A Q+     A+  +++G                K SNADF K  +
Sbjct:   96 LEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVEAARPVAGFLSPFDREQTFDSQLEKVHSLFRRQLAIPLYDMEATFAEY--EEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTS-LEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETR-------KAPGGPMLLPQTYGARGKGRTQLSLLPRALQRP--SAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFL 979          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Human
Match: SART3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:HGNC Symbol;Acc:HGNC:16860])

HSP 1 Score: 321.627 bits (823), Expect = 9.682e-96
Identity = 249/903 (27.57%), Postives = 424/903 (46.95%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSD---KDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCS----------VDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK----------------PQKRKTP---------DYKSSGLKAKKVKFSEELSTETVT-----------ASVSIEQPIERCEEK-------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIG--MIPRTVG----------LKPMATQKKIIHGASSDSQDG-----------NIAEAKKSNADFRKFLM 2496
            ++I+   E +  N  DY+ H  LI  L+   ++ + R +R+ M   +PL+ E+W++W++DE S+  D   ++ +  +F +A++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  +W  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+             +   +  + Q+L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RA+RN   ++ LW  Y+  ME +             ++E+R  F                    YL  E                + E F++          DP C +++ W  IEA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   +                P+KR            D +    K ++V+ S   + ET             A+V +E P ++ E+                    T+FVSNL YS+ E D  LR  FE CG++ +IR    +    RG+ +++F  + +  +AL+++R+ +  RPMFVS C   +K+     F YS  + E +KLF+  LP + TK  LE I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + +I+V +S PP ++ P+K           K P G  ++P+T G          L P A Q+     A+  +++G                K SNADF K  +
Sbjct:   96 LEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYDMEATFAEY--EEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISDSSKELEELRAAFTRALE---------------YLKQE----------------VEERFNE--------SGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSL-EKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETR-------KAPGGPMLLPQTYGARGKGRTQLSLLPRALQRP--SAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFL 925          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Human
Match: SART3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:HGNC Symbol;Acc:HGNC:16860])

HSP 1 Score: 111.309 bits (277), Expect = 9.614e-26
Identity = 73/278 (26.26%), Postives = 141/278 (50.72%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINS---DKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISY 942
            ++I+   E +  N  DY+ H  LI  L+   ++ + R +R+ M   +PL+ E+W++W++DE S+     D++ +  +F +A++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  +W  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+             +   +  + Q+L  Y P+E+ +   E    A               EY  Y +      + ++I++  ++ERA+ + CL  ++WI Y
Sbjct:   96 LEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYDMEATFAEY--EEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQL--IFERALVENCLVPDLWIRY 350          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Human
Match: SART3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:HGNC Symbol;Acc:HGNC:16860])

HSP 1 Score: 102.064 bits (253), Expect = 1.209e-24
Identity = 54/115 (46.96%), Postives = 77/115 (66.96%), Query Frame = 1
Query: 1981 RPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKK 2313
            RPMFVS C   +K+     F YS  + E +KLF+  LP + TK  LE I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + +I+V +S PP ++ P+K
Sbjct:   12 RPMFVSPCVDKSKNPDFKVFRYSTSL-EKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEK 125          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Celegans
Match: sart-3 (SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:Q17430])

HSP 1 Score: 160.614 bits (405), Expect = 2.262e-40
Identity = 185/804 (23.01%), Postives = 343/804 (42.66%), Query Frame = 1
Query:  277 YYPLSPEMWIDWINDEKSINSDKDF--IRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEE------IRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQ-----KERIYKIYLRQLSLSLQSNDET----------LKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIEN---YIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDY---KSSGLK--AKKVK-----FSEELSTET----------------VTASVSIEQPIERCEE-KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDK--SRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSS--QSIDFKPP-------IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            + PL+P  W +WI D ++   +     +  +F +A+ D   V +W E   +      DK +       R     A+  +GT    G  IW  +L YE S ++ +  N        ++++ ++ R L       ++            K+  +  +  K + + +  K +LSK        FE+ I   ET             K+    ++  + + +     I   +ER +++L   +  WI+Y  +     +  +  + K Y RA+R+   S  L    +   E      +EI   +       +N       L++ Y    +R++      + D + + E+FD+   +      + +D      +   +  A    NM K R +W+ I+ S     +  W+E +  ER+FGD E+ ++  N A+N  +D    +    ++   EE  L       +K+++Q    + R  K+ +E P  P  +   D+   ++SG +   KKVK     F   L                       S ++++     E+ +TIFVSNL ++  E+++RQ  E    +A IR  + ++     RGFA++  ++    ++AL  +R  +  RPMF+S  +   +  F +S   +E +K+FV+N+    T   L+ +F +FG +  +R VT K G PKGIA+V++  E  A K +   D + + +R +EV LS PPVK+  K  G+ ++   S++   P       + ++PR +  K      ++    + D  +G       SN  FRK  M
Sbjct:   65 WAPLNPLNWKNWIEDFQNRKPEPSVAEVEEMFEKALFDENDVTIWVERAMYAYKVANDKNKKEDFKFCRDVCSKALENLGTRYDSGGHIWLIFLEYEMS-YLKNSMNAPDYQRLADQVFALFERALHCPTDQLEDVYVLAEQFCTEFKQHHKLEELKKTYNSTMRQKEQLSK--------FEELIQQEET-------------KKQGLKQFFDHEKKSGIPSRIKMAHERLVSELDDDEEAWIAYGAWADIELKLPQVAV-KVYSRALRHCPYSFVLHQQALLAFERDRRPNEEIDALWERARSNVINSAEEGRSLYRTYAFLLRRRI--HLTGSSDYSPMAEVFDEGAALLREWFSMAWDTTADYRQMQAYFYASLMKNMDKCRNIWNDILASGFGRFAGKWIEAVRLERQFGDKENARKYLNKALNSVSDNINEIYMYYVQFEREEGTLAELDLVLEKVNSQVAHRAIRPQKKVSEKPA-PAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPLPPSNAKSSSAVSSSNASSTPAPGSFAVQKAAPGTEDARTIFVSNLDFTTTEDEIRQAIEG---VASIRFARKANSDLVHRGFAYVVMENDQKAQQALLKDRVPVKGRPMFISANDPEKRVGFKFST-TLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVASGDKLMLRERELEVALSNPPVKKD-KSHGKPAAIGASLEEDGPRKGHAAKLQLVPRAITNKTPQITARL---DAMDVSEGTSTSQPLSNDQFRKMFM 834          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Celegans
Match: sart-3 (SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:Q17430])

HSP 1 Score: 160.614 bits (405), Expect = 2.262e-40
Identity = 185/804 (23.01%), Postives = 343/804 (42.66%), Query Frame = 1
Query:  277 YYPLSPEMWIDWINDEKSINSDKDF--IRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEE------IRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQ-----KERIYKIYLRQLSLSLQSNDET----------LKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIEN---YIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDY---KSSGLK--AKKVK-----FSEELSTET----------------VTASVSIEQPIERCEE-KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDK--SRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSS--QSIDFKPP-------IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            + PL+P  W +WI D ++   +     +  +F +A+ D   V +W E   +      DK +       R     A+  +GT    G  IW  +L YE S ++ +  N        ++++ ++ R L       ++            K+  +  +  K + + +  K +LSK        FE+ I   ET             K+    ++  + + +     I   +ER +++L   +  WI+Y  +     +  +  + K Y RA+R+   S  L    +   E      +EI   +       +N       L++ Y    +R++      + D + + E+FD+   +      + +D      +   +  A    NM K R +W+ I+ S     +  W+E +  ER+FGD E+ ++  N A+N  +D    +    ++   EE  L       +K+++Q    + R  K+ +E P  P  +   D+   ++SG +   KKVK     F   L                       S ++++     E+ +TIFVSNL ++  E+++RQ  E    +A IR  + ++     RGFA++  ++    ++AL  +R  +  RPMF+S  +   +  F +S   +E +K+FV+N+    T   L+ +F +FG +  +R VT K G PKGIA+V++  E  A K +   D + + +R +EV LS PPVK+  K  G+ ++   S++   P       + ++PR +  K      ++    + D  +G       SN  FRK  M
Sbjct:   65 WAPLNPLNWKNWIEDFQNRKPEPSVAEVEEMFEKALFDENDVTIWVERAMYAYKVANDKNKKEDFKFCRDVCSKALENLGTRYDSGGHIWLIFLEYEMS-YLKNSMNAPDYQRLADQVFALFERALHCPTDQLEDVYVLAEQFCTEFKQHHKLEELKKTYNSTMRQKEQLSK--------FEELIQQEET-------------KKQGLKQFFDHEKKSGIPSRIKMAHERLVSELDDDEEAWIAYGAWADIELKLPQVAV-KVYSRALRHCPYSFVLHQQALLAFERDRRPNEEIDALWERARSNVINSAEEGRSLYRTYAFLLRRRI--HLTGSSDYSPMAEVFDEGAALLREWFSMAWDTTADYRQMQAYFYASLMKNMDKCRNIWNDILASGFGRFAGKWIEAVRLERQFGDKENARKYLNKALNSVSDNINEIYMYYVQFEREEGTLAELDLVLEKVNSQVAHRAIRPQKKVSEKPA-PAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPLPPSNAKSSSAVSSSNASSTPAPGSFAVQKAAPGTEDARTIFVSNLDFTTTEDEIRQAIEG---VASIRFARKANSDLVHRGFAYVVMENDQKAQQALLKDRVPVKGRPMFISANDPEKRVGFKFST-TLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVASGDKLMLRERELEVALSNPPVKKD-KSHGKPAAIGASLEEDGPRKGHAAKLQLVPRAITNKTPQITARL---DAMDVSEGTSTSQPLSNDQFRKMFM 834          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Celegans
Match: sart-3 (SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:Q17430])

HSP 1 Score: 160.614 bits (405), Expect = 2.262e-40
Identity = 185/804 (23.01%), Postives = 343/804 (42.66%), Query Frame = 1
Query:  277 YYPLSPEMWIDWINDEKSINSDKDF--IRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEE------IRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQ-----KERIYKIYLRQLSLSLQSNDET----------LKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIEN---YIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDY---KSSGLK--AKKVK-----FSEELSTET----------------VTASVSIEQPIERCEE-KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDK--SRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSS--QSIDFKPP-------IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            + PL+P  W +WI D ++   +     +  +F +A+ D   V +W E   +      DK +       R     A+  +GT    G  IW  +L YE S ++ +  N        ++++ ++ R L       ++            K+  +  +  K + + +  K +LSK        FE+ I   ET             K+    ++  + + +     I   +ER +++L   +  WI+Y  +     +  +  + K Y RA+R+   S  L    +   E      +EI   +       +N       L++ Y    +R++      + D + + E+FD+   +      + +D      +   +  A    NM K R +W+ I+ S     +  W+E +  ER+FGD E+ ++  N A+N  +D    +    ++   EE  L       +K+++Q    + R  K+ +E P  P  +   D+   ++SG +   KKVK     F   L                       S ++++     E+ +TIFVSNL ++  E+++RQ  E    +A IR  + ++     RGFA++  ++    ++AL  +R  +  RPMF+S  +   +  F +S   +E +K+FV+N+    T   L+ +F +FG +  +R VT K G PKGIA+V++  E  A K +   D + + +R +EV LS PPVK+  K  G+ ++   S++   P       + ++PR +  K      ++    + D  +G       SN  FRK  M
Sbjct:   65 WAPLNPLNWKNWIEDFQNRKPEPSVAEVEEMFEKALFDENDVTIWVERAMYAYKVANDKNKKEDFKFCRDVCSKALENLGTRYDSGGHIWLIFLEYEMS-YLKNSMNAPDYQRLADQVFALFERALHCPTDQLEDVYVLAEQFCTEFKQHHKLEELKKTYNSTMRQKEQLSK--------FEELIQQEET-------------KKQGLKQFFDHEKKSGIPSRIKMAHERLVSELDDDEEAWIAYGAWADIELKLPQVAV-KVYSRALRHCPYSFVLHQQALLAFERDRRPNEEIDALWERARSNVINSAEEGRSLYRTYAFLLRRRI--HLTGSSDYSPMAEVFDEGAALLREWFSMAWDTTADYRQMQAYFYASLMKNMDKCRNIWNDILASGFGRFAGKWIEAVRLERQFGDKENARKYLNKALNSVSDNINEIYMYYVQFEREEGTLAELDLVLEKVNSQVAHRAIRPQKKVSEKPA-PAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPLPPSNAKSSSAVSSSNASSTPAPGSFAVQKAAPGTEDARTIFVSNLDFTTTEDEIRQAIEG---VASIRFARKANSDLVHRGFAYVVMENDQKAQQALLKDRVPVKGRPMFISANDPEKRVGFKFST-TLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVASGDKLMLRERELEVALSNPPVKKD-KSHGKPAAIGASLEEDGPRKGHAAKLQLVPRAITNKTPQITARL---DAMDVSEGTSTSQPLSNDQFRKMFM 834          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Celegans
Match: sart-3 (SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:Q17430])

HSP 1 Score: 160.614 bits (405), Expect = 2.262e-40
Identity = 185/804 (23.01%), Postives = 343/804 (42.66%), Query Frame = 1
Query:  277 YYPLSPEMWIDWINDEKSINSDKDF--IRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEE------IRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQ-----KERIYKIYLRQLSLSLQSNDET----------LKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIEN---YIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDY---KSSGLK--AKKVK-----FSEELSTET----------------VTASVSIEQPIERCEE-KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDK--SRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSS--QSIDFKPP-------IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            + PL+P  W +WI D ++   +     +  +F +A+ D   V +W E   +      DK +       R     A+  +GT    G  IW  +L YE S ++ +  N        ++++ ++ R L       ++            K+  +  +  K + + +  K +LSK        FE+ I   ET             K+    ++  + + +     I   +ER +++L   +  WI+Y  +     +  +  + K Y RA+R+   S  L    +   E      +EI   +       +N       L++ Y    +R++      + D + + E+FD+   +      + +D      +   +  A    NM K R +W+ I+ S     +  W+E +  ER+FGD E+ ++  N A+N  +D    +    ++   EE  L       +K+++Q    + R  K+ +E P  P  +   D+   ++SG +   KKVK     F   L                       S ++++     E+ +TIFVSNL ++  E+++RQ  E    +A IR  + ++     RGFA++  ++    ++AL  +R  +  RPMF+S  +   +  F +S   +E +K+FV+N+    T   L+ +F +FG +  +R VT K G PKGIA+V++  E  A K +   D + + +R +EV LS PPVK+  K  G+ ++   S++   P       + ++PR +  K      ++    + D  +G       SN  FRK  M
Sbjct:   65 WAPLNPLNWKNWIEDFQNRKPEPSVAEVEEMFEKALFDENDVTIWVERAMYAYKVANDKNKKEDFKFCRDVCSKALENLGTRYDSGGHIWLIFLEYEMS-YLKNSMNAPDYQRLADQVFALFERALHCPTDQLEDVYVLAEQFCTEFKQHHKLEELKKTYNSTMRQKEQLSK--------FEELIQQEET-------------KKQGLKQFFDHEKKSGIPSRIKMAHERLVSELDDDEEAWIAYGAWADIELKLPQVAV-KVYSRALRHCPYSFVLHQQALLAFERDRRPNEEIDALWERARSNVINSAEEGRSLYRTYAFLLRRRI--HLTGSSDYSPMAEVFDEGAALLREWFSMAWDTTADYRQMQAYFYASLMKNMDKCRNIWNDILASGFGRFAGKWIEAVRLERQFGDKENARKYLNKALNSVSDNINEIYMYYVQFEREEGTLAELDLVLEKVNSQVAHRAIRPQKKVSEKPA-PAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPLPPSNAKSSSAVSSSNASSTPAPGSFAVQKAAPGTEDARTIFVSNLDFTTTEDEIRQAIEG---VASIRFARKANSDLVHRGFAYVVMENDQKAQQALLKDRVPVKGRPMFISANDPEKRVGFKFST-TLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVASGDKLMLRERELEVALSNPPVKKD-KSHGKPAAIGASLEEDGPRKGHAAKLQLVPRAITNKTPQITARL---DAMDVSEGTSTSQPLSNDQFRKMFM 834          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 70.8626 bits (172), Expect = 1.511e-12
Identity = 59/248 (23.79%), Postives = 118/248 (47.58%), Query Frame = 1
Query: 1612 RMKEEAENPTKPQKRKTPDYKSSGLKA------KKVKFSEELSTETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDL----RQKFEKCGKIAE-----IRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNS--SNKHSFSY-------SVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLS 2283
            R + E + P +P+K +  D   +G +       K ++ + ++   +V ++V +  P   C+ + ++V N+ +  NE  +     Q+   CG +A+     I + + + DK+  FAFI+F S       +  +    + + + V R      ++++F         ++ V  ANK+F+  LP  +T+  ++ +   FG LK   L     G  KG A+ EY +     +A+ G +GM++GD+ + V L+
Sbjct:   97 RREPEPQKPREPKKYRFWDVPPTGFETTTPMEYKNMQAAGQVPRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCG-LAQAPGNPILLCQINLDKN--FAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFDMNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLA 341          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Fly
Match: Caper (gene:FBgn0031883 transcript:FBtr0089640)

HSP 1 Score: 69.3218 bits (168), Expect = 8.591e-12
Identity = 54/181 (29.83%), Postives = 92/181 (50.83%), Query Frame = 1
Query: 1759 PIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIR-IQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEAN------KLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            P ER + +T+F   L   V   DL + F   GK+ ++R I  +   + +G A+I+FD   +V  AL L  + LL  P+ V    +  K+    +    +        +L+V +L  N+T+  L  IF+ FG +  I+L+   ++G  KG  ++ Y N +DA KAL   +G E+  R+++V 
Sbjct:  231 PEER-DARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQRLLGVPIMVQHTQAE-KNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVG 409          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Fly
Match: Caper (gene:FBgn0031883 transcript:FBtr0089636)

HSP 1 Score: 69.3218 bits (168), Expect = 8.591e-12
Identity = 54/181 (29.83%), Postives = 92/181 (50.83%), Query Frame = 1
Query: 1759 PIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIR-IQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEAN------KLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            P ER + +T+F   L   V   DL + F   GK+ ++R I  +   + +G A+I+FD   +V  AL L  + LL  P+ V    +  K+    +    +        +L+V +L  N+T+  L  IF+ FG +  I+L+   ++G  KG  ++ Y N +DA KAL   +G E+  R+++V 
Sbjct:  231 PEER-DARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQRLLGVPIMVQHTQAE-KNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVG 409          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Fly
Match: Rnp4F (gene:FBgn0014024 transcript:FBtr0112876)

HSP 1 Score: 67.3958 bits (163), Expect = 4.405e-11
Identity = 46/136 (33.82%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 2002 CNSSNKHS-FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPRTVGLKPMATQK 2406
             N+  K S F YS  + E NK+FV+NL    +K  L  +F  FG +K++RLV   +   KGIAYVE+    +A +A+ G DG       I V +S PP + +        S +   + P  +IP T+  + +A +K
Sbjct:  706 ANAEAKESNFKYSPNM-EINKIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRAVAGRDGCLFKGMNISVAISNPPPRGT---SAVKPSVAPKRRVPTSLIPTTLVRQEVAAKK 837          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Fly
Match: Rnp4F (gene:FBgn0014024 transcript:FBtr0070752)

HSP 1 Score: 67.3958 bits (163), Expect = 4.405e-11
Identity = 46/136 (33.82%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 2002 CNSSNKHS-FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPRTVGLKPMATQK 2406
             N+  K S F YS  + E NK+FV+NL    +K  L  +F  FG +K++RLV   +   KGIAYVE+    +A +A+ G DG       I V +S PP + +        S +   + P  +IP T+  + +A +K
Sbjct:  706 ANAEAKESNFKYSPNM-EINKIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRAVAGRDGCLFKGMNISVAISNPPPRGT---SAVKPSVAPKRRVPTSLIPTTLVRQEVAAKK 837          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Fly
Match: Rnp4F (gene:FBgn0014024 transcript:FBtr0340477)

HSP 1 Score: 67.3958 bits (163), Expect = 4.405e-11
Identity = 46/136 (33.82%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 2002 CNSSNKHS-FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPRTVGLKPMATQK 2406
             N+  K S F YS  + E NK+FV+NL    +K  L  +F  FG +K++RLV   +   KGIAYVE+    +A +A+ G DG       I V +S PP + +        S +   + P  +IP T+  + +A +K
Sbjct:  706 ANAEAKESNFKYSPNM-EINKIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRAVAGRDGCLFKGMNISVAISNPPPRGT---SAVKPSVAPKRRVPTSLIPTTLVRQEVAAKK 837          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Zebrafish
Match: sart3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:NCBI gene;Acc:558581])

HSP 1 Score: 237.654 bits (605), Expect = 1.367e-65
Identity = 146/526 (27.76%), Postives = 266/526 (50.57%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSIN---SDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYE-------KSPFVDDGSNEQKE-------RIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQ----------CSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            AEI +++   E +  N  DY+ H  LI  L+   K+   R++R+ M   +PL+ E+W+DW+ DE  I    SD++ +  +F RAI+DY   ++W EY Q+ +G +  +   E +R  FE A+  VG H+TKG  IW  Y  +E       + P     S EQ+E       RI+ ++ RQL++ L   + T  E+   +  +      +  ++  + Q++    P+E+ +            S+ P+  E       +  E + ++++I+  +ERA+ + CL  ++WI Y  YL +   + ++ +L A++RAVRN   ++ LW  Y+  +E +      ++  F           T ++ +WQ+YLD+ +R++D     +++L  +R  F + +    Y+  D +          C+L++ W  IEA +  NM K+RELW  IM       +++WLE    ER +GD  H ++  + AV C +DYPE++C+ +L     E  L+ +    +K +T+  ++ E+R +
Sbjct:   58 AEIQRLE---EQLSINAFDYNCHVDLIKLLRQEGKLHRLRKARQKMSELFPLTEEIWLDWLKDEIRITEDESDREKVYELFERAIKDYVCPEIWLEYVQYSIGGMGAQGGIERVRSIFERALTAVGLHMTKGASIWEAYREFEIVILSTVQPPPGTVPSQEQQELLSAQLERIHTLFRRQLAVPLMDMEGTYAEY--SDWADDGVPETVTHQYRRALQQMEKGKPYEEALL----------VSEPPKLAEYQSYIDFEIKEGDPARVQII--FERALAENCLVPDLWIKYTTYLDRQL-KIKDLVLSAHERAVRNCPWTMGLWKSYLLALERHGADHQTVKDVFEKALNAGFIQATDYVEIWQSYLDYLRRRVDFSKGKSMELDELRAAFSRSL---EYLKQDVEERFSESGDLSCTLMQIWARIEALHCKNMQKARELWDSIMTKGNAKYANMWLEYYNLERSYGDAAHCRKALHRAVQCTSDYPEHVCDVLLNFERVEGSLEDWDAAVQKTETKLNRVCEQRAR 562          

HSP 2 Score: 118.242 bits (295), Expect = 1.185e-26
Identity = 84/270 (31.11%), Postives = 141/270 (52.22%), Query Frame = 1
Query: 1765 ERCEEKTIFVSNLKYSVN--ENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPP-------------IGMIPRTVGLKPMATQK------KIIHGASSDSQDGNIAEAKK-SNADFRKFLM 2496
            +R +E  +FVSNL +++   E  LR  F+ CG I ++R    +    RG+ ++QF+ +  V EALK++R+ +  RPM+VS C   NK+     F Y   + E +K+F+  LP + TK  LE++ K+ G ++ IR+VT +SG  KG+AYVE+ +E  AS+A++  DG  + +  + V +S PP +    KD  + S+ +    P             I ++PR++  +     K         H   +D +     + K  SN DF + L+
Sbjct:  683 QRKDENCVFVSNLTFNMEDPEGKLRTLFQGCGTIQQVRPVFTAKGTFRGYCYVQFEDRLAVPEALKMDRQEVDGRPMYVSPCVDKNKNPDFKVFKYKTSM-EKHKIFISGLPYSATKETLEDLCKEHGTIRAIRIVTNRSGKSKGLAYVEFEDEAQASQAVLKMDGTMLENFTLSVAISNPPGRRM--KDEAAPSRFLGAAMPRQLQGARGKGRTQISLLPRSLYRQSTPDAKAENGTISAPHATVTDGETSLDTQTKSLSNEDFARMLL 949          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Zebrafish
Match: sart3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:NCBI gene;Acc:558581])

HSP 1 Score: 234.958 bits (598), Expect = 1.006e-64
Identity = 146/526 (27.76%), Postives = 266/526 (50.57%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSIN---SDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYE-------KSPFVDDGSNEQKE-------RIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQ----------CSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            AEI +++   E +  N  DY+ H  LI  L+   K+   R++R+ M   +PL+ E+W+DW+ DE  I    SD++ +  +F RAI+DY   ++W EY Q+ +G +  +   E +R  FE A+  VG H+TKG  IW  Y  +E       + P     S EQ+E       RI+ ++ RQL++ L   + T  E+   +  +      +  ++  + Q++    P+E+ +            S+ P+  E       +  E + ++++I+  +ERA+ + CL  ++WI Y  YL +   + ++ +L A++RAVRN   ++ LW  Y+  +E +      ++  F           T ++ +WQ+YLD+ +R++D   + + +L  +R  F + +    Y+  D +          C+L++ W  IEA +  NM K+RELW  IM       +++WLE    ER +GD  H ++  + AV C +DYPE++C+ +L     E  L+ +    +K +T+  ++ E+R +
Sbjct:   58 AEIQRLE---EQLSINAFDYNCHVDLIKLLRQEGKLHRLRKARQKMSELFPLTEEIWLDWLKDEIRITEDESDREKVYELFERAIKDYVCPEIWLEYVQYSIGGMGAQGGIERVRSIFERALTAVGLHMTKGASIWEAYREFEIVILSTVQPPPGTVPSQEQQELLSAQLERIHTLFRRQLAVPLMDMEGTYAEY--SDWADDGVPETVTHQYRRALQQMEKGKPYEEALL----------VSEPPKLAEYQSYIDFEIKEGDPARVQII--FERALAENCLVPDLWIKYTTYLDRQL-KIKDLVLSAHERAVRNCPWTMGLWKSYLLALERHGADHQTVKDVFEKALNAGFIQATDYVEIWQSYLDYLRRRVDFSKEWSRELDELRAAFSRSL---EYLKQDVEERFSESGDLSCTLMQIWARIEALHCKNMQKARELWDSIMTKGNAKYANMWLEYYNLERSYGDAAHCRKALHRAVQCTSDYPEHVCDVLLNFERVEGSLEDWDAAVQKTETKLNRVCEQRAR 562          

HSP 2 Score: 118.242 bits (295), Expect = 1.032e-26
Identity = 84/270 (31.11%), Postives = 141/270 (52.22%), Query Frame = 1
Query: 1765 ERCEEKTIFVSNLKYSVN--ENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPP-------------IGMIPRTVGLKPMATQK------KIIHGASSDSQDGNIAEAKK-SNADFRKFLM 2496
            +R +E  +FVSNL +++   E  LR  F+ CG I ++R    +    RG+ ++QF+ +  V EALK++R+ +  RPM+VS C   NK+     F Y   + E +K+F+  LP + TK  LE++ K+ G ++ IR+VT +SG  KG+AYVE+ +E  AS+A++  DG  + +  + V +S PP +    KD  + S+ +    P             I ++PR++  +     K         H   +D +     + K  SN DF + L+
Sbjct:  683 QRKDENCVFVSNLTFNMEDPEGKLRTLFQGCGTIQQVRPVFTAKGTFRGYCYVQFEDRLAVPEALKMDRQEVDGRPMYVSPCVDKNKNPDFKVFKYKTSM-EKHKIFISGLPYSATKETLEDLCKEHGTIRAIRIVTNRSGKSKGLAYVEFEDEAQASQAVLKMDGTMLENFTLSVAISNPPGRRM--KDEAAPSRFLGAAMPRQLQGARGKGRTQISLLPRSLYRQSTPDAKAENGTISAPHATVTDGETSLDTQTKSLSNEDFARMLL 949          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Zebrafish
Match: pabpc1l (poly(A) binding protein, cytoplasmic 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-5836])

HSP 1 Score: 69.3218 bits (168), Expect = 9.587e-12
Identity = 44/168 (26.19%), Postives = 83/168 (49.40%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXX-RPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            IF+ N+  S++   L   F   G I   ++  D  + S+G+ F+ F++Q     A++    +LL  R +FV    S  +         VE   +++KN  +++    L+NIF +FG    + ++T + G  +G  +V + N  DA +A+   +G E+  RV+ V  ++
Sbjct:  101 IFIKNMDESIDNKALYDTFSAFGNILSCKVVCD-ENGSKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREAEMGAKAVEFTNVYIKNFGEDIDSEKLKNIFTEFGKTLSVCVMTDERGRSRGFGFVNFVNHGDARRAVTEMNGKELNGRVLYVGRAQ 267          

HSP 2 Score: 59.3066 bits (142), Expect = 1.652e-8
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDS-HDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDF 2346
            +++V +L   V E  L QKF   G+I  IR+ +D    +S G+A+I F    D++  ++       +    R M+  R     K              +F+KN+ +++   AL + F  FG +   ++V  ++G  KG  +V +  +  A++A+   +GM + DR + V       K   +++ E  +++++F
Sbjct:   12 SLYVGDLHADVTEAMLYQKFSPAGQIMSIRVCRDVITRRSLGYAYINFQQPADAECALDTMNYEVIKGRPIRIMWSQRDPGLRKSG---------VGNIFIKNMDESIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGH----FKSRKEREAEMGAKAVEF 190          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Zebrafish
Match: pabpc1l (poly(A) binding protein, cytoplasmic 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-5836])

HSP 1 Score: 69.3218 bits (168), Expect = 9.587e-12
Identity = 44/168 (26.19%), Postives = 83/168 (49.40%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXX-RPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            IF+ N+  S++   L   F   G I   ++  D  + S+G+ F+ F++Q     A++    +LL  R +FV    S  +         VE   +++KN  +++    L+NIF +FG    + ++T + G  +G  +V + N  DA +A+   +G E+  RV+ V  ++
Sbjct:  101 IFIKNMDESIDNKALYDTFSAFGNILSCKVVCD-ENGSKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREAEMGAKAVEFTNVYIKNFGEDIDSEKLKNIFTEFGKTLSVCVMTDERGRSRGFGFVNFVNHGDARRAVTEMNGKELNGRVLYVGRAQ 267          

HSP 2 Score: 59.3066 bits (142), Expect = 1.652e-8
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDS-HDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDF 2346
            +++V +L   V E  L QKF   G+I  IR+ +D    +S G+A+I F    D++  ++       +    R M+  R     K              +F+KN+ +++   AL + F  FG +   ++V  ++G  KG  +V +  +  A++A+   +GM + DR + V       K   +++ E  +++++F
Sbjct:   12 SLYVGDLHADVTEAMLYQKFSPAGQIMSIRVCRDVITRRSLGYAYINFQQPADAECALDTMNYEVIKGRPIRIMWSQRDPGLRKSG---------VGNIFIKNMDESIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGH----FKSRKEREAEMGAKAVEF 190          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Zebrafish
Match: pabpc1l (poly(A) binding protein, cytoplasmic 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-5836])

HSP 1 Score: 69.3218 bits (168), Expect = 1.067e-11
Identity = 44/168 (26.19%), Postives = 83/168 (49.40%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXX-RPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            IF+ N+  S++   L   F   G I   ++  D  + S+G+ F+ F++Q     A++    +LL  R +FV    S  +         VE   +++KN  +++    L+NIF +FG    + ++T + G  +G  +V + N  DA +A+   +G E+  RV+ V  ++
Sbjct:  101 IFIKNMDESIDNKALYDTFSAFGNILSCKVVCD-ENGSKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREAEMGAKAVEFTNVYIKNFGEDIDSEKLKNIFTEFGKTLSVCVMTDERGRSRGFGFVNFVNHGDARRAVTEMNGKELNGRVLYVGRAQ 267          

HSP 2 Score: 59.3066 bits (142), Expect = 1.627e-8
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDS-HDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDF 2346
            +++V +L   V E  L QKF   G+I  IR+ +D    +S G+A+I F    D++  ++       +    R M+  R     K              +F+KN+ +++   AL + F  FG +   ++V  ++G  KG  +V +  +  A++A+   +GM + DR + V       K   +++ E  +++++F
Sbjct:   12 SLYVGDLHADVTEAMLYQKFSPAGQIMSIRVCRDVITRRSLGYAYINFQQPADAECALDTMNYEVIKGRPIRIMWSQRDPGLRKSG---------VGNIFIKNMDESIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVG----HFKSRKEREAEMGAKAVEF 190          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Xenopus
Match: hbp1 (HMG-box transcription factor 1 [Source:Xenbase;Acc:XB-GENE-950343])

HSP 1 Score: 220.32 bits (560), Expect = 1.280e-61
Identity = 144/501 (28.74%), Postives = 249/501 (49.70%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDF---IRAIFLRAIEDYKSVDVWFEYCQF---MLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKY--FESNCSKIEILNL-YERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDY----------DPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSN-SSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            N  DY+ H  LI  L+   ++   R +R+ M   +PL+ E+W+DW+ DE  +  +  +   +  +F RA++DY   ++W EY Q+    +G      ++R  FE A+  VG H+TKG  +W  Y  +E    +    + Q ERI+K++ RQL + L   + T  E+       +  +  +   ++ + Q++    P+E+ +   ET   A               EY  Y  FE N      + L +ERA+ + CL  ++W  Y +YL +   + ++ +L A+ RAVRN   +++LW  Y+   E +      I   F           T ++ +WQ YLD+ +R++D     + +L  +R +F + +   +Y+            DP CS+++ W  IEA++  NM K+RELW  IM + GNS  +++WLE    ER  GD +H ++  + AV C TDYPE++CE +L +   E  L+ +     K + +  ++ E+R K
Sbjct:   40 NAFDYNCHVDLIKLLRQEGELERLRRARQKMSELFPLTEEIWLDWLKDEMKVADEGSYREKVYELFERAVKDYICPEIWLEYAQYSIGGMGEEGGIAKVRSIFERALTAVGLHMTKGSTLWDAYREFENQQML----HAQLERIHKLFRRQLGVPLFDMNSTYAEY--EEWSEEPMQEALIQSYKKALQQMEKCKPYEEALLAAETPKLA---------------EYQAYIDFEMNAGDPARIQLIFERALVENCLVPDLWARYTQYLDRQL-KVKDLVLSAHDRAVRNCPWTVDLWKRYILATERHCVDHKIISENFEKALNAGFIQATDYVEIWQYYLDYLRRRVDFTKDSSKELEELRSVFVRAL---DYLKQEVEERFGESGDPSCSIMQNWARIEARHCNNMQKARELWDSIM-TRGNSRFANMWLEYYNLERAHGDIQHCRKALHRAVQCTTDYPEHVCEVLLSLERIEGTLEDWDTAVLKTENRLSRVKEQRAK 514          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Xenopus
Match: hbp1 (HMG-box transcription factor 1 [Source:Xenbase;Acc:XB-GENE-950343])

HSP 1 Score: 207.608 bits (527), Expect = 2.562e-57
Identity = 141/492 (28.66%), Postives = 243/492 (49.39%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDF---IRAIFLRAIEDYKSVDVWFEYCQF---MLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKY--FESNCSKIEILNL-YERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQ-CSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSN-SSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            N  DY+ H  LI  L+   ++   R +R+ M   +PL+ E+W+DW+ DE  +  +  +   +  +F RA++DY   ++W EY Q+    +G      ++R  FE A+  VG H+TKG  +W  Y  +E    +    + Q ERI+K++ RQL + L   + T  E+       +  +  +   ++ + Q++    P+E+ +   ET   A               EY  Y  FE N      + L +ERA+ + CL  ++W  Y +YL +   + ++ +L A+ RAVRN   +++LW  Y+   E +      I   F           T ++ +WQ YLD+ +R++D     + +L  +R +F + +      DY  Q     K+  F+ A++  NM K+RELW  IM + GNS  +++WLE    ER  GD +H ++  + AV C TDYPE++CE +L +   E  L+ +     K + +  ++ E+R K
Sbjct:   17 NAFDYNCHVDLIKLLRQEGELERLRRARQKMSELFPLTEEIWLDWLKDEMKVADEGSYREKVYELFERAVKDYICPEIWLEYAQYSIGGMGEEGGIAKVRSIFERALTAVGLHMTKGSTLWDAYREFENQQML----HAQLERIHKLFRRQLGVPLFDMNSTYAEY--EEWSEEPMQEALIQSYKKALQQMEKCKPYEEALLAAETPKLA---------------EYQAYIDFEMNAGDPARIQLIFERALVENCLVPDLWARYTQYLDRQL-KVKDLVLSAHDRAVRNCPWTVDLWKRYILATERHCVDHKIISENFEKALNAGFIQATDYVEIWQYYLDYLRRRVDFTKDSSKELEELRSVFVRAL------DYLKQEVEERKFLCFLLARHCNNMQKARELWDSIM-TRGNSRFANMWLEYYNLERAHGDIQHCRKALHRAVQCTTDYPEHVCEVLLSLERIEGTLEDWDTAVLKTENRLSRVKEQRAK 479          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Xenopus
Match: hbp1 (HMG-box transcription factor 1 [Source:Xenbase;Acc:XB-GENE-950343])

HSP 1 Score: 205.682 bits (522), Expect = 1.813e-56
Identity = 143/506 (28.26%), Postives = 244/506 (48.22%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDF---IRAIFLRAIEDYKSVDVWFEYCQF---MLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEK--------------SPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKY--FESNCSKIEILNL-YERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQ-CSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSN-SSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            N  DY+ H  LI  L+   ++   R +R+ M   +PL+ E+W+DW+ DE  +  +  +   +  +F RA++DY   ++W EY Q+    +G      ++R  FE A+  VG H+TKG  +W  Y  +E               SP      + Q ERI+K++ RQL + L   + T  E+       +  +  +   ++ + Q++    P+E+ +   ET   A               EY  Y  FE N      + L +ERA+ + CL  ++W  Y +YL +   + ++ +L A+ RAVRN   +++LW  Y+   E +      I   F           T ++ +WQ YLD+ +R++D     + +L  +R +F + +      DY  Q     K+  F+ A++  NM K+RELW  IM + GNS  +++WLE    ER  GD +H ++  + AV C TDYPE++CE +L +   E  L+ +     K + +  ++ E+R K
Sbjct:   20 NAFDYNCHVDLIKLLRQEGELERLRRARQKMSELFPLTEEIWLDWLKDEMKVADEGSYREKVYELFERAVKDYICPEIWLEYAQYSIGGMGEEGGIAKVRSIFERALTAVGLHMTKGSTLWDAYREFENAILGTIQPVPGSIPSPEQQQMLHAQLERIHKLFRRQLGVPLFDMNSTYAEY--EEWSEEPMQEALIQSYKKALQQMEKCKPYEEALLAAETPKLA---------------EYQAYIDFEMNAGDPARIQLIFERALVENCLVPDLWARYTQYLDRQL-KVKDLVLSAHDRAVRNCPWTVDLWKRYILATERHCVDHKIISENFEKALNAGFIQATDYVEIWQYYLDYLRRRVDFTKDSSKELEELRSVFVRAL------DYLKQEVEERKFLCFLLARHCNNMQKARELWDSIM-TRGNSRFANMWLEYYNLERAHGDIQHCRKALHRAVQCTTDYPEHVCEVLLSLERIEGTLEDWDTAVLKTENRLSRVKEQRAK 500          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Xenopus
Match: hbp1 (HMG-box transcription factor 1 [Source:Xenbase;Acc:XB-GENE-950343])

HSP 1 Score: 203.371 bits (516), Expect = 4.282e-55
Identity = 144/508 (28.35%), Postives = 245/508 (48.23%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDF---IRAIFLRAIEDYKSVDVWFEYCQF---MLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYE--------------KSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKY--FESNCSKIEILNL-YERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQCSLVKYWTFIE---AKYAGNMPKSRELWSLIMKSLGNSN-SSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            N  DY+ H  LI  L+   ++   R +R+ M   +PL+ E+W+DW+ DE  +  +  +   +  +F RA++DY   ++W EY Q+    +G      ++R  FE A+  VG H+TKG  +W  Y  +E               SP      + Q ERI+K++ RQL + L   + T  E+       +  +  +   ++ + Q++    P+E+ +   ET   A               EY  Y  FE N      + L +ERA+ + CL  ++W  Y +YL +   + ++ +L A+ RAVRN   +++LW  Y+   E +      I   F           T ++ +WQ YLD+ +R++D     + +L  +R +F + +      DY  Q  L +  T I+   A++  NM K+RELW  IM + GNS  +++WLE    ER  GD +H ++  + AV C TDYPE++CE +L +   E  L+ +     K + +  ++ E+R K
Sbjct:   16 NAFDYNCHVDLIKLLRQEGELERLRRARQKMSELFPLTEEIWLDWLKDEMKVADEGSYREKVYELFERAVKDYICPEIWLEYAQYSIGGMGEEGGIAKVRSIFERALTAVGLHMTKGSTLWDAYREFENAILGTIQPVPGSIPSPEQQQMLHAQLERIHKLFRRQLGVPLFDMNSTYAEY--EEWSEEPMQEALIQSYKKALQQMEKCKPYEEALLAAETPKLA---------------EYQAYIDFEMNAGDPARIQLIFERALVENCLVPDLWARYTQYLDRQL-KVKDLVLSAHDRAVRNCPWTVDLWKRYILATERHCVDHKIISENFEKALNAGFIQATDYVEIWQYYLDYLRRRVDFTKDSSKELEELRSVFVRAL------DYLKQ-ELFQTRTCIKSNKARHCNNMQKARELWDSIM-TRGNSRFANMWLEYYNLERAHGDIQHCRKALHRAVQCTTDYPEHVCEVLLSLERIEGTLEDWDTAVLKTENRLSRVKEQRAK 497          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Xenopus
Match: hbp1 (HMG-box transcription factor 1 [Source:Xenbase;Acc:XB-GENE-950343])

HSP 1 Score: 201.83 bits (512), Expect = 5.706e-55
Identity = 144/508 (28.35%), Postives = 245/508 (48.23%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDF---IRAIFLRAIEDYKSVDVWFEYCQF---MLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEK--------------SPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKY--FESNCSKIEILNL-YERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQCSLVKYWTFIE---AKYAGNMPKSRELWSLIMKSLGNSN-SSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            N  DY+ H  LI  L+   ++   R +R+ M   +PL+ E+W+DW+ DE  +  +  +   +  +F RA++DY   ++W EY Q+    +G      ++R  FE A+  VG H+TKG  +W  Y  +E               SP      + Q ERI+K++ RQL + L   + T  E+       +  +  +   ++ + Q++    P+E+ +   ET   A               EY  Y  FE N      + L +ERA+ + CL  ++W  Y +YL +   + ++ +L A+ RAVRN   +++LW  Y+   E +      I   F           T ++ +WQ YLD+ +R++D     + +L  +R +F + +      DY  Q  L +  T I+   A++  NM K+RELW  IM + GNS  +++WLE    ER  GD +H ++  + AV C TDYPE++CE +L +   E  L+ +     K + +  ++ E+R K
Sbjct:   40 NAFDYNCHVDLIKLLRQEGELERLRRARQKMSELFPLTEEIWLDWLKDEMKVADEGSYREKVYELFERAVKDYICPEIWLEYAQYSIGGMGEEGGIAKVRSIFERALTAVGLHMTKGSTLWDAYREFENAILGTIQPVPGSIPSPEQQQMLHAQLERIHKLFRRQLGVPLFDMNSTYAEY--EEWSEEPMQEALIQSYKKALQQMEKCKPYEEALLAAETPKLA---------------EYQAYIDFEMNAGDPARIQLIFERALVENCLVPDLWARYTQYLDRQL-KVKDLVLSAHDRAVRNCPWTVDLWKRYILATERHCVDHKIISENFEKALNAGFIQATDYVEIWQYYLDYLRRRVDFTKDSSKELEELRSVFVRAL------DYLKQ-ELFQTRTCIKSNKARHCNNMQKARELWDSIM-TRGNSRFANMWLEYYNLERAHGDIQHCRKALHRAVQCTTDYPEHVCEVLLSLERIEGTLEDWDTAVLKTENRLSRVKEQRAK 521          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Mouse
Match: Sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:MGI Symbol;Acc:MGI:1858230])

HSP 1 Score: 366.696 bits (940), Expect = 2.872e-112
Identity = 259/901 (28.75%), Postives = 446/901 (49.50%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSI---NSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-IENYID------YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK-------------------------------------PQKRKTPDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEK--------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPR-----------TVGLKPMATQKKIIHGASSDSQDGN----------IAEAKK-SNADFRKFLM 2496
            ++I+   E +  N  DY+ H +LI  L+   ++   R +R+ M   +PL+ E+W++W++DE S+     D++ +  +F RA++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  IW  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+       +     +   ++ +  +L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RAVRN   ++ LW  Y+  ME +      I  TF           T ++ +WQ YLD+ +R++D +   + +L  +R +F + +  ++  ++       DP C +++ W  +EA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   K                                     P KR+  +   +  +A  +K   ELS + +T  V    P  + +EK                    T+FVSNL YS+ E +  LR  FE CG++ +IR    +    RG+ +++F  + + ++AL+L+R+++  RPMFVS C   +K+     F YS   +E +KLF+  LP + TK  LE+I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + VI+V +S PP ++ P+K        +   P   M+PR            + L P A Q++   GA+  +++G             EA K SNADF K L+
Sbjct:   97 LEIERLEEQLSINGYDYNCHVELIRLLRLEGELSRVRAARQKMSELFPLTEELWLEWLHDEISMAMDGLDREHVYELFERAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLAIWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYEMEATFAEY--EEWSEEPMPESVLQSYQKALGQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHSRAVRNCPWTVALWSRYLLAMERHGLDHQTISATFENALSAGFIQATDYVEIWQVYLDYLRRRVDFRQDSSKELEELRSMFTRALEYLQQEVEERFSESGDPSCLIMQSWARVEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGTLEDWDLAIQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKKVRAEKKALKKKKKTRGADKRREDEDEENEWGEEEEEQPSKRRRTENSLASGEASAMKEETELSGKCLTIDVG---PPSKQKEKAASLKRDMPKVAHDSSKDSVTVFVSNLPYSIEEPEVKLRPLFEVCGEVVQIRPIFSNRGDFRGYCYVEFGEEKSAQQALELDRKIVEGRPMFVSPCVDKSKNPDFKVFRYST-TLEKHKLFISGLPFSCTKEELEDICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIRENVIKVAISNPPQRKVPEKP------EVRTAPGAPMLPRQMYGARGKGRTQLSLLPRALQRQ---GAAPQAENGPAPGPAVAPSVATEAPKMSNADFAKLLL 960          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Mouse
Match: Sart3 (squamous cell carcinoma antigen recognized by T cells 3 [Source:MGI Symbol;Acc:MGI:1858230])

HSP 1 Score: 117.857 bits (294), Expect = 9.572e-28
Identity = 76/282 (26.95%), Postives = 145/282 (51.42%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSI---NSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYL 954
            ++I+   E +  N  DY+ H +LI  L+   ++   R +R+ M   +PL+ E+W++W++DE S+     D++ +  +F RA++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  IW  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+       +     +   ++ +  +L  Y P+E+ +   E    A               EY  Y +      + ++I++  ++ERA+ + CL  ++WI Y +YL
Sbjct:   97 LEIERLEEQLSINGYDYNCHVELIRLLRLEGELSRVRAARQKMSELFPLTEELWLEWLHDEISMAMDGLDREHVYELFERAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLAIWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYEMEATFAEY--EEWSEEPMPESVLQSYQKALGQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQL--IFERALVENCLVPDLWIRYSQYL 355          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Mouse
Match: Pabpc1l (poly(A) binding protein, cytoplasmic 1-like [Source:MGI Symbol;Acc:MGI:1922908])

HSP 1 Score: 70.8626 bits (172), Expect = 4.735e-12
Identity = 44/168 (26.19%), Postives = 85/168 (50.60%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXX-RPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            IF+ NL+ S++   L   F   G I   ++  + H  SRGF F+ F++    ++A+     +LL  R +FV    S  K         +    ++VKNL  NV +  L+++F QFG ++ ++++   +G  +G  +V +    +A KA+   +G E+  +++ V  ++
Sbjct:  101 IFIKNLENSIDNKALYDTFSTFGSILSSKVVYNEHG-SRGFGFVHFETHEAAQKAINTMNGMLLNDRKVFVGHFKSRQKREAELGARALGFTNIYVKNLHANVDEQRLQDLFSQFGNMQSVKVMRDSNGQSRGFGFVNFEKHEEAQKAVDHMNGKEVSGQLLYVGRAQ 267          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Mouse
Match: Rbm39 (RNA binding motif protein 39 [Source:MGI Symbol;Acc:MGI:2157953])

HSP 1 Score: 66.6254 bits (161), Expect = 4.997e-11
Identity = 49/179 (27.37%), Postives = 93/179 (51.96%), Query Frame = 1
Query: 1759 PIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYS----VGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            P ER + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+++F   S+V  A+ L  + +L  P+ V    +    + + +     G     +L+V +L  N+T+  L  IF+ FG ++ I+L+   ++G  KG  ++ +S+   A KAL   +G E+  R ++V 
Sbjct:  147 PEER-DARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVG 324          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Mouse
Match: Rbm39 (RNA binding motif protein 39 [Source:MGI Symbol;Acc:MGI:2157953])

HSP 1 Score: 66.6254 bits (161), Expect = 6.817e-11
Identity = 49/179 (27.37%), Postives = 93/179 (51.96%), Query Frame = 1
Query: 1759 PIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYS----VGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            P ER + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+++F   S+V  A+ L  + +L  P+ V    +    + + +     G     +L+V +L  N+T+  L  IF+ FG ++ I+L+   ++G  KG  ++ +S+   A KAL   +G E+  R ++V 
Sbjct:  147 PEER-DARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVG 324          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. UniProt/SwissProt
Match: sp|Q9JLI8|SART3_MOUSE (Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus OX=10090 GN=Sart3 PE=1 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 2.009e-111
Identity = 259/901 (28.75%), Postives = 446/901 (49.50%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSI---NSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-IENYID------YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK-------------------------------------PQKRKTPDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEK--------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPR-----------TVGLKPMATQKKIIHGASSDSQDGN----------IAEAKK-SNADFRKFLM 2496
            ++I+   E +  N  DY+ H +LI  L+   ++   R +R+ M   +PL+ E+W++W++DE S+     D++ +  +F RA++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  IW  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+       +     +   ++ +  +L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RAVRN   ++ LW  Y+  ME +      I  TF           T ++ +WQ YLD+ +R++D +   + +L  +R +F + +  ++  ++       DP C +++ W  +EA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   K                                     P KR+  +   +  +A  +K   ELS + +T  V    P  + +EK                    T+FVSNL YS+ E +  LR  FE CG++ +IR    +    RG+ +++F  + + ++AL+L+R+++  RPMFVS C   +K+     F YS   +E +KLF+  LP + TK  LE+I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + VI+V +S PP ++ P+K        +   P   M+PR            + L P A Q++   GA+  +++G             EA K SNADF K L+
Sbjct:   97 LEIERLEEQLSINGYDYNCHVELIRLLRLEGELSRVRAARQKMSELFPLTEELWLEWLHDEISMAMDGLDREHVYELFERAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLAIWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYEMEATFAEY--EEWSEEPMPESVLQSYQKALGQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHSRAVRNCPWTVALWSRYLLAMERHGLDHQTISATFENALSAGFIQATDYVEIWQVYLDYLRRRVDFRQDSSKELEELRSMFTRALEYLQQEVEERFSESGDPSCLIMQSWARVEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGTLEDWDLAIQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKKVRAEKKALKKKKKTRGADKRREDEDEENEWGEEEEEQPSKRRRTENSLASGEASAMKEETELSGKCLTIDVG---PPSKQKEKAASLKRDMPKVAHDSSKDSVTVFVSNLPYSIEEPEVKLRPLFEVCGEVVQIRPIFSNRGDFRGYCYVEFGEEKSAQQALELDRKIVEGRPMFVSPCVDKSKNPDFKVFRYST-TLEKHKLFISGLPFSCTKEELEDICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIRENVIKVAISNPPQRKVPEKP------EVRTAPGAPMLPRQMYGARGKGRTQLSLLPRALQRQ---GAAPQAENGPAPGPAVAPSVATEAPKMSNADFAKLLL 960          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. UniProt/SwissProt
Match: sp|Q15020|SART3_HUMAN (Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 3.368e-108
Identity = 257/900 (28.56%), Postives = 441/900 (49.00%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSD---KDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-----IENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK----------------PQKRKT---------PDYKSSGLKAKKVKFSEELSTETVT-----------ASVSIEQPIERCEEK-------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIG--MIPRTVG----------LKPMATQKKIIHGASSDSQDG-----------NIAEAKKSNADFRKFLM 2496
            ++I+   E +  N  DY+ H  LI  L+   ++ + R +R+ M   +PL+ E+W++W++DE S+  D   ++ +  +F +A++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  +W  Y  +E S  V+     + E+++ ++ RQL++ L   + T  E+             +   +  + Q+L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RA+RN   ++ LW  Y+  ME +      I  TF           T ++ +WQAYLD+ +R++D +   + +L  +R  F + +      +E   +   DP C +++ W  IEA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   +                P+KR            D +    K ++V+ S   + ET             A+V +E P ++ E+                    T+FVSNL YS+ E D  LR  FE CG++ +IR    +    RG+ +++F  + +  +AL+++R+ +  RPMFVS C   +K+     F YS   +E +KLF+  LP + TK  LE I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + +I+V +S PP ++ P+K           K P G  ++P+T G          L P A Q+     A+  +++G                K SNADF K  +
Sbjct:   96 LEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFE-SAIVEAA---RLEKVHSLFRRQLAIPLYDMEATFAEY--EEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTS-LEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETR-------KAPGGPMLLPQTYGARGKGRTQLSLLPRALQRP--SAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFL 961          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. UniProt/SwissProt
Match: sp|Q5REG1|SART3_PONAB (Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii OX=9601 GN=SART3 PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 6.824e-108
Identity = 260/914 (28.45%), Postives = 444/914 (48.58%), Query Frame = 1
Query:  142 MKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSD---KDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEK-------------SPFVDDGS-NEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-----IENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK-------------EEAENPTK----------------PQKRKT---------PDYKSSGLKAKKVKFSEELSTETVT-----------ASVSIEQPIERCEEK-------------------TIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIG--MIPRTVG----------LKPMATQKKIIHGASSDSQDG-----------NIAEAKKSNADFRKFLM 2496
            ++I+   E +  N  DY+ H  LI  L+   ++ + R +R+ M   +PL+ E+W++W++DE S+  D   ++ +  +F +A++DY   ++W EY Q+ +G +  K   E++R  FE A++ VG H+TKG  +W  Y  +E              SPF  + + + Q E+++ ++ RQL++ L   + T  E+             +   +  + Q+L  Y P+E+ +   E    A               EY  Y +      + ++I+++  +ERA+ + CL  ++WI Y +YL +   + ++ +L  + RA+RN   ++ LW  Y+  ME +      I  TF           T ++ +WQAYLD+ +R++D +   + +L  +R  F + +      +E   +   DP C +++ W  IEA+   NM K+RELW  IM       +++WLE    ER  GD +H ++  + AV C +DYPE++CE +L +   E  L+ +    +K +T+  +++E+RMK             E+AE   +                P+KR            D +    K ++V+ S   + ET             A+V +E P ++ E+                    T+FVSNL YS+ E D  LR  FE CG++ +IR    +    RG+ +++F  + +  +AL+++R+ +  RPMFVS C   +K+     F YS   +E +KLF+  LP + TK  LE I K  G +K++RLVT ++G PKG+AYVEY NE+ AS+A++  DGM I + VI+V +S PP ++ P+K           K P G  ++P+T G          L P A Q+     A+  +++G                K SNADF K  +
Sbjct:   96 LEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVEAARPVAGFLSPFDREQTFDSQLEKVHSLFRRQLAIPLYDMEATFAEY--EEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLA---------------EYQAYIDFEMKIGDPARIQLI--FERALVENCLVPDLWIRYSQYLDRQL-KVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAPGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDAKLRPLFEACGEVVQIRPIFSNRGDFRGYRYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTS-LEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENVIKVAISNPPQRKVPEKPETR-------KAPGGPTLLPQTYGARGKGRTQLSLLPRALQRP--GAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFL 979          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. UniProt/SwissProt
Match: sp|B3DJT0|SART3_DANRE (Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio OX=7955 GN=sart3 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 7.592e-64
Identity = 146/526 (27.76%), Postives = 266/526 (50.57%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSIN---SDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYE-------KSPFVDDGSNEQKE-------RIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQ----------CSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            AEI +++   E +  N  DY+ H  LI  L+   K+   R++R+ M   +PL+ E+W+DW+ DE  I    SD++ +  +F RAI+DY   ++W EY Q+ +G +  +   E +R  FE A+  VG H+TKG  IW  Y  +E       + P     S EQ+E       RI+ ++ RQL++ L   + T  E+   +  +      +  ++  + Q++    P+E+ +            S+ P+  E       +  E + ++++I+  +ERA+ + CL  ++WI Y  YL +   + ++ +L A++RAVRN   ++ LW  Y+  +E +      ++  F           T ++ +WQ+YLD+ +R++D   + + +L  +R  F + +    Y+  D +          C+L++ W  IEA +  NM K+RELW  IM       +++WLE    ER +GD  H ++  + AV C +DYPE++C+ +L     E  L+ +    +K +T+  ++ E+R +
Sbjct:   58 AEIQRLE---EQLSINAFDYNCHVDLIKLLRQEGKLHRLRKARQKMSELFPLTEEIWLDWLKDEIRITEDESDREKVYELFERAIKDYVCPEIWLEYVQYSIGGMGAQGGIERVRSIFERALTAVGLHMTKGASIWEAYREFEIVILSTVQPPPGTVPSQEQQELLSAQLERIHTLFRRQLAVPLMDMEGTYAEY--SDWADDGVPETVTHQYRRALQQMEKGKPYEEALL----------VSEPPKLAEYQSYIDFEIKEGDPARVQII--FERALAENCLVPDLWIKYTTYLDRQL-KIKDLVLSAHERAVRNCPWTMGLWKSYLLALERHGADHQTVKDVFEKALNAGFIQATDYVEIWQSYLDYLRRRVDFSKEWSRELDELRAAFSRSL---EYLKQDVEERFSESGDLSCTLMQIWARIEALHCKNMQKARELWDSIMTKGNAKYANMWLEYYNLERSYGDAAHCRKALHRAVQCTSDYPEHVCDVLLNFERVEGSLEDWDAAVQKTETKLNRVCEQRAR 562          

HSP 2 Score: 118.242 bits (295), Expect = 7.791e-26
Identity = 84/270 (31.11%), Postives = 141/270 (52.22%), Query Frame = 1
Query: 1765 ERCEEKTIFVSNLKYSVN--ENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPP-------------IGMIPRTVGLKPMATQK------KIIHGASSDSQDGNIAEAKK-SNADFRKFLM 2496
            +R +E  +FVSNL +++   E  LR  F+ CG I ++R    +    RG+ ++QF+ +  V EALK++R+ +  RPM+VS C   NK+     F Y   + E +K+F+  LP + TK  LE++ K+ G ++ IR+VT +SG  KG+AYVE+ +E  AS+A++  DG  + +  + V +S PP +    KD  + S+ +    P             I ++PR++  +     K         H   +D +     + K  SN DF + L+
Sbjct:  683 QRKDENCVFVSNLTFNMEDPEGKLRTLFQGCGTIQQVRPVFTAKGTFRGYCYVQFEDRLAVPEALKMDRQEVDGRPMYVSPCVDKNKNPDFKVFKYKTSM-EKHKIFISGLPYSATKETLEDLCKEHGTIRAIRIVTNRSGKSKGLAYVEFEDEAQASQAVLKMDGTMLENFTLSVAISNPPGRRM--KDEAAPSRFLGAAMPRQLQGARGKGRTQISLLPRSLYRQSTPDAKAENGTISAPHATVTDGETSLDTQTKSLSNEDFARMLL 949          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. UniProt/SwissProt
Match: sp|Q17430|SART3_CAEEL (Nuclear RNA-binding protein sart-3 OS=Caenorhabditis elegans OX=6239 GN=sart-3 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.878e-39
Identity = 185/804 (23.01%), Postives = 343/804 (42.66%), Query Frame = 1
Query:  277 YYPLSPEMWIDWINDEKSINSDKDF--IRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEE------IRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQ-----KERIYKIYLRQLSLSLQSNDET----------LKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIEN---YIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDY---KSSGLK--AKKVK-----FSEELSTET----------------VTASVSIEQPIERCEE-KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDK--SRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSS--QSIDFKPP-------IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            + PL+P  W +WI D ++   +     +  +F +A+ D   V +W E   +      DK +       R     A+  +GT    G  IW  +L YE S ++ +  N        ++++ ++ R L       ++            K+  +  +  K + + +  K +LSK        FE+ I   ET             K+    ++  + + +     I   +ER +++L   +  WI+Y  +     +  +  + K Y RA+R+   S  L    +   E      +EI   +       +N       L++ Y    +R++      + D + + E+FD+   +      + +D      +   +  A    NM K R +W+ I+ S     +  W+E +  ER+FGD E+ ++  N A+N  +D    +    ++   EE  L       +K+++Q    + R  K+ +E P  P  +   D+   ++SG +   KKVK     F   L                       S ++++     E+ +TIFVSNL ++  E+++RQ  E    +A IR  + ++     RGFA++  ++    ++AL  +R  +  RPMF+S  +   +  F +S   +E +K+FV+N+    T   L+ +F +FG +  +R VT K G PKGIA+V++  E  A K +   D + + +R +EV LS PPVK+  K  G+ ++   S++   P       + ++PR +  K      ++    + D  +G       SN  FRK  M
Sbjct:   65 WAPLNPLNWKNWIEDFQNRKPEPSVAEVEEMFEKALFDENDVTIWVERAMYAYKVANDKNKKEDFKFCRDVCSKALENLGTRYDSGGHIWLIFLEYEMS-YLKNSMNAPDYQRLADQVFALFERALHCPTDQLEDVYVLAEQFCTEFKQHHKLEELKKTYNSTMRQKEQLSK--------FEELIQQEET-------------KKQGLKQFFDHEKKSGIPSRIKMAHERLVSELDDDEEAWIAYGAWADIELKLPQVAV-KVYSRALRHCPYSFVLHQQALLAFERDRRPNEEIDALWERARSNVINSAEEGRSLYRTYAFLLRRRI--HLTGSSDYSPMAEVFDEGAALLREWFSMAWDTTADYRQMQAYFYASLMKNMDKCRNIWNDILASGFGRFAGKWIEAVRLERQFGDKENARKYLNKALNSVSDNINEIYMYYVQFEREEGTLAELDLVLEKVNSQVAHRAIRPQKKVSEKPA-PAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPLPPSNAKSSSAVSSSNASSTPAPGSFAVQKAAPGTEDARTIFVSNLDFTTTEDEIRQAIEG---VASIRFARKANSDLVHRGFAYVVMENDQKAQQALLKDRVPVKGRPMFISANDPEKRVGFKFST-TLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVASGDKLMLRERELEVALSNPPVKKD-KSHGKPAAIGASLEEDGPRKGHAAKLQLVPRAITNKTPQITARL---DAMDVSEGTSTSQPLSNDQFRKMFM 834          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. TrEMBL
Match: V4AET9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_188648 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 6.731e-120
Identity = 284/904 (31.42%), Postives = 450/904 (49.78%), Query Frame = 1
Query:  148 IDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSD----KDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEI---RQFFEVAIAQVGTHLTKGYLIWGTYLIYEK--------------SPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYL----PFEDKIANIETEYAANATSDSPESKEMHWIEYLKY--FE---SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDY-----DPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSN-SSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEE--------------------SDLKTYLQFTKKIDTQRKK------------ISERRMKEEAENPTKPQKRKT------------------------------PDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC----NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESP--------------KKDGESSSQSIDFKPPIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKK-----SNADFRKFLM 2496
            I   RE + +NP  YD+H ++I  LK S ++ + RE+RE M  Y+PL+ E+W+DWI DE  +  D    +D I  +F RA++DY+SV +W EY QF +G + D   I   R+ FE AI  VG H+T+G ++W  Y   E               +P  ++  N Q +R+  ++ RQL++ L   ++T  E+            ++    E S QK + +L    PFED +   E+ Y               W EY  Y  FE    + S+I+ +  +ER+IT+ CL+   W+ Y KYL     + +  IL  Y+RAVRN   S  LW  Y+  +E +N S ++++              + +  +W  Y+D+ +RQ++        L + RE  +K   +EN  +Y     D    + +YW  IE K   NM ++RE+W+ IM  LG  N +++WLE  + ER +GD +H ++L   A+N  TD+PE + +  +    EE                    +D K      +++ TQ+KK              +   KE    P KP K+                                P YK      KK K  EE +TE V    S +       ++T+FVSNL + +NE+ +++ F KCG+I+EIR+ K+ H KS+G+A+++F  +  V +AL+L+R+ +  RPM+VSRC        K  F +S  + E NKLF+KNLP   TK AL  IF Q G LK++R++T++SG PKG+AYVEY +E DA +A++ TDG++IGD  IEV +S PP ++ P              KK+ E+  ++   +  I ++PR V   P+  +      +++ S++G   ++       SN+DFR  L+
Sbjct:   25 IAQLREKINENPYLYDNHTEIIKLLKSSGELEKLREARENMSKYFPLTAELWLDWIKDEIRMIEDDFKDRDNIYQLFSRAVQDYQSVPLWLEYVQFAIGGMKDDGGISKMRKIFEEAITVVGLHVTQGSMVWDAYRETENAVLAGLLPAPGSIPTPEQEESFNVQNQRVSSLFKRQLAVPLLDMEQTYSEY------KDWNGGDLDIYTEESYQKSLAHLEKLKPFEDSLVTAESPY---------------WEEYQTYINFELKGDDPSRIQCI--FERSITENCLNPEAWLKYTKYLDSKL-KIKSVILPVYERAVRNCPWSCLLWQRYLLALERHNESGNKLKDVTAKALTSGFTLASEYSTIWSTYIDYLRRQINWSEDHTEQLELFRETIEK--ALENLTEYFGNDGDENGMMRQYWAVIEGKMCKNMTRAREIWNEIM-GLGYGNQANMWLEYYKLERAYGDNKHCRKLLQKALNSVTDWPESITQAYINFEREEGTLEDYDVAVGRCEAQLDRLTDRKAKAAEKEEVATQQKKQVRNEKKAQKKFEKKTPKKEVMTPPEKPAKKSPNNKRKLEEPNSTTSSISKQDKADDFRVPPPPGYKGEPPPNKKQKTEEETTTEGVKHDPSKD-------DRTVFVSNLNFDINEDGIKEIFCKCGEISEIRLVKNFHGKSKGYAYVEFIDELPVTKALELDRQPVHNRPMYVSRCEDRGGGKKKAEFRFSTDL-EKNKLFIKNLPFTCTKDALTTIFSQHGKLKDVRIITYRSGQPKGLAYVEYESEEDAKQAVLKTDGLQIGDHHIEVAISNPPARKQPVIKRDEFIPSLGGGKKESETRGKA---RTQIALLPRAVQKVPVPKKPTRPSASATASKNGGSGDSSAPPTAMSNSDFRNMLL 890          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. TrEMBL
Match: A0A2A3EKK0 (Squamous cell carcinoma antigen recognized by T-cells OS=Apis cerana cerana OX=94128 GN=APICC_08004 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.252e-119
Identity = 281/849 (33.10%), Postives = 436/849 (51.35%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINS---DKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYL-TDKE---EIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEK------SPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEF----LXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKD-NVDLTIIRELFDKL---ITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTY----LQFTKKIDT-------------------QRKKISERRMKEEAE------NPTKPQKRKT---PDYKSSGLKAKKVKFSEELSTETV---------TASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC--NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKP------PVKESP---KKDGESSSQSIDFKPP---IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            NP DY SH  LIN L+   ++   R +RE M   YPLSP++W+ W+ DE  + +    K  +  +  RA++DY +V+VW EY QF +G + T+K+    +R  FE A+  VG H  KG +IW  +  +E        P       EQ ERI  ++ RQL+  L   ++T +E+         E    +  I   +  +  KL   LP+E+KI + +TE   N   DS       +  YL Y + N     I  LYERAITDL L  +IW+ YLKYL ++  + E  + + YQRA+RN     ++W  ++R  E +N SV E++T          +    +  LW  YL++ +R++D+ S D    L I+R  F++    +     ++ DP C +++YW   EA +A NM K+R LW+ I+    +  +S WLE I  ER +GD +HL++L   A+    D+PE +    +    +E  L+      ++  +K+D                    Q KK  +R+  E  +      +PTK  K +    P  + S L  +K   SEE   +T             + I+   E  ++ T+F+SNL Y+ +E ++R   +  G I   ++ +D   +S+G+ ++Q  +   +++AL+L+R  +  RPMFVS+C  N +    F YS  + E NKLFVK LP + TK  LE IFK  GALKE+R+VT+++G  KG+AYVE+ +EN A+KAL+ TDGM+I D+VI V +S+P      P  E P   K  G ++     F  P   + M+PRTV  K  AT     +G+++ S  GN    K +N DFR  L+
Sbjct:   78 NPYDYASHVALINKLQKMGELERLRAAREDMSSKYPLSPDLWLSWMRDEIKLATTIEQKAEVVKLCERAVKDYLAVEVWLEYLQFSIGNMGTEKDAAKNVRHLFERALTDVGLHTIKGAIIWEAFREFEAVLYALIDPLNQAERKEQLERIGNLFKRQLACPLLDMEKTYEEYEAWRHGDGTEAVIDDKIIIGGYNRALSKLNLRLPYEEKIVSAQTE---NELLDS-------YKIYLSYEQRNGDPGRITVLYERAITDLSLEMSIWLDYLKYLEENI-KIESVLDQVYQRALRNVPWCAKIWQKWIRSYEKWNKSVLEVQTLLENALAAGFSTAEDYRNLWITYLEYLRRKIDRYSTDEGKQLEILRNTFNRACEHLAKSFGLEGDPNCIILQYWARTEAIHANNMEKTRSLWADILSQGHSGTASYWLEYISLERCYGDTKHLRKLFQKALTMVKDWPESIANSWIDFERDEGTLEQMEICEIRTKEKLDKVAEERQKMQQMSNHELSPLQNKKTLKRKQDETGKWKNLGSSPTKITKVEMQIKPKIRESRLNFEKNTDSEEQKLKTAPPPGFKMPENEQMEIDNMHEMDDKSTVFISNLDYTASEEEVRNALQPAGPITMFKMIRDYKGRSKGYCYVQLSNMEAIDKALQLDRTPIRGRPMFVSKCDPNRTRGSGFKYSCSL-EKNKLFVKGLPVSTTKEELEEIFKVHGALKEVRIVTYRNGHSKGLAYVEFKDENSAAKALLATDGMKIVDKVISVAISQPPERKKVPATEEPLLVKSLGGTTVSRTTFGMPKTLLSMVPRTV--KTAAT-----NGSANVS--GNGVAPKMNNQDFRNMLL 905          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. TrEMBL
Match: A0A087ZPR6 (Uncharacterized protein OS=Apis mellifera OX=7460 GN=Rnp4F PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 6.095e-119
Identity = 278/849 (32.74%), Postives = 432/849 (50.88%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINS---DKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYL-TDKE---EIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEK------SPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEF----LXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKD-NVDLTIIRELFDKL---ITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTY----LQFTKKIDT-------------------QRKKISERRMKEEAE------NPTKPQKRKT---PDYKSSGLKAKKVKFSEELSTETV---------TASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC--NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKP------PVKESP---KKDGESSSQSIDFKPP---IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            NP DY SH  LIN L+   ++   R +RE M   YPLSP++W+ W+ DE  + +    K  +  +  RA++DY +V+VW EY QF +G + T+K+    +R  FE A+  VG H  KG +IW  +  +E        P       EQ ERI  ++ RQL+  L   ++T +E+         E    +  I   +  +  KL   LP+E+KI + +TE   N   DS       +  YL Y + N     I  LYERAITDL L  +IW+ YLKYL ++  + E  + + YQRA+RN     ++W  ++R  E +N SV E++T          +    +  LW  YL++ +R++D+ S D    L I+R  F++    +     ++ DP C +++YW   EA +A NM K+R LW+ I+    +  +S WLE I  ER +GD +HL++L   A+    D+PE +    +    +E  L+      ++  +K+D                    Q KK  +R+  E  +      +PTK  K +    P  + S L  +K   SEE   +T             + I+   E  ++ T+F+SNL Y+ +E ++R   +  G I   ++ +D   +S+G+ ++Q  +   +++AL+L+R  +  RPMFVS+C  N +    F YS  + E NKLFVK LP + TK  LE IFK  GALKE+R+VT+++G  KG+AY+E+ +EN A+KAL+ TDGM+I D++I V +S+P      P  E P   K  G ++     F  P   + M+PRTV  K  AT         S +  GN    K +N DFR  L+
Sbjct:   80 NPYDYASHVALINKLQKMGELERLRAAREDMSSKYPLSPDLWLSWMRDEIKLATTIEQKAEVVKLCERAVKDYLAVEVWLEYLQFSIGNMGTEKDAAKNVRHLFERALTDVGLHTIKGAIIWEAFREFEAVLYALIDPLNQAERKEQLERIGNLFKRQLACPLLDMEKTYEEYEAWRHGDGTEAVIDDKIIIGGYNRALSKLNLRLPYEEKIVSAQTE---NELLDS-------YKIYLSYEQRNGDPGRITVLYERAITDLSLEMSIWLDYLKYLEENI-KIESVLDQVYQRALRNVPWCAKIWQKWIRSYEKWNKSVLEVQTLLENALAAGFSTAEDYRNLWITYLEYLRRKIDRYSTDEGKQLEILRNTFNRACEHLAKSFGLEGDPNCIILQYWARTEAIHANNMEKTRSLWADILSQGHSGTASYWLEYISLERCYGDTKHLRKLFQKALTMVKDWPESIANSWIDFERDEGTLEQMEICEIRTKEKLDKVAEERQKMQQMSNHELSPLQNKKTLKRKQDETGKWKNLGSSPTKITKVEMQIKPKIRESRLNFEKNADSEEQKLKTAPPPGFKMPENEQMEIDNMNEMDDKSTVFISNLDYTASEEEVRNALQPAGPITMFKMIRDYKGRSKGYCYVQLSNIEAIDKALQLDRTPIRGRPMFVSKCDPNRTRGSGFKYSCSL-EKNKLFVKGLPVSTTKEDLEEIFKVHGALKEVRIVTYRNGHSKGLAYIEFKDENSAAKALLATDGMKIADKIISVAISQPPERKKVPATEEPLLVKSLGGTTVSRTTFGMPKTLLSMVPRTV--KTAATN-------GSANVPGNGVAPKMNNQDFRNMLL 907          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. TrEMBL
Match: C3Y679 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_283159 PE=4 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 6.481e-119
Identity = 271/909 (29.81%), Postives = 435/909 (47.85%), Query Frame = 1
Query:  169 VLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINS---DKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK-EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFV----DDGS---NEQKE-------RIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLD-KQSKDNVDLTIIRELFDKLI-----TIENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKE---------------EAENPTKP-------------QKRKTPDYKSSGLKA------KKVKFSEELS-----------------------------TETVTASVSIEQPIERCEEKTIFVSNLKYSVN--ENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNK----HSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKE-SPKKDG--------------------------------ESSSQSIDFKPPIGM------IPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFL 2493
            V  NP DY SH +LI AL+   ++ + R++RE M  ++PL+ E+W++W+ DE  ++S   ++  I  +F RA++DY   DVW EY Q+ +G + D  E +R   E A+   G H++KG ++W  Y  +E +       D GS    +Q+E       RI  I+ RQLS+ L   D T  E+     +    +  +   ++ + +KL  Y PFE+ +           ++ +P  +E  ++ Y+ Y  +      I  ++ERA+ +  L   +W  Y  YL     +    +L A++RA RN   +  LW GY+  +E +    ++I+   +          + ++ LWQ Y D+ +R++D  +  ++  +  +R  + + +     +++ Y     DPQC+L + W  +EAKY  NM K+RELW  IM       + +WLE  E ER +GD E  +++   AV+  +D+PE +CE ++    EE  L+TY     + + Q K++ ERR K+               EA    +              QKRK       G KA      K+VK    LS                               + T  V +  P    E +++FVSNL YS++  ++ +R+ F +CG++A++R+   S  K RGF +++F  +S   +AL  + + +  RP+FVS C    K    H F Y+  + E NKLFV NLP  VTK ALENIFKQ G L+ +R+VT++SG PKG+AYVEY +E  AS+A++ TDG+ IGDR I+V +S PP +   P  +G                                 ++S +   KPP G        P T G +P  TQ+ +  GA            + +NADF K  
Sbjct:   44 VSGNPYDYSSHVELIRALRREGELEDVRQARERMSKFFPLTEELWLEWLTDEMKLDSGRQNRTGINQLFERAVKDYLCADVWLEYIQYCIGGMEDGLEPVRAVCEKALTAGGLHVSKGTMLWDVYREFENAVLAGMQPDPGSICTGDQEEKIQAQISRINSIFRRQLSVPLLGMDGTYLEY--EEFQTGPVDATVKQVYQKACEKLDKYKPFEESLT----------SATAPRLQE--YLAYIDYELAEDEPTRIQCIFERALQENPLVVELWTKYTHYLDTKL-RIPHIVLSAHERATRNCPWAAILWQGYLLALERHRQPKEKIKEVMDTALPAGFPQASDYVSLWQTYCDYHRRRVDWTKDAESSGIDALRSTYQQAVDYCRDSLQQYFGETGDPQCTLQRTWARLEAKYNKNMGKARELWDGIMAEGHGREAQMWLEYAELERSYGDVERSRKVLQKAVSKASDWPESVCEALINFEREEGTLETYDNTVARCEAQLKRVQERRAKQAEKELVAAQAEEQKAEARKKNRAEKKSAKKQEMKQGQKRKVECLDEEGFKAPEEPPVKRVKGQCHLSQLLKGNSDEPEEVPFSAAWQSIHEATIPPVPSSTGDVPVHDPDR--ERRSVFVSNLSYSLHNPQDKMREVFSECGEVADVRLAFTSKKKFRGFCYVEFKEESAAVKALGFDHKEVEGRPLFVSPCIDKRKGDKFHGFQYATKL-EKNKLFVSNLPYTVTKEALENIFKQHGPLRGVRMVTYRSGKPKGLAYVEYEDEQTASQAVLKTDGLMIGDRKIQVAVSNPPTRRGGPHGEGVDDRLSRSDNKESQYRGKGRTQLSLLPRSLHKPTTSSASTSKPPAGSNGTTADQPATSG-QPTTTQEPVKQGAK-----------RLTNADFAKMF 922          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. TrEMBL
Match: A0A310SGM4 (Squamous cell carcinoma antigen recognized by T-cells 3 OS=Eufriesea mexicana OX=516756 GN=WN48_00346 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.894e-118
Identity = 281/854 (32.90%), Postives = 438/854 (51.29%), Query Frame = 1
Query:  166 NVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINS---DKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYL-TDKE---EIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPF-VDDGSNE-----QKERIYKIYLRQLSLSLQSNDETLKEFLX----XXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQS-KDNVDLTIIRELFDKL---ITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTY----LQFTKKID------------------TQRKKISERRMKEEAE------NPTKPQKRKT---PDYKSSGLK-AKKVKFSEELSTETVTASVSIEQP------IERCEE----KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC--NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKES--------PKKD-GESSSQSIDFKPP---IGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            ++ +NP DY SH  LIN L+   ++   R +RE M+  YPLSPE+W+ W+ DE  + +    K  +  +  RA++DY SV+VW EY QF +G + T+K+    +RQ FE A+  VG H  KG +IW  +  +E   + + D SNE     Q ERI  ++ RQL+  L   ++T +E+                 +   ++ +  KL   LP+E+KI       +A A  +  +S +M    YL Y   +     I  LYERAITDL L  +IW+ YLKYL ++  + E  I + YQRA RN    +++W  ++R  E +  SV E++T          +    +  LW  YL++ +R++D+ S  +   L ++R  F++    +     ++ DP C +++YW   EA +A NM K+R LW+ I+    ++ +S WLE I  ER +GD +HL++L   A+    D+PE +    +    +E  L+      ++  +K+D                  +  KK  +R+  E  +      +PTK  K +T   P  + S L   KK+    E     +T     + P      IE   E     T+F+SNL Y+  E ++R   E  G I   ++ +D   +S+G+ ++Q +S   VE+AL+L+R  +  RPMFVSRC  N +    F YS   +E NKLF+K LP + TK  LE IF  +G LKE+R+VT+++G  KG+AYVE+ +EN A+KAL+ TDGM+IG++VI V +S+PP ++         P K  G ++     F  P   + M+PRTV         KI     S +  GN    K SN DFR  L+
Sbjct:   71 SLAENPYDYASHVALINKLQKMGELERLRIARENMNTKYPLSPELWLSWMRDEIKLATTPEQKAEVIKLCDRAVKDYLSVEVWLEYLQFSIGNMGTEKDAAKNVRQLFEQALTAVGLHTIKGAIIWEAFREFEAVLYALIDPSNEAERKEQLERIGNLFKRQLACPLLDMEKTYEEYEAWHNGDGAAATIDNKIVTGGYDRALSKLNLRLPYEEKIV------SAQAEKELLDSYKM----YLSYELQSGDPGRITVLYERAITDLSLEMSIWLDYLKYLDENI-KIESIIDQVYQRASRNVPWCVKIWQRWIRSYEKWGKSVLEVQTLLENALSAGFSTADDYRNLWITYLEYLRRKIDRYSDSEEKQLDVLRNAFNRACEHLAKSFGLEGDPNCIILQYWARTEAIHANNMEKARSLWADILSQGHSAIASYWLEYISLERCYGDTKHLRKLFQKALTSVRDWPESIANSWIDFERDEGTLEQMEICEIRTKEKLDKVAEERQKAPQMSNSELLSLNKKAHKRKQDESGKWKNLGGSPTKITKVETQIKPKIRESRLNLEKKINADVEEQRTKITPPPGFKTPENEKMEIENMHEVDDKTTVFISNLDYTATEEEVRNALEPAGPITMFKMIRDYKGRSKGYCYVQLNSVEAVEKALQLDRTTIKGRPMFVSRCDPNRTKGSGFKYS-NTLEKNKLFLKGLPLSTTKDELEEIFNVYGILKEVRIVTYRNGHSKGLAYVEFEDENSAAKALLATDGMKIGEKVISVAISQPPERKKIPATEELFPIKSLGGTTVSRSTFGMPKTLLSMVPRTV---------KIAATNGSANVTGNGVAPKMSNQDFRNMLL 903          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Cavefish
Match: sart3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:NCBI gene;Acc:558581])

HSP 1 Score: 225.328 bits (573), Expect = 2.131e-61
Identity = 141/528 (26.70%), Postives = 267/528 (50.57%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSIN----SDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYE-------KSPFVDDGSNEQKE-------RIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMH-WIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQ----------CSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMK 1620
            AEI +++   E +  N  DY+ H  LI  L+   K+   R++R+ M   +PL+ E+W+DW+ DE  +     S+++ I  +F +A++DY   D+W E+ Q+ +G +  +     +R  FE A+  VG H+TKG  +W  Y  +E       + P     S EQ+E       RI+ ++ RQL++ L   + T  E+   +   +     +   ++ + Q L    P+E+ +            S+ P+  E   +I+Y +  E + ++++I+  +ERA+ + CL  ++W  Y  YL +   + ++ +L  ++R VRN   ++ LW  Y+  +E +      +   F           T ++ +WQ++LD+ +R++D   + + +L  +R  F + +   +Y+  D +          C++++ W  IEA +  NM K+RELW  IM       +++WLE    ER +GD  H ++  + AV C TDYPE++CE +L     E  L+ +    +K +++  +++E+R+K
Sbjct:   78 AEIQRLE---EQLSINAFDYNCHVDLIKLLRQEGKLHRLRKARQKMSELFPLTEEIWLDWLKDEIRLTEGEESEREKIYELFEKAVKDYICPDIWLEFAQYSIGGMGAEGGISRVRSIFERALTAVGLHMTKGAALWEAYREFEIAILSTLQPPPGSVLSGEQQEQLNAQLERIHTLFRRQLAIPLLDMEGTYAEY--SDWAEEGVPEMVTQHYKRAAQHLEKSRPYEEALL----------VSEPPKLAEYQGYIDY-EMKEGDPARVQII--FERALAENCLVPDLWAKYTTYLDRQL-KIKDLVLSCHERGVRNCPWTMGLWKSYLLALERHGAEHHIVSDVFEKALNAGFIQATDYVEIWQSHLDYLRRRVDFSKEGSRELEELRSAFSRCL---DYLKQDVEERFSESGDLSCTIMQVWARIEALHCKNMQKARELWDSIMTKGNAKYANMWLEYYNLERSYGDAAHCRKALHRAVQCTTDYPEHVCEVLLTFERVEGSLEDWDVAVQKTESRLNRVNEQRVK 583          

HSP 2 Score: 121.709 bits (304), Expect = 7.854e-28
Identity = 89/306 (29.08%), Postives = 159/306 (51.96%), Query Frame = 1
Query: 1651 KRKTPDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQK--FEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSI--------------DFKPPIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKK----SNADFRKFLM 2496
            +R  P  K+     +K   +++   E+    +S   P +R +  ++FVSNL +++ E + + K  F  CG + E+R    +    RG+ ++QF+ +   +EALKL+R  +  RPM+VS C   +K+     F Y+  + E +K+F+  LP   TK  LE + K+ G +K +RLVT ++G  KG+AYVE+ NE  AS+A++  D  +I +  + V +S PP +   K +G   S  +                +  + ++PR++  + +  + K  +G ++  QDG I + +     SN DF + L+
Sbjct:  670 RRAPPPRKAEPPAPRK---NQQAIPESAVRKISDIPPEQRKDSSSVFVSNLSFTMEEPEAKMKAVFNACGTVVEVRPVYTAKGAFRGYCYVQFEDELAAQEALKLDRVEVDARPMYVSPCVDKSKNPDSKIFKYNTSM-EKHKIFISGLPYTYTKEQLEELCKEHGGIKAVRLVTNRAGKSKGLAYVEFENETQASQAVLKMDRTKIENFTLSVAISNPPAR---KTEGSLGSGRVLGSMMPRQLQGARGKGRTQVSLLPRSLHRQSVP-EAKTENGTTAKQQDG-ITDGQGTKSLSNEDFARMLL 966          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Cavefish
Match: rbm39a (RNA-binding protein 39 [Source:NCBI gene;Acc:103042624])

HSP 1 Score: 67.781 bits (164), Expect = 3.051e-11
Identity = 52/187 (27.81%), Postives = 94/187 (50.27%), Query Frame = 1
Query: 1750 IEQPI-----ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC----NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            I QPI     E  + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+I+F   ++V  A+ L  + LL  P+ V       N +   + +   G     +L+V +L  N+T+  L  IF+ FG +  I+L+   ++G  KG  ++ +++   A KAL   +G E+  R ++V 
Sbjct:  140 IRQPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVDSTSVPLAIGLSGQRLLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIDSIQLMMDTETGRSKGYGFITFADAECAKKALEQLNGFELAGRPMKVG 326          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Cavefish
Match: rbm39a (RNA-binding protein 39 [Source:NCBI gene;Acc:103042624])

HSP 1 Score: 67.3958 bits (163), Expect = 3.171e-11
Identity = 51/187 (27.27%), Postives = 94/187 (50.27%), Query Frame = 1
Query: 1750 IEQPI-----ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYS----VGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            I QPI     E  + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+I+F   ++V  A+ L  + LL  P+ V    +    + + +     G     +L+V +L  N+T+  L  IF+ FG +  I+L+   ++G  KG  ++ +++   A KAL   +G E+  R ++V 
Sbjct:  103 IRQPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVDSTSVPLAIGLSGQRLLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIDSIQLMMDTETGRSKGYGFITFADAECAKKALEQLNGFELAGRPMKVG 289          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Cavefish
Match: rbm39a (RNA-binding protein 39 [Source:NCBI gene;Acc:103042624])

HSP 1 Score: 67.3958 bits (163), Expect = 3.225e-11
Identity = 52/187 (27.81%), Postives = 94/187 (50.27%), Query Frame = 1
Query: 1750 IEQPI-----ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC----NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            I QPI     E  + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+I+F   ++V  A+ L  + LL  P+ V       N +   + +   G     +L+V +L  N+T+  L  IF+ FG +  I+L+   ++G  KG  ++ +++   A KAL   +G E+  R ++V 
Sbjct:  125 IRQPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVDSTSVPLAIGLSGQRLLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIDSIQLMMDTETGRSKGYGFITFADAECAKKALEQLNGFELAGRPMKVG 311          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Cavefish
Match: rbm39b (RNA-binding protein 39-like [Source:NCBI gene;Acc:103037644])

HSP 1 Score: 67.3958 bits (163), Expect = 3.962e-11
Identity = 51/188 (27.13%), Postives = 99/188 (52.66%), Query Frame = 1
Query: 1750 IEQPI-----ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSV-----GVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            + QPI     E  + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+++F   S+V  A+ L  + LL  P+ V + + + K+  + ++     G     +L+V +L  N+T+  L  IF+ FG ++ I+L+   ++G  KG  ++ +++   A KAL   +G E+  R ++V 
Sbjct:  178 VRQPIDNLSAEERDSRTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYVEFVEASSVPLAIGLTGQRLLGVPIIV-QASQAEKNRAAAALQNLQKGGAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVG 364          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 65.4698 bits (158), Expect = 2.905e-11
Identity = 52/186 (27.96%), Postives = 96/186 (51.61%), Query Frame = 1
Query: 1741 SVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVE-----ANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            S S   P ER + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+I+F    +V  A+ L  + LL  P+ V    +    + + +   ++       +L+V +L  N+T+  L  IF+ FG +  I+L+   ++G  KG  ++ +S+ + A KAL   +G E+  R ++VN
Sbjct:  162 STSTLTPEER-DSRTVFCMQLAARIRAKDLEEFFSAVGKVRDVRLISDRNSRRSKGIAYIEFVDLDSVPLAIGLTGQRLLGVPIIVQASQAEKNRAAAAAAANLQKLASGPMRLYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKVN 346          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 60.8474 bits (146), Expect = 8.090e-10
Identity = 50/188 (26.60%), Postives = 89/188 (47.34%), Query Frame = 1
Query: 1768 RCEEKT-IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSN------KHSFSY----SVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            R +E T +++ N    ++E+ LR+ F K GK   + +  D   KSRGF F+ F    D+Q  V    ++  + L  R +FV R           K  F       +   +   L+VKNL  N+    L   F  +G +   ++++ + G  KG  +V +S+  +A+KA+   +G  +G + + V L++
Sbjct:  189 RAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAV---NEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMS-EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQ 372          

HSP 2 Score: 55.0694 bits (131), Expect = 4.701e-8
Identity = 38/171 (22.22%), Postives = 76/171 (44.44%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQST----VXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            +F+ NL  S++   +   F   G I   ++  D  + SRG+ F+ F++Q      +E+   +     L R  FV R  S  +          E   +++KN   ++ +  L   F +FG    + +++ + G  +G  +V +    DA +A+   +G E+  R + V  ++
Sbjct:  101 VFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCD-ENGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQ 270          

HSP 3 Score: 54.299 bits (129), Expect = 8.434e-8
Identity = 43/166 (25.90%), Postives = 80/166 (48.19%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDS-HDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRV 2265
            +++V +L   V E  L +KF   G +  IR+ +D    +S G+A++ F    D++  ++       +    R M+  R  S  K      VG V     F+KNL K++   A+ + F  FG +   ++V  ++G  +G  +V +  +  A +A+   +GM + DR+
Sbjct:   12 SLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKS----GVGNV-----FIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETQEAADRAIEKMNGMLLNDRL 167          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 8.758e-10
Identity = 42/154 (27.27%), Postives = 77/154 (50.00%), Query Frame = 1
Query: 1780 KTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDK-SRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGV-VEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFK-SGLPKGIAYVEYSNENDASKALV 2232
            + +FV  L +   E  LRQ FE+ G + +  + KD+  K SRGF F+ F S S V+ A+      +  R +   R  S      S   G  +   K+FV  +  +  +  L + F+++G ++ + ++T + SG  +G A+V +++ +   K +V
Sbjct:   11 RKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSRED---SMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVV 161          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 60.4622 bits (145), Expect = 1.138e-9
Identity = 52/204 (25.49%), Postives = 100/204 (49.02%), Query Frame = 1
Query: 1759 PIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFV-------SRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSID 2343
            P ER + +T+F   L   +   DL + F   GK+ ++R+  D +  +S+G A+I+F    +V  A+ L  + LL  P+ V       +R  ++   + +         +L+V +L  N+T+  L+ IF+ FG ++  +L+    +G  +G  +V +++   A KAL   +G E+  R ++V         + + DG  +S  +D
Sbjct:  153 PEER-DARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVEVDSVSLAIGLTGQRLLGVPIIVQASQAEKNRAAAAAAAAATMQKSTAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVG------HVTERSDGSGASSFLD 349          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 56.6102 bits (135), Expect = 5.656e-9
Identity = 41/151 (27.15%), Postives = 71/151 (47.02%), Query Frame = 1
Query: 1759 PIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKD-SHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFK-SGLPKGIAYVEYSN 2205
            P E  + + +F+  L +   E  LR+ +E+ G I +  + KD S  +SRGF FI +     V  A++     +  R +   R    +       V V    KLFV  +  N  +  L + F +FG ++ + +VT K +G  +G A+V + +
Sbjct:    7 PKEPEQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPGIQVTV---KKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDD 154          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 72.7886 bits (177), Expect = 5.356e-14
Identity = 55/183 (30.05%), Postives = 97/183 (53.01%), Query Frame = 1
Query: 1765 ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIR-IQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXX-XXRP----MFVSRCNSSNKHSFSYSVGVVE-ANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTF-KSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKP 2289
            E  E  TIFV  L +S+++  L+++FE  G +   R I +   D+SRG+ ++ F+++S  E+A++  +      RP    M  S+   +N  +  +     E ++ LF+ NL  N  + A+  +F + G +  +R+ T  ++  PKG  YV++SN  DA KAL    G  I +R + ++ S P
Sbjct:  163 ETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSP 345          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 53.5286 bits (127), Expect = 1.001e-7
Identity = 44/177 (24.86%), Postives = 87/177 (49.15%), Query Frame = 1
Query: 1765 ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKD-SHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFK-SGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKP 2289
            E C+   +F+  L +   E++LR+ F K G + +++I KD +  +SRGF F+ F+  S+V + +   + +L  + +   R    ++          +  K+FV  +  +V     E  F Q+G + + +L+  K +G  +G  +V Y +  DA   +     ++  DR IE+  ++P
Sbjct:  157 ESCK---MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSV-DEVVKTQHILDGKVIDPKRAIPRDEQD--------KTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSA-DAVDRVCQNKFIDFKDRKIEIKRAEP 320          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 52.7582 bits (125), Expect = 1.816e-7
Identity = 39/161 (24.22%), Postives = 72/161 (44.72%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFD-SQSTVXXXXXXXXXXXXXRPMFVSRCNSSN-------KHSFSY---SVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALV 2232
             ++V N+     +   ++ F K G I    ++KD+  K +GF F+ ++  +  V+    L    L    ++V R    N       K   +Y    +   +   LFVKNL  +V    LE  F  +G +   +++  ++G  KG  +V +S   +A+KA+ 
Sbjct:  220 NLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAIT 380          

HSP 2 Score: 51.2174 bits (121), Expect = 5.358e-7
Identity = 42/158 (26.58%), Postives = 67/158 (42.41%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXX-XXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEI 2253
             IF+ NL   ++   L   F   G I   +I  D + KS+GF F+ F+ +   +EA   L   LL  + ++V+   S  +              L+VKN+    T    + +F +FG +    L     G  KG  +V Y    DA KA+   +  E+
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSEL 284          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Yeast
Match: HRB1 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; HRB1 has a paralog, GBP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004949])

HSP 1 Score: 51.9878 bits (123), Expect = 2.626e-7
Identity = 51/187 (27.27%), Postives = 89/187 (47.59%), Query Frame = 1
Query: 1747 SIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKI--AEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXX-XXRPMFVSRCN---SSN-KHSFSYSVGVVEANK----LFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEV 2274
            + E+ + R    +IFV NL Y     DL + F + GK+  A+I   +  H   RG   ++F +   V+ A++       ++R +FV + N   S+N K   +   G +  N+    + VKNLP +V   AL++IFK+ G +    +     G+  G   V + +  D  +A+   +G  I   V++V
Sbjct:  150 TYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHH---RGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDV 333          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 51.6026 bits (122), Expect = 3.074e-7
Identity = 44/172 (25.58%), Postives = 84/172 (48.84%), Query Frame = 1
Query: 1777 EKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXX-XXRPMFVSRCNSSNKHSFSYSVGVV-----EANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEV 2274
            E +IFV NL +     DL++ F   G++ E  I   S    RG   ++F    +V++A+      L ++R + V + N   + +  +S            ++F+ NLP ++   +L+++FK+ G +    +    +G  +G   V Y  E++  +A+   +GME+  RV+EV
Sbjct:  121 ENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIIT-SKGHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEV 291          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Nematostella
Match: EDO37342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY3])

HSP 1 Score: 292.738 bits (748), Expect = 1.364e-86
Identity = 226/791 (28.57%), Postives = 395/791 (49.94%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDE---KSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYL-TDK--EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDY------DPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERR----------MKEEAENPTKPQKRKTPDYKSSGLKA------------KKVKFSEELSTE----------TVTASVSIE------------------QPIERCEEKT-----IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC--NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVK 2298
            AEI ++++  E    NP +Y SH +LIN L  S  +   R++RE M   +PL+ E+W+ WI DE     I   ++ ++++F R ++DY+SV +W +YCQFM+  + TD+  E +R  FE A+   G H+T+   I  +         +      Q+ER+  IY RQL++ L     T+++F +W +E++E    +   ++ ++ KL   LP+ED++         +  S+S E+    +  YLKY       + I+ LYERA+ D CL  ++W+ Y  YL     +    +L A++RAVRN      LW  Y+  +E  N    +I+  F+       +    F+ LW+ Y +  +R++ + ++++ +   ++E  D L +   Y+ +      D    L + W  +EA    N+ +++ LW +++   G      W+E     R   D +  +++ + AV   +D PE     +L +  EE  L+ +     +  T+ K ++ERR          MKE  E   K +  +T    +   +             +KV+ S  LS            TV +   +E                  +P    EE++     +F+SNL +S+ E+ LR KF K G++ ++RI K+   +S+G+A+++F+++STV+ AL ++RE +  RPMF+S C   + N  +F +    ++ + LFV NLP +  +  +E +F + G +K++RLVT ++G PKG  YVEY  E+ AS A++  D  E+  R I V LS PP +
Sbjct:   11 AEIHQLEVQLET---NPYNYQSHIQLINLLSSSGDLERLRQARENMSKSFPLTEELWLSWIEDELPLACIPDHRETVKSLFDRGVQDYQSVKLWIQYCQFMMDNMETDQGLENVRATFEKALTSAGLHVTEVCTIGLSTF------RLTVCLAAQRERVESIYRRQLAVPLLGMQMTMRDFEDWLEEDEEVPVPVKLAYQKAETKLEEILPYEDEL--------NSNKSNSLEA----YKNYLKYEVQKGEPVRIVCLYERALKDNCLYSDLWMEYTTYLDSKL-KISSVVLPAHERAVRNCPWVASLWQNYMLALERSNQPSSKIKEIFDKALTCGFSSGVEFLQLWRCYCNHMRRRVKEWTEESHE---VKEWRDSLKSAIEYMQHYFGNEGDSTNLLDRCWARLEAYKLSNLSEAQRLWEIVISRHGR-ELEYWVEYANLVRTCKDVQSCRKVLHRAVQSVSDNPEGATRALLSLEEEEGSLEDWDSSYARCATRLKIVNERRTRAAEKEMSQMKEGEELAEKKKASRTEKKATKKQEKKAEKKDKAQTMKRKVRESYSLSPARNNITLHSLCTVYSQAGMEGSQNQQIDKVRSSEPAAKKPCGESEEESSDPRKVFISNLLFSITEDHLRDKFSKLGEVLDVRIVKNMAGRSKGYAYVEFNNESTVQAALAMDREKMEGRPMFISPCVDKAKNPTTFKFPTS-LDKHTLFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNRAGKPKGYGYVEYEQESSASTAVLTLDKTEVKGRTISVALSNPPTR 774          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Nematostella
Match: EDO42839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S096])

HSP 1 Score: 102.834 bits (255), Expect = 1.098e-25
Identity = 49/130 (37.69%), Postives = 79/130 (60.77%), Query Frame = 1
Query:  178 NPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDE---KSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYL-TDK--EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKS 549
            NP +Y SH +LIN L  S  +   R++RE M   +PL+ E+W+ WI DE     I   ++ ++++F R ++DY+SV +W +YCQFM+  + TD+  E +R  FE A+   G H+T+G  IW  +  +E +
Sbjct:    4 NPYNYQSHIQLINLLSSSGDLERLRQARENMSKSFPLTEELWLSWIEDELPLACIPDHRETVKSLFDRGVQDYQSVKLWIQYCQFMMDNMETDQGLESVRATFEKALTSAGLHVTEGSSIWDGFREFETT 133          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 65.0846 bits (157), Expect = 5.844e-11
Identity = 50/200 (25.00%), Postives = 104/200 (52.00%), Query Frame = 1
Query: 1753 EQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGV---VEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLV-TFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQS 2337
            E+  E  +++T+F   L  ++   DL + F K G+++++RI  D +  +S+G A+I+F  +S V  A+ L  + LL  P+ V    +      + +  +   +   +L+V +L  N+T+  ++ +F+ FG +  ++L+   ++   KG  +V++     A +A+   +G E+  R +++     PV E     G+SS+ S
Sbjct:  110 EESAEEKDQRTVFCMQLARNIRPRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEFTDKSAVPLAIGLSGQKLLGAPIMVMLTQAEKNRLAAEAERLKQPLGPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKIG----PVTER----GDSSAYS 301          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 58.9214 bits (141), Expect = 6.722e-9
Identity = 42/170 (24.71%), Postives = 78/170 (45.88%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKD-SHDKSRGFAFIQFD----SQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            +++V +L   V E  L +KF   G +  IR+ +D    +S G+A++ F     ++  ++       +    R M+  R  S  K              +F+KNL K++   +L + F  FG +   ++   + G PKG  +V +  E+ A +A+   DGM + D+ + V 
Sbjct:   14 SLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRDPSLRKSGVG---------NIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVG 174          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Nematostella
Match: EDO38842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBS2])

HSP 1 Score: 56.9954 bits (136), Expect = 1.458e-8
Identity = 47/154 (30.52%), Postives = 73/154 (47.40%), Query Frame = 1
Query: 1768 RCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKAL 2229
            RC    +FV NL    +E ++++ F+K G++AE+ I     +K +GF FI+ D++   E A               +R   + +  F+       A  L VKNL   VT   LE  F QFG ++   +V    G  KG   VE+S +N+A  A+
Sbjct:    9 RC---RLFVGNL-IDCDEEEMKEMFKKYGEVAEVFI-----NKEKGFGFIRLDTRLHAEAAKAGLD--------MATRKGRTLRVRFA-----THAAALRVKNLDNLVTNELLEQAFSQFGDVERAVVVCDVRGRSKGHGIVEFSRKNNAHNAM 140          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Medaka
Match: sart3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:NCBI gene;Acc:101165237])

HSP 1 Score: 294.664 bits (753), Expect = 8.508e-87
Identity = 232/853 (27.20%), Postives = 400/853 (46.89%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYL---IWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLD-KQSKDNVDLTIIRELFDKLIT-----IENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERIL---RIVAEESDLKTYLQFTK----KIDTQRKKISERRMKEEAENPTKPQKRKTPDYKSSGLKAKKVKFSEELSTETV------------------------TASVSIEQPIE-RCEEKTIFVSNLKYSVNEND--LRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHS----FSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKP------------PIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKK----SNADFRKFLM 2496
            AEI +++   E +  N  DY+ H  LI  LK   ++I  R++R+ M   +PL+ E+W+DW+ DE  +  ++                               +++E++ + FE AI        K Y+   IW  Y  Y        G  ++   I++  +  + L +       + + E+          +    +L++ +   Y+ FE K+ +                                ++I+I   +ERA+ + CL  ++W    KYL +   + ++ +L  ++RAVRN   ++ LW  Y+  +E +      +   F           T ++ +WQ YLD+ +R++D K SK+   L  +RE F + +      +E       DP C +++ W  IEA +  NM K+RELW  IM    +  +++WLE    ER +GD  H ++  + AV C TDYPE++C+ +L   R+     D  T +Q T+    +I+ QR K +E+   +  +   + ++R+    +  GLK  +    E + TET                          A   I+   E R +  ++F+SNL +++ E +  L+  FE CG IA++R         RG+ ++QF+S ++V EALKL+R  +  RPMFVS C   NK+     F Y+  + E +K+F+  LP + TK  LE I KQ G +K++RLVT++SG PKG+AYVE+++E  AS+A++  DG+EI    I V +S PP +   +K G SS    D  P             + ++PR++  +  A   K+ +G +++  +G +    +    SN+DF K L+
Sbjct:   59 AEIQRLE---EQLSINAFDYNCHVDLIKLLKQEGELIRLRKARQKMSELFPLTEEIWLDWLKDEIRLTEEE-------------------------------SNREKVYELFERAI--------KDYICPEIWLEYAQYSIGGMGSPGGIDKVRSIFERAVTAVGLHMTKGQSVWEAYREFENAILSTLQLVAEPPKLAEYQA--YIDFELKVGDP-------------------------------ARIQIT--FERALAENCLVPDMWSKCTKYLDRQL-KVKDLVLSTHERAVRNCPWTMSLWKSYLLALERHGADHHTVSDVFEKALNAGFIQATDYVEIWQVYLDYLRRRVDFKSSKE---LEELREAFSRCLDYMKQDVEERFGESGDPSCVVMQIWARIEALHCKNMQKARELWDNIMTKGNSKYANMWLEYYNLERSYGDSVHCRKALHRAVQCTTDYPEHVCDVLLTFERVEGSLEDWDTAVQKTESRMNRINEQRAKAAEKEANQARQEEERVEQRRKVKAEKKGLKKDQRGADEYMETETGLFGRNAPRTKPSAGLKKVPPGHGDAAEKQIDDKSELRDDCCSVFISNLAFTLQEPEATLKALFESCGSIAQVRPIFGHRGVFRGYCYVQFESPASVTEALKLDRREVEGRPMFVSPCVDKNKNPDFKIFKYNTSL-EKHKIFISGLPLSCTKEQLEEICKQQGTVKDVRLVTYRSGRPKGLAYVEFADETQASQAVLKMDGVEIEGHKISVAISNPPRRSVNEKPG-SSRPVTDMMPRQNYGSRGKGRTQLSLLPRSLH-RQAAGVGKVENGTAAEKMEGTVNTTGEPRTLSNSDFAKMLL 827          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Medaka
Match: sart3 (spliceosome associated factor 3, U4/U6 recycling protein [Source:NCBI gene;Acc:101165237])

HSP 1 Score: 261.151 bits (666), Expect = 5.716e-74
Identity = 227/908 (25.00%), Postives = 403/908 (44.38%), Query Frame = 1
Query:  133 AEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSIN---SDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDK---EEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKS-------PFVDDGSNEQKE-------RIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFE-----SNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLIT-----IENYID--YDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERIL---RIVAEESDLKTYLQFTK----KIDTQRKKISERRMKEEAENPTKPQKRKTPDYKSSGLKAKKVKFSEELSTET----------------VTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKS-------RGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC--NSSNKHSFSYSVGVVEANKL---FVKNLPKNVTKYALEN------IFKQFGALKEIRLVTFKSGLP-------------------------------KGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKP------------PIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKK----SNADFRKFLM 2496
            AEI +++   E +  N  DY+ H  LI  LK   ++I  R++R+ M   +PL+ E+W+DW+ DE  +    S+++ +  +F RAI+DY   ++W EY Q+ +G +      +++R  FE A+  VG H+TKG  +W  Y  +E +       P      NE++E       RI+ ++ RQL++ L   + T  E+             +  +++ + Q++    P E+ +   E    A               EY  Y +      + ++I+I   +ERA+ + CL  ++W    KYL +   + ++ +L  ++RAVRN   ++ LW  Y+  +E +      +   F           T ++ +WQ YLD+ +R++D   + + +L  +RE F + +      +E       DP C +++ W  IEA +  NM K+RELW  IM    +  +++WLE    ER +GD  H ++  + AV C TDYPE++C+ +L   R+     D  T +Q T+    +I+ QR K +E+   +  +   + ++R+    +  GLK  +    E+   E                      + ++ +E   E  +F  N   +     L++     G  AE +I   S  +           AF   + ++T++   +    +   RP+F  R          F     V EA KL    V+  P  V+    +N      IFK   +L++ ++  F SGLP                               KG+AYVE+++E  AS+A++  DG+EI    I V +S PP +   +K G SS    D  P             + ++PR++  +  A   K+ +G +++  +G +    +    SN+DF K L+
Sbjct:   59 AEIQRLE---EQLSINAFDYNCHVDLIKLLKQEGELIRLRKARQKMSELFPLTEEIWLDWLKDEIRLTEEESNREKVYELFERAIKDYICPEIWLEYAQYSIGGMGSPGGIDKVRSIFERAVTAVGLHMTKGQSVWEAYREFENAILSTLQPPPGKVPRNEEQELIKTQLERIHTLFRRQLAIPLMDMEATYAEY--EEWSEHGVPEAVAHQYKKALQQMEKCKPLEEALLVAEPPKLA---------------EYQAYIDFELKVGDPARIQIT--FERALAENCLVPDMWSKCTKYLDRQL-KVKDLVLSTHERAVRNCPWTMSLWKSYLLALERHGADHHTVSDVFEKALNAGFIQATDYVEIWQVYLDYLRRRVDFSKESSKELEELREAFSRCLDYMKQDVEERFGESGDPSCVVMQIWARIEALHCKNMQKARELWDNIMTKGNSKYANMWLEYYNLERSYGDSVHCRKALHRAVQCTTDYPEHVCDVLLTFERVEGSLEDWDTAVQKTESRMNRINEQRAKAAEKEANQARQEEERVEQRRKVKAEKKGLKKDQRGAGEKRKAEQEDQDEWNKDSGPKRRRGNVDGTTDEYME--TETGLFGRNAPRTKPSAGLKKVPPGHGDAAEKQIDDKSELRDDCCSVFISNLAFTLQEPEATLKALFESCGSIAQVRPIFGHRGVFRGYCYVQFESPASVTEALKLDRREVEGRPMFVSPCVDKNKNPDFKIFKYNTSLEKHKI--FISGLPLSCTKEQLEEICKQQGTVKDVRLVTYRSGRPKGLAYVEFADETQASQAVLKMDGVEIEGHKISVAISNPPRRSVNEKPG-SSRPVTDMMPRQNYGSRGKGRTQLSLLPRSLH-RQAAGVGKVENGTAAEKMEGTVNTTGEPRTLSNSDFAKMLL 937          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Medaka
Match: pabpc1b (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:101169122])

HSP 1 Score: 69.707 bits (169), Expect = 8.085e-12
Identity = 48/168 (28.57%), Postives = 84/168 (50.00%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXX-XXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            IF+ NL  S++   L   F   G I   ++  D  + SRG+ F+ F++    E A  K+   LL +R +FV R  S  +          E   +++KN  +++    L+ IF +FG    +R++T +SG  +G  +V + N  DA KA+   +G E+  R++ V  ++
Sbjct:  101 IFIKNLDKSIDNKALYDTFSAFGNILSCKVVCD-ENGSRGYGFVHFETHDAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAREFTNVYIKNFGEDMDDEKLKEIFSKFGNATSVRVMTDESGGGRGFGFVSFENHEDAQKAVDEMNGKELNGRIMFVGRAQ 267          

HSP 2 Score: 57.3806 bits (137), Expect = 5.062e-8
Identity = 45/170 (26.47%), Postives = 81/170 (47.65%), Query Frame = 1
Query: 1783 TIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDS-HDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            +++V +L   V E  L +KF   G I  IR+ +D    +S G+A++ F    D++  ++       +    R M+  R  S  K       GV     +F+KNL K++   AL + F  FG +   ++V  ++G  +G  +V +   + A +A+   +GM + DR + V 
Sbjct:   12 SLYVGDLHQDVTEAMLYEKFSPAGAIVSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGQPVRIMWSQRDPSLRKS------GV---GNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETHDAAERAIEKMNGMLLNDRKVFVG 171          

HSP 3 Score: 53.5286 bits (127), Expect = 7.741e-7
Identity = 46/188 (24.47%), Postives = 79/188 (42.02%), Query Frame = 1
Query: 1768 RCEEKT-IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQF----DSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYS----------VGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            R  E T +++ N    +++  L++ F K G    +R+  D     RGF F+ F    D+Q  V+E    E      R MFV R     +                    +   L+VKNL   +    L   F  FG++   + V  + G  KG  +V +S+  +A+KA+   +G  +  + + V L++
Sbjct:  186 RAREFTNVYIKNFGEDMDDEKLKEIFSKFGNATSVRVMTDESGGGRGFGFVSFENHEDAQKAVDEMNGKELNG---RIMFVGRAQKKMERQMELKRRFEQMKQDRTTRYQGVNLYVKNLDDGIDDERLRKEFSPFGSITSAK-VMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQ 369          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Medaka
Match: pabpc1l (embryonic polyadenylate-binding protein [Source:NCBI gene;Acc:101167536])

HSP 1 Score: 68.1662 bits (165), Expect = 1.808e-11
Identity = 43/168 (25.60%), Postives = 81/168 (48.21%), Query Frame = 1
Query: 1786 IFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXX-XXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSK 2286
            IF+ N+  S++   L   F   G I   ++  D    S+G+ F+ F++Q     A   +   LL +R +FV    S  +    +   V++   +++KN   N+T   L+  F  FG    +R++  + G  +G  +V Y++  DA KA+   +G E+  ++I V  ++
Sbjct:   76 IFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLTDEKLKEAFSAFGKTLSVRVMRDEKGRSRGFGFVNYAHHEDAQKAVDEMNGKEMNGKIIYVGRAQ 242          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Medaka
Match: rbm39b (RNA-binding protein 39 [Source:NCBI gene;Acc:101167788])

HSP 1 Score: 68.1662 bits (165), Expect = 2.164e-11
Identity = 53/187 (28.34%), Postives = 94/187 (50.27%), Query Frame = 1
Query: 1750 IEQPI-----ERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHD-KSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRC----NSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVT-FKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVN 2277
            + QPI     E  + +T+F   L   +   DL   F   GK+ ++RI  D +  +S+G A+I+F   S+V  A+ L  + LL  P+ V       N +   + +   G     +L+V +L  N+T+  L  IF+ FG ++ I+L+   ++G  KG  ++ +++   A KAL   +G E+  R ++V 
Sbjct:  135 VRQPIDNLTPEERDARTVFCMQLAARIRARDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYIEFVETSSVPLAIGLTGQRLLGVPIIVQASQAEKNRAAAAANNLQKGSAGPMRLYVGSLHFNITEEMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVG 321          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Planmine SMEST
Match: SMESG000008868.1 (SMESG000008868.1)

HSP 1 Score: 1572.37 bits (4070), Expect = 0.000e+0
Identity = 790/790 (100.00%), Postives = 790/790 (100.00%), Query Frame = 1
Query:  127 FSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLXXXXXXXXXXXXICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVXXXXXXXXXXXXXRPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 2496
            FSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLEWNQENKEWENEICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVEEALKLERELLLERPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM
Sbjct:   16 FSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLEWNQENKEWENEICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKEMHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQDEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQNLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYIDYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIEFERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFTKKIDTQRKKISERRMKEEAENPTKPQKRKTPDYKSSGLKAKKVKFSEELSTETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIRIQKDSHDKSRGFAFIQFDSQSTVEEALKLERELLLERPMFVSRCNSSNKHSFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGLPKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGESSSQSIDFKPPIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSNADFRKFLM 805          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Planmine SMEST
Match: SMESG000047714.1 (SMESG000047714.1)

HSP 1 Score: 331.257 bits (848), Expect = 1.850e-108
Identity = 163/178 (91.57%), Postives = 170/178 (95.51%), Query Frame = 1
Query:  127 FSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFL 660
            FSAEIMKIDMYRENVLKNPL YDSH KLINALKHSEKMIEARESRETMHIYYPLSPEM  DWINDEKSINSDKDFIRA+F+RAIEDY+SV VWFEY QFMLGYLT+K+EIRQ FEVAIAQVGTHLTKGYLIWGTYLIYEKS FVDDGSNEQK+RIYK+YLRQLSLSLQSNDETLKEFL
Sbjct:   16 FSAEIMKIDMYRENVLKNPLHYDSHWKLINALKHSEKMIEARESRETMHIYYPLSPEMRYDWINDEKSINSDKDFIRALFIRAIEDYRSVYVWFEYYQFMLGYLTNKKEIRQCFEVAIAQVGTHLTKGYLIWGTYLIYEKSLFVDDGSNEQKDRIYKLYLRQLSLSLQSNDETLKEFL 193          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Planmine SMEST
Match: SMESG000012925.1 (SMESG000012925.1)

HSP 1 Score: 329.717 bits (844), Expect = 8.480e-108
Identity = 162/178 (91.01%), Postives = 169/178 (94.94%), Query Frame = 1
Query:  127 FSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFL 660
            FS EIMKIDMYRENVLKNPL YDSH KLINALKHSEKMIEARESRETMHIYYPLSPEM  DWINDEKSINSDKDFIRA+F+RAIEDY+SV VWFEY QFMLGYLT+K+EIRQ FEVAIAQVGTHLTKGYLIWGTYLIYEKS FVDDGSNEQK+RIYK+YLRQLSLSLQSNDETLKEFL
Sbjct:   16 FSVEIMKIDMYRENVLKNPLHYDSHWKLINALKHSEKMIEARESRETMHIYYPLSPEMRYDWINDEKSINSDKDFIRALFIRAIEDYRSVYVWFEYYQFMLGYLTNKKEIRQCFEVAIAQVGTHLTKGYLIWGTYLIYEKSLFVDDGSNEQKDRIYKLYLRQLSLSLQSNDETLKEFL 193          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Planmine SMEST
Match: SMESG000013251.1 (SMESG000013251.1)

HSP 1 Score: 324.709 bits (831), Expect = 4.075e-106
Identity = 159/175 (90.86%), Postives = 165/175 (94.29%), Query Frame = 1
Query:  127 FSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLK 651
            FSAE MKI MYRENVLKNPLDYDSH KLINALKHSEKMIEARESRE MHIYYPLSPEMWID INDEKSINS+KDFIRA+F+RAI+DY+SVD WFEYCQFMLGYLTDKEEIRQ FEVAIAQVGTHLTKGYLIWGTYLIYEKS FV DG NEQKERIYK+YLRQLSLSLQSNDETLK
Sbjct:   16 FSAESMKIYMYRENVLKNPLDYDSHWKLINALKHSEKMIEARESREIMHIYYPLSPEMWIDCINDEKSINSNKDFIRALFIRAIKDYRSVDAWFEYCQFMLGYLTDKEEIRQCFEVAIAQVGTHLTKGYLIWGTYLIYEKSSFVYDGINEQKERIYKLYLRQLSLSLQSNDETLK 190          
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Planmine SMEST
Match: SMESG000038659.1 (SMESG000038659.1)

HSP 1 Score: 331.643 bits (849), Expect = 6.580e-104
Identity = 178/196 (90.82%), Postives = 184/196 (93.88%), Query Frame = 1
Query:   73 MFHMIXXXXXXXXXXXXXFSAEIMKIDMYRENVLKNPLDYDSHCKLINALKHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLRAIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIWGTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFL 660
            MFHMIDDDLSSSDSESEDFSA+IMKIDMYREN LKNPLDYDSH KLINALKHSEKMIEAR+SRETMHIYYPL PEMWIDWINDEKSINSDKDFI AI     EDY+SVDVWF+YCQFMLGYLTDKEEIRQ FEVA AQVGTHLTKGYLIWGTYLIYEKS FVDDGSNEQKERIYK+YLR+LSLSLQSNDETLKEFL
Sbjct:    1 MFHMIDDDLSSSDSESEDFSAKIMKIDMYRENFLKNPLDYDSHWKLINALKHSEKMIEARKSRETMHIYYPLFPEMWIDWINDEKSINSDKDFICAI-----EDYRSVDVWFKYCQFMLGYLTDKEEIRQCFEVAFAQVGTHLTKGYLIWGTYLIYEKSFFVDDGSNEQKERIYKLYLRKLSLSLQSNDETLKEFL 191          
The following BLAST results are available for this feature:
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SART37.014e-10928.56spliceosome associated factor 3, U4/U6 recycling p... [more]
SART31.064e-10828.34spliceosome associated factor 3, U4/U6 recycling p... [more]
SART39.682e-9627.57spliceosome associated factor 3, U4/U6 recycling p... [more]
SART39.614e-2626.26spliceosome associated factor 3, U4/U6 recycling p... [more]
SART31.209e-2446.96spliceosome associated factor 3, U4/U6 recycling p... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sart-32.262e-4023.01SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
sart-32.262e-4023.01SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
sart-32.262e-4023.01SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
sart-32.262e-4023.01SART-3/p110 homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
uaf-11.511e-1223.79Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Caper8.591e-1229.83gene:FBgn0031883 transcript:FBtr0089640[more]
Caper8.591e-1229.83gene:FBgn0031883 transcript:FBtr0089636[more]
Rnp4F4.405e-1133.82gene:FBgn0014024 transcript:FBtr0112876[more]
Rnp4F4.405e-1133.82gene:FBgn0014024 transcript:FBtr0070752[more]
Rnp4F4.405e-1133.82gene:FBgn0014024 transcript:FBtr0340477[more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sart31.367e-6527.76spliceosome associated factor 3, U4/U6 recycling p... [more]
sart31.006e-6427.76spliceosome associated factor 3, U4/U6 recycling p... [more]
pabpc1l9.587e-1226.19poly(A) binding protein, cytoplasmic 1-like [Sourc... [more]
pabpc1l9.587e-1226.19poly(A) binding protein, cytoplasmic 1-like [Sourc... [more]
pabpc1l1.067e-1126.19poly(A) binding protein, cytoplasmic 1-like [Sourc... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hbp11.280e-6128.74HMG-box transcription factor 1 [Source:Xenbase;Acc... [more]
hbp12.562e-5728.66HMG-box transcription factor 1 [Source:Xenbase;Acc... [more]
hbp11.813e-5628.26HMG-box transcription factor 1 [Source:Xenbase;Acc... [more]
hbp14.282e-5528.35HMG-box transcription factor 1 [Source:Xenbase;Acc... [more]
hbp15.706e-5528.35HMG-box transcription factor 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sart32.872e-11228.75squamous cell carcinoma antigen recognized by T ce... [more]
Sart39.572e-2826.95squamous cell carcinoma antigen recognized by T ce... [more]
Pabpc1l4.735e-1226.19poly(A) binding protein, cytoplasmic 1-like [Sourc... [more]
Rbm394.997e-1127.37RNA binding motif protein 39 [Source:MGI Symbol;Ac... [more]
Rbm396.817e-1127.37RNA binding motif protein 39 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JLI8|SART3_MOUSE2.009e-11128.75Squamous cell carcinoma antigen recognized by T-ce... [more]
sp|Q15020|SART3_HUMAN3.368e-10828.56Squamous cell carcinoma antigen recognized by T-ce... [more]
sp|Q5REG1|SART3_PONAB6.824e-10828.45Squamous cell carcinoma antigen recognized by T-ce... [more]
sp|B3DJT0|SART3_DANRE7.592e-6427.76Squamous cell carcinoma antigen recognized by T-ce... [more]
sp|Q17430|SART3_CAEEL2.878e-3923.01Nuclear RNA-binding protein sart-3 OS=Caenorhabdit... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AET96.731e-12031.42Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2A3EKK01.252e-11933.10Squamous cell carcinoma antigen recognized by T-ce... [more]
A0A087ZPR66.095e-11932.74Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
C3Y6796.481e-11929.81Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A310SGM41.894e-11832.90Squamous cell carcinoma antigen recognized by T-ce... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sart32.131e-6126.70spliceosome associated factor 3, U4/U6 recycling p... [more]
rbm39a3.051e-1127.81RNA-binding protein 39 [Source:NCBI gene;Acc:10304... [more]
rbm39a3.171e-1127.27RNA-binding protein 39 [Source:NCBI gene;Acc:10304... [more]
rbm39a3.225e-1127.81RNA-binding protein 39 [Source:NCBI gene;Acc:10304... [more]
rbm39b3.962e-1127.13RNA-binding protein 39-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM392.905e-1127.96RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
pabpc48.090e-1026.60poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSPMAT00000004893.18.758e-1027.27pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
RBM391.138e-925.49RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
HNRNPA2B15.656e-927.15heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NSR15.356e-1430.05Nucleolar protein that binds nuclear localization ... [more]
HRP11.001e-724.86Subunit of cleavage factor I; cleavage factor I is... [more]
PAB11.816e-724.22Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
HRB12.626e-727.27Poly(A+) RNA-binding protein; key surveillance fac... [more]
GBP23.074e-725.58Poly(A+) RNA-binding protein; key surveillance fac... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373421.364e-8628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428391.098e-2537.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339265.844e-1125.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332066.722e-924.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388421.458e-830.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sart38.508e-8727.20spliceosome associated factor 3, U4/U6 recycling p... [more]
sart35.716e-7425.00spliceosome associated factor 3, U4/U6 recycling p... [more]
pabpc1b8.085e-1228.57polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc1l1.808e-1125.60embryonic polyadenylate-binding protein [Source:NC... [more]
rbm39b2.164e-1128.34RNA-binding protein 39 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Squamous cell carcinoma antigen recognized by T-cells 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008868.10.000e+0100.00SMESG000008868.1[more]
SMESG000047714.11.850e-10891.57SMESG000047714.1[more]
SMESG000012925.18.480e-10891.01SMESG000012925.1[more]
SMESG000013251.14.075e-10690.86SMESG000013251.1[more]
SMESG000038659.16.580e-10490.82SMESG000038659.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001214 ID=SMED30001214|Name=Squamous cell carcinoma antigen recognized by T-cells 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2515bp
GAAAAATTATTAAATTTTAATAAATTAATTTGCTAATAAATCGAATTTGT
CTTATAAAGAAAACATTTAAAAATGTTCCATATGATCGATGATGATTTGT
CTAGTAGTGATTCGGAATCAGAAGATTTTTCAGCGGAAATTATGAAAATT
GATATGTATAGAGAAAATGTTTTAAAAAATCCTCTTGATTATGATTCTCA
TTGTAAGTTAATTAATGCACTAAAACATTCAGAAAAGATGATTGAAGCAA
GAGAATCAAGAGAAACTATGCATATTTATTATCCATTGTCCCCTGAAATG
TGGATTGATTGGATCAATGATGAAAAGTCTATTAATTCAGACAAAGATTT
CATACGTGCTATATTCCTTCGTGCAATTGAAGATTATAAAAGTGTCGATG
TATGGTTTGAATATTGCCAATTTATGTTAGGATATTTAACTGATAAAGAA
GAAATTAGACAATTTTTTGAAGTTGCTATTGCTCAAGTTGGGACTCATTT
AACTAAAGGATACTTAATATGGGGAACTTATCTTATTTATGAAAAATCTC
CTTTTGTAGATGATGGAAGTAATGAACAAAAGGAACGAATATACAAAATA
TATTTAAGACAATTATCTCTCTCTTTACAAAGTAATGATGAAACGTTAAA
AGAATTTCTTGAGTGGAATCAAGAAAATAAGGAATGGGAAAATGAAATCT
GTGCTAAACATGAATTATCTAAACAAAAGTTAATTAATTATCTTCCATTT
GAAGATAAAATAGCGAACATTGAAACTGAATACGCTGCAAATGCAACTTC
AGATTCTCCTGAAAGTAAAGAAATGCATTGGATAGAATATTTAAAATACT
TTGAATCCAATTGTTCAAAAATTGAAATATTAAACTTATATGAAAGAGCC
ATTACTGACTTATGTTTAAGTCAAAATATTTGGATTAGTTATTTAAAGTA
TCTTAGTCAACATTTTGAGCAAGACGAAGAACGAATTCTTAAAGCCTACC
AAAGAGCAGTAAGAAACTACAAATCTAGCCTAGAGTTGTGGATTGGCTAC
GTACGTCACATGGAAATGTATAATTGTTCCGTCGATGAGATTAGAACAAC
ATTCAATCTGATATTTCGTCAAAATCTTAATGATCAAACTCCTTTTATCC
CTCTATGGCAAGCGTATTTGGATTTTGAAAAAAGACAGCTTGATAAGCAA
TCCAAGGACAATGTTGATTTAACAATTATCAGAGAACTATTTGATAAACT
AATTACCATTGAAAATTATATCGATTATGATCCCCAGTGTTCTCTGGTGA
AATATTGGACCTTTATTGAGGCTAAATATGCTGGAAACATGCCAAAATCT
CGAGAGTTGTGGAGCTTAATCATGAAATCTCTAGGCAATTCCAACTCGTC
ATTATGGTTAGAAAACATTGAATTTGAACGAAAATTCGGTGATTTCGAAC
ACTTGAAACGACTCGCTAACACCGCAGTCAATTGTTTCACCGATTATCCG
GAATACCTCTGTGAACGAATTCTGAGAATAGTTGCCGAAGAAAGCGATTT
GAAAACATATTTGCAATTCACCAAAAAAATCGATACCCAGCGGAAAAAGA
TCTCTGAGCGTCGAATGAAAGAAGAAGCAGAAAACCCAACAAAGCCACAG
AAAAGAAAAACTCCCGATTATAAAAGCTCTGGATTGAAAGCAAAAAAAGT
GAAATTTTCCGAGGAATTATCGACCGAAACTGTAACGGCCTCGGTGAGCA
TTGAACAGCCAATTGAAAGGTGTGAAGAGAAAACGATTTTCGTTAGCAAT
TTGAAATACAGCGTCAATGAGAATGATTTGCGGCAGAAATTCGAAAAATG
CGGTAAAATCGCTGAGATCCGAATCCAGAAAGATTCCCACGACAAATCTC
GAGGATTTGCGTTCATTCAGTTTGATTCGCAATCTACAGTTGAAGAGGCA
TTGAAACTGGAACGGGAACTGTTACTGGAACGTCCGATGTTTGTTAGTCG
ATGCAATTCGTCGAATAAACATTCCTTCTCCTATTCGGTTGGAGTCGTCG
AAGCCAACAAACTGTTTGTAAAAAATCTCCCGAAAAATGTCACGAAATAT
GCGCTGGAAAATATTTTCAAACAATTCGGAGCTCTAAAAGAAATACGATT
GGTCACATTCAAAAGTGGACTTCCTAAAGGAATCGCCTATGTTGAGTATT
CGAATGAGAATGACGCCTCAAAGGCGCTGGTTGGAACCGATGGGATGGAA
ATCGGAGATCGAGTAATCGAGGTGAATCTAAGTAAGCCACCTGTTAAGGA
ATCTCCTAAAAAAGACGGCGAATCCTCATCTCAGTCGATTGATTTCAAGC
CCCCTATCGGAATGATACCGCGTACTGTTGGATTGAAACCAATGGCAACG
CAAAAGAAAATTATCCATGGGGCTAGTTCGGATAGTCAGGATGGCAATAT
CGCCGAGGCTAAGAAATCGAATGCTGATTTTCGTAAATTTTTGATGTAAA
TAAATTTTTAGTTTT
back to top

protein sequence of SMED30001214-orf-1

>SMED30001214-orf-1 ID=SMED30001214-orf-1|Name=SMED30001214-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=809bp
MFHMIDDDLSSSDSESEDFSAEIMKIDMYRENVLKNPLDYDSHCKLINAL
KHSEKMIEARESRETMHIYYPLSPEMWIDWINDEKSINSDKDFIRAIFLR
AIEDYKSVDVWFEYCQFMLGYLTDKEEIRQFFEVAIAQVGTHLTKGYLIW
GTYLIYEKSPFVDDGSNEQKERIYKIYLRQLSLSLQSNDETLKEFLEWNQ
ENKEWENEICAKHELSKQKLINYLPFEDKIANIETEYAANATSDSPESKE
MHWIEYLKYFESNCSKIEILNLYERAITDLCLSQNIWISYLKYLSQHFEQ
DEERILKAYQRAVRNYKSSLELWIGYVRHMEMYNCSVDEIRTTFNLIFRQ
NLNDQTPFIPLWQAYLDFEKRQLDKQSKDNVDLTIIRELFDKLITIENYI
DYDPQCSLVKYWTFIEAKYAGNMPKSRELWSLIMKSLGNSNSSLWLENIE
FERKFGDFEHLKRLANTAVNCFTDYPEYLCERILRIVAEESDLKTYLQFT
KKIDTQRKKISERRMKEEAENPTKPQKRKTPDYKSSGLKAKKVKFSEELS
TETVTASVSIEQPIERCEEKTIFVSNLKYSVNENDLRQKFEKCGKIAEIR
IQKDSHDKSRGFAFIQFDSQSTVEEALKLERELLLERPMFVSRCNSSNKH
SFSYSVGVVEANKLFVKNLPKNVTKYALENIFKQFGALKEIRLVTFKSGL
PKGIAYVEYSNENDASKALVGTDGMEIGDRVIEVNLSKPPVKESPKKDGE
SSSQSIDFKPPIGMIPRTVGLKPMATQKKIIHGASSDSQDGNIAEAKKSN
ADFRKFLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR015155PFU
IPR003107HAT
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR011990TPR-like_helical_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 188..208
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 508..535
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 781..795
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 776..796
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 736..758
NoneNo IPR availablePANTHERPTHR17204:SF25EMBRYO DEFECTIVE 140coord: 508..626
NoneNo IPR availablePANTHERPTHR17204PRE-MRNA PROCESSING PROTEIN PRP39-RELATEDcoord: 508..626
coord: 9..539
NoneNo IPR availablePANTHERPTHR17204:SF25EMBRYO DEFECTIVE 140coord: 9..539
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 571..642
e-value: 2.3E-19
score: 80.4
coord: 663..735
e-value: 1.0E-21
score: 88.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 572..631
e-value: 9.9E-17
score: 60.5
coord: 664..732
e-value: 2.8E-17
score: 62.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 570..646
score: 17.506
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 662..739
score: 18.086
IPR003107HAT (Half-A-TPR) repeatSMARTSM00386hat_new_1coord: 421..454
e-value: 53.0
score: 10.1
coord: 339..371
e-value: 33.0
score: 11.6
coord: 300..332
e-value: 0.0084
score: 25.3
coord: 264..296
e-value: 57.0
score: 9.9
coord: 123..159
e-value: 54.0
score: 10.1
coord: 89..120
e-value: 0.06
score: 22.5
coord: 54..86
e-value: 180.0
score: 6.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 30..212
e-value: 1.3E-34
score: 121.7
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 247..536
e-value: 9.3E-33
score: 115.7
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 31..520
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 565..653
e-value: 1.9E-21
score: 78.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 654..749
e-value: 4.3E-22
score: 80.8
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 567..652
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 658..747