Myosin head

Overview
NameMyosin head
Smed IDSMED30001196
Length (bp)330
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin head (SMED30001196) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin head (SMED30001196) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin head (SMED30001196) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin head (SMED30001196) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001196

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30001196SMESG000049494.1 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001196SMESG000049494.1 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001196SMESG000049494.1 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30001196SMESG000049494.1 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001196SMESG000049494.1 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001196SMESG000049494.1 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin head vs. Ensembl Human
Match: MYH9 (myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:7579])

HSP 1 Score: 181.03 bits (458), Expect = 1.286e-58
Identity = 82/99 (82.83%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  104 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKK 202          
BLAST of Myosin head vs. Ensembl Human
Match: MYH11 (myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:7569])

HSP 1 Score: 181.8 bits (460), Expect = 5.381e-55
Identity = 83/99 (83.84%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++I++ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  108 RYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 206          
BLAST of Myosin head vs. Ensembl Human
Match: MYH14 (myosin heavy chain 14 [Source:HGNC Symbol;Acc:HGNC:23212])

HSP 1 Score: 172.555 bits (436), Expect = 1.685e-53
Identity = 77/99 (77.78%), Postives = 90/99 (90.91%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK+LPIY + I+E Y+G+KRHE PPH+YA+ + AYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  128 RYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRK 226          
BLAST of Myosin head vs. Ensembl Human
Match: MYH9 (myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:7579])

HSP 1 Score: 178.718 bits (452), Expect = 9.237e-53
Identity = 82/99 (82.83%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  104 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKK 202          
BLAST of Myosin head vs. Ensembl Human
Match: MYH11 (myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:7569])

HSP 1 Score: 178.333 bits (451), Expect = 1.068e-52
Identity = 83/99 (83.84%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++I++ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  108 RYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 206          
BLAST of Myosin head vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 174.866 bits (442), Expect = 7.116e-52
Identity = 79/103 (76.70%), Postives = 96/103 (93.20%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSAS 309
            RY+S LIYTYSGLFCVV+NPYK+LPIY++++IE +KG+KRHE PPHI+AIADTAYR+MLQ+REDQSILCTGESGAGKTENTKKVIQYLA VA + +N+ L+A+
Sbjct:  101 RYYSSLIYTYSGLFCVVINPYKKLPIYSEDLIEEFKGKKRHEMPPHIFAIADTAYRSMLQEREDQSILCTGESGAGKTENTKKVIQYLAHVAGATRNKSLNAA 203          
BLAST of Myosin head vs. Ensembl Celegans
Match: nmy-2 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5EBY3])

HSP 1 Score: 158.303 bits (399), Expect = 4.446e-46
Identity = 76/103 (73.79%), Postives = 88/103 (85.44%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVA--ASMKNQKLS 303
            RYFS L YTYSGLFCVV+NPYKR+PIY D I E +K +KR E PPHI+A+AD AYR+MLQ+R+DQSILCTGESGAGKTENTKKVIQYLA VA  + +KN+K S
Sbjct:  109 RYFSNLYYTYSGLFCVVINPYKRIPIYTDTIAEQFKCKKRKEMPPHIFAVADEAYRSMLQERDDQSILCTGESGAGKTENTKKVIQYLAYVANRSMVKNRKTS 211          
BLAST of Myosin head vs. Ensembl Celegans
Match: myo-5 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q21000])

HSP 1 Score: 143.28 bits (360), Expect = 8.698e-41
Identity = 63/93 (67.74%), Postives = 79/93 (84.95%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAA 279
            RY+S +IYTYSGLFCVV+NPYKRLPIY++ + + Y G++R+E PPH++A++D AYRNM  DRE+QS+L TGESGAGKTENTKKVI Y A V A
Sbjct:  104 RYYSMMIYTYSGLFCVVINPYKRLPIYSESVCQMYLGKRRNEMPPHLFAVSDEAYRNMTNDRENQSMLITGESGAGKTENTKKVISYFAMVGA 196          
BLAST of Myosin head vs. Ensembl Celegans
Match: myo-6 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q5FC20])

HSP 1 Score: 141.354 bits (355), Expect = 3.816e-40
Identity = 63/110 (57.27%), Postives = 83/110 (75.45%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSAS--NAIAQ 324
            RY+S +IYTYSGLFCV +NPYK LPIY D +   Y  ++R E PPH++A++D A+RNM+ D+E+QS+L TGESGAGKTENTKKVI Y A + +  K+QK  +S  N + Q
Sbjct:  108 RYYSMMIYTYSGLFCVFINPYKMLPIYTDSVASMYVNKRRAEMPPHLFAVSDEAFRNMMSDKENQSMLITGESGAGKTENTKKVIAYFAMIGSGNKDQKSESSLENQVVQ 217          
BLAST of Myosin head vs. Ensembl Celegans
Match: myo-1 (Myosin-1 [Source:UniProtKB/Swiss-Prot;Acc:P02567])

HSP 1 Score: 140.969 bits (354), Expect = 4.985e-40
Identity = 65/96 (67.71%), Postives = 78/96 (81.25%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMK 288
            RY + LIYTYSGLFCVV+NPYKRLPIY D +   + G++R E PPH++A++D AYR MLQD E+QS+L TGESGAGKTENTKKVI Y A+V AS K
Sbjct:  107 RYAAMLIYTYSGLFCVVINPYKRLPIYTDSVARMFMGKRRTEMPPHLFAVSDQAYRYMLQDHENQSMLITGESGAGKTENTKKVICYFATVGASQK 202          
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302572)

HSP 1 Score: 166.777 bits (421), Expect = 5.933e-49
Identity = 77/94 (81.91%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            RY+SGLIYTYSGLFCVV+NPYK+LPIY ++I+E YKG KRHE PPH++AI D+AYRNML DREDQSILCTGESGAGKTENTKKVIQ+LA VAAS
Sbjct:  109 RYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS 202          
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302574)

HSP 1 Score: 166.777 bits (421), Expect = 5.933e-49
Identity = 77/94 (81.91%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            RY+SGLIYTYSGLFCVV+NPYK+LPIY ++I+E YKG KRHE PPH++AI D+AYRNML DREDQSILCTGESGAGKTENTKKVIQ+LA VAAS
Sbjct:  109 RYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS 202          
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0100466)

HSP 1 Score: 166.777 bits (421), Expect = 5.933e-49
Identity = 77/94 (81.91%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            RY+SGLIYTYSGLFCVV+NPYK+LPIY ++I+E YKG KRHE PPH++AI D+AYRNML DREDQSILCTGESGAGKTENTKKVIQ+LA VAAS
Sbjct:  109 RYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS 202          
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0072398)

HSP 1 Score: 166.777 bits (421), Expect = 5.936e-49
Identity = 77/94 (81.91%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            RY+SGLIYTYSGLFCVV+NPYK+LPIY ++I+E YKG KRHE PPH++AI D+AYRNML DREDQSILCTGESGAGKTENTKKVIQ+LA VAAS
Sbjct:  109 RYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS 202          
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302573)

HSP 1 Score: 166.777 bits (421), Expect = 6.228e-49
Identity = 77/94 (81.91%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            RY+SGLIYTYSGLFCVV+NPYK+LPIY ++I+E YKG KRHE PPH++AI D+AYRNML DREDQSILCTGESGAGKTENTKKVIQ+LA VAAS
Sbjct:  109 RYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS 202          
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh11b (myosin, heavy chain 11b, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-101124-2])

HSP 1 Score: 179.489 bits (454), Expect = 2.720e-58
Identity = 82/103 (79.61%), Postives = 93/103 (90.29%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSAS 309
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++IIE YKG+KRHE PPHIY++ D AYRNMLQ+REDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K + S
Sbjct:  106 RYFSGLIYTYSGLFCVVINPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSVTDNAYRNMLQEREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKEATS 208          
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 179.874 bits (455), Expect = 2.338e-57
Identity = 82/99 (82.83%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY +EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSFKTKK 200          
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 182.57 bits (462), Expect = 2.175e-54
Identity = 84/107 (78.50%), Postives = 96/107 (89.72%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIA 321
            RY+SGLIYTYSGLFCVV+NPYK LPIY +EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K  +S A++
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSFKTKKDQSSIALS 208          
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh9b (myosin, heavy chain 9b, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-998])

HSP 1 Score: 181.03 bits (458), Expect = 9.376e-54
Identity = 82/108 (75.93%), Postives = 97/108 (89.81%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQ 324
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI++ YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K  +S+ ++ 
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKKDQSSSVLSH 209          
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 180.259 bits (456), Expect = 1.766e-53
Identity = 84/108 (77.78%), Postives = 96/108 (88.89%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQ 324
            RY+SGLIYTYSGLFCVV+NPYK LPIY +EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K  +S A++ 
Sbjct:  105 RYYSGLIYTYSGLFCVVINPYKYLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSFKTKKDQSSIALSH 212          
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 179.104 bits (453), Expect = 5.257e-53
Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++II+ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:   96 RYFSGLIYTYSGLFCVVVNPYKALPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 194          
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 179.104 bits (453), Expect = 5.736e-53
Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++II+ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  107 RYFSGLIYTYSGLFCVVVNPYKALPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 205          
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 179.104 bits (453), Expect = 5.737e-53
Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++II+ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  100 RYFSGLIYTYSGLFCVVVNPYKALPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 198          
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 179.104 bits (453), Expect = 5.737e-53
Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++II+ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  107 RYFSGLIYTYSGLFCVVVNPYKALPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 205          
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 179.104 bits (453), Expect = 5.738e-53
Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++II+ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  107 RYFSGLIYTYSGLFCVVVNPYKALPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 205          
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 173.711 bits (439), Expect = 7.659e-56
Identity = 80/99 (80.81%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++ IIE Y+G+KRHE PPHIYAI+++AYR MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  108 RYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK 206          
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh9 (myosin, heavy polypeptide 9, non-muscle [Source:MGI Symbol;Acc:MGI:107717])

HSP 1 Score: 179.104 bits (453), Expect = 4.881e-53
Identity = 82/99 (82.83%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  104 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSKK 202          
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 178.718 bits (452), Expect = 5.927e-53
Identity = 84/102 (82.35%), Postives = 95/102 (93.14%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSA 306
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++I++ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K S+
Sbjct:  108 RYFSGLIYTYSGLFCVVVNPYKYLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDSS 209          
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 178.718 bits (452), Expect = 6.040e-53
Identity = 84/102 (82.35%), Postives = 95/102 (93.14%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSA 306
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++I++ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K S+
Sbjct:  108 RYFSGLIYTYSGLFCVVVNPYKYLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDSS 209          
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 178.718 bits (452), Expect = 6.043e-53
Identity = 84/102 (82.35%), Postives = 95/102 (93.14%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSA 306
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++I++ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K S+
Sbjct:  108 RYFSGLIYTYSGLFCVVVNPYKYLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDSS 209          
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|P10587|MYH11_CHICK (Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 PE=1 SV=4)

HSP 1 Score: 179.489 bits (454), Expect = 2.207e-52
Identity = 84/99 (84.85%), Postives = 94/99 (94.95%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK+LPIY+++II+ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  107 RYFSGLIYTYSGLFCVVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 205          
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|P14105|MYH9_CHICK (Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 3.039e-52
Identity = 82/99 (82.83%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  104 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSKK 202          
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|P35748|MYH11_RABIT (Myosin-11 OS=Oryctolagus cuniculus OX=9986 GN=MYH11 PE=2 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 3.069e-52
Identity = 83/99 (83.84%), Postives = 94/99 (94.95%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFSGLIYTYSGLFCVV+NPYK+LPIY+++I++ YKG+KRHE PPHIYAIADTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  108 RYFSGLIYTYSGLFCVVVNPYKQLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKK 206          
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|Q8VDD5|MYH9_MOUSE (Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4)

HSP 1 Score: 179.104 bits (453), Expect = 3.414e-52
Identity = 82/99 (82.83%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  104 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKSKK 202          
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|P35579|MYH9_HUMAN (Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4)

HSP 1 Score: 178.718 bits (452), Expect = 4.436e-52
Identity = 82/99 (82.83%), Postives = 93/99 (93.94%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  104 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKK 202          
BLAST of Myosin head vs. TrEMBL
Match: A0A2H1CJH5 (Myosin head OS=Fasciola hepatica OX=6192 GN=D915_05023 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.282e-68
Identity = 95/110 (86.36%), Postives = 105/110 (95.45%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RYFSG+IYTYSGLFCVV+NPYKRLPIYND+IIEWYKGRKRHERPPHIY+IAD+AYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVA S K+QK + +N I++FH
Sbjct:  111 RYFSGMIYTYSGLFCVVVNPYKRLPIYNDDIIEWYKGRKRHERPPHIYSIADSAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKSQKTTTANVISKFH 220          
BLAST of Myosin head vs. TrEMBL
Match: A0A4S2M569 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_002715 PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.828e-66
Identity = 93/110 (84.55%), Postives = 102/110 (92.73%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RY+SG+IYTYSGLFCVV+NPYKRLPIYNDEIIEWYKG++RHERPPHIYAIAD AYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVA S K QK + +N I++ H
Sbjct:  111 RYYSGMIYTYSGLFCVVINPYKRLPIYNDEIIEWYKGKRRHERPPHIYAIADAAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKTQKTTTANVISKLH 220          
BLAST of Myosin head vs. TrEMBL
Match: A0A0R3SZA8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS11101 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.220e-65
Identity = 93/110 (84.55%), Postives = 103/110 (93.64%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RY+SGLIYTYSGLFCVV+NPYKRLPIY +EI+EWYKG+KRHERPPHI+AIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVA S KNQK + SN I++ +
Sbjct:  110 RYYSGLIYTYSGLFCVVINPYKRLPIYREEIVEWYKGKKRHERPPHIFAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSTKNQKTTPSNIISKLN 219          
BLAST of Myosin head vs. TrEMBL
Match: A0A3P7NPR8 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6990 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.073e-63
Identity = 94/110 (85.45%), Postives = 104/110 (94.55%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RY+SGLIYTYSGLFCVV+NPYKR+PIY +EI+EWYKGRKRHERPPHI+AIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVA S KNQK +ASN +++ H
Sbjct:   84 RYYSGLIYTYSGLFCVVVNPYKRIPIYREEIVEWYKGRKRHERPPHIFAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVATSAKNQKTTASNVLSKMH 193          
BLAST of Myosin head vs. TrEMBL
Match: A0A564Y912 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2342 PE=3 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 8.079e-63
Identity = 89/110 (80.91%), Postives = 102/110 (92.73%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RY+SGLIYTYSGLFCVV+NPYKRLPIY +EI+EWYKG+KRHERPPHI+AIADTAYRNM+ DR+DQSILCTGESGAGKTENTK+VIQYLASVA S KNQK + SN I++ +
Sbjct:  101 RYYSGLIYTYSGLFCVVINPYKRLPIYREEIVEWYKGKKRHERPPHIFAIADTAYRNMILDRKDQSILCTGESGAGKTENTKRVIQYLASVATSTKNQKTTPSNIISKLN 210          
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 174.096 bits (440), Expect = 3.255e-55
Identity = 80/99 (80.81%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++ IIE Y+G+KRHE PPHIYAI+++AYR MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  111 RYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK 209          
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 174.096 bits (440), Expect = 4.856e-55
Identity = 80/99 (80.81%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++ IIE Y+G+KRHE PPHIYAI+++AYR MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  111 RYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK 209          
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 180.644 bits (457), Expect = 1.031e-53
Identity = 83/99 (83.84%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY +EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA S KN+K
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKNLPIYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVALSSKNKK 200          
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh9b (myosin, heavy chain 9b, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-998])

HSP 1 Score: 177.563 bits (449), Expect = 1.202e-52
Identity = 81/99 (81.82%), Postives = 92/99 (92.93%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI++ YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKK 200          
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 175.637 bits (444), Expect = 5.962e-52
Identity = 82/108 (75.93%), Postives = 95/108 (87.96%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQ 324
            RYFSGLIYTYSGLFCVV+NPYK LPIY+++II+ YKG+KRHE PPHIY+I D AYRNM+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K +++    Q
Sbjct:  107 RYFSGLIYTYSGLFCVVVNPYKMLPIYSEKIIDMYKGKKRHEVPPHIYSITDNAYRNMMQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSAQHSGQ 214          
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 180.259 bits (456), Expect = 2.309e-54
Identity = 82/99 (82.83%), Postives = 92/99 (92.93%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EIIE Y+G+KRHE PPHIYA+ DTAYR+MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  114 RYYSGLIYTYSGLFCVVVNPYKNLPIYSEEIIEMYRGKKRHEVPPHIYAVTDTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK 212          
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005905.1 (pep scaffold:Pmarinus_7.0:GL476612:176223:319014:-1 gene:ENSPMAG00000004928.1 transcript:ENSPMAT00000005905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 1.814e-39
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAA 279
            RY + +IYTYSGLFCV +NPYK LP+Y+  ++  Y+G+KR E PPHI++I+D AY+ ML DRE+QSIL TGESGAGKT NTK+VIQY A++AA
Sbjct:  110 RYAAWMIYTYSGLFCVTVNPYKWLPVYDPIVVAGYRGKKRQEAPPHIFSISDNAYQFMLSDRENQSILITGESGAGKTVNTKRVIQYFATIAA 202          
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005582.1 (pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 gene:ENSPMAG00000004862.1 transcript:ENSPMAT00000005582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 1.888e-39
Identity = 66/119 (55.46%), Postives = 89/119 (74.79%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAA----------SMKNQKLSASNAIAQF 327
            RY + +IYTYSGLFCV +NPYK LP+Y+ + +  Y+G+KR E PPHI++I+D AY+ ML DRE+QSIL TGESGAGKT NTK+VIQY AS+AA          ++++Q +SA+ A+  F
Sbjct:  106 RYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKRDTSKGTLEDQIVSANPALEAF 224          
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 3.836e-39
Identity = 65/119 (54.62%), Postives = 89/119 (74.79%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAA----------SMKNQKLSASNAIAQF 327
            RY + +IYTYSGLFCV +NPYK LP+Y+ + +  Y+G+KR E PPHI++I+D AY+ ML DRE+QS+L TGESGAGKT NTK+VIQY AS+AA          ++++Q +SA+ A+  F
Sbjct:  106 RYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAGTKRDASKGTLEDQIVSANPALEAF 224          
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003821.1 (pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 gene:ENSPMAG00000003267.1 transcript:ENSPMAT00000003821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 4.464e-38
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAA 279
            RY + +IYTYSGLFCV +NPYK LP+Y+  ++  Y+G+KR E PPHI++I+D AY+ ML DRE+QSIL TGESGAGKT NTK+VIQY A++AA
Sbjct:  106 RYAAWMIYTYSGLFCVTINPYKWLPVYDPIVVAGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAA 198          
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 114.005 bits (284), Expect = 2.453e-31
Identity = 56/105 (53.33%), Postives = 72/105 (68.57%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGR-----------KRHER-PPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAA 279
            RY   LIYTYSGLF V +NPY  L +Y+++ I  Y  +             HE+ PPHI+AIA+ AY N+L + +DQSIL TGESGAGKTENTKK++QYLAS+ +
Sbjct:   98 RYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITS 202          
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 98.2117 bits (243), Expect = 8.248e-26
Identity = 42/94 (44.68%), Postives = 68/94 (72.34%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            R+ +G+IYTY G   + +NP++ L IY + ++E YKG+ R E PPH++AIA++ Y N+    E+Q ++ +GESGAGKTE  K+++QY+A+ + S
Sbjct:   59 RFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNS 152          
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 97.4413 bits (241), Expect = 1.609e-25
Identity = 41/94 (43.62%), Postives = 66/94 (70.21%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            R+ +  IYTY G   + +NP++ L IY D ++  YKG+ R E PPH++AIA++ Y NM    E+Q ++ +GESGAGKTE  K+++QY+A+ +++
Sbjct:   59 RFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASST 152          
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 91.6633 bits (226), Expect = 1.755e-23
Identity = 48/121 (39.67%), Postives = 74/121 (61.16%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLP-IYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLAS------------VAASMKNQKLSASNAIAQ 324
            RY    IYTYSG+  +  NP+ R+  +Y  ++I+ Y G++R E  PH++AIA+ AYR M  D+++Q+I+ +GESGAGKT + K +++Y AS            V  S   QK+ A+N I +
Sbjct:   93 RYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIME 213          
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 91.2781 bits (225), Expect = 2.509e-23
Identity = 40/95 (42.11%), Postives = 68/95 (71.58%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLP-IYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAAS 282
            RY +G IYTYSG+  +  NP+ ++  +Y+ E+I+ Y  +++ E  PH++AIA+ AYR M+ ++ +Q+++ +GESGAGKT + K +++Y ASV  S
Sbjct:   94 RYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQES 188          
BLAST of Myosin head vs. Ensembl Nematostella
Match: MYHC-ST (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG0])

HSP 1 Score: 152.91 bits (385), Expect = 1.592e-45
Identity = 67/95 (70.53%), Postives = 82/95 (86.32%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASM 285
            RYFSGLIYTYSGLFCV +NPY+RLPIY D+I+  Y+G+++ E PPH++ I D AY+NMLQDRE+QS+L TGESGAGKTENTKKVIQYLA V+  +
Sbjct:  103 RYFSGLIYTYSGLFCVAINPYRRLPIYTDKIVFAYRGKRKTEAPPHVFCICDNAYQNMLQDRENQSMLITGESGAGKTENTKKVIQYLAHVSGGI 197          
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO27673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8L2])

HSP 1 Score: 103.605 bits (257), Expect = 1.222e-27
Identity = 48/91 (52.75%), Postives = 66/91 (72.53%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASV 273
            RY+   IYTY+G   V +NPY+  PIY+ E I  YKG+K  + PPHI+AIAD AY  M ++  DQ ++ +GESGAGKTE+TK ++QYLA++
Sbjct:   30 RYYKHQIYTYTGSILVAVNPYQLYPIYDAEYIAKYKGKKLGDLPPHIFAIADNAYTFMKRELHDQCVIISGESGAGKTESTKLILQYLAAM 120          
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 103.99 bits (258), Expect = 2.622e-27
Identity = 52/113 (46.02%), Postives = 73/113 (64.60%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKN-----QKLSASNAIAQ 324
            RY +  IYTY G   V +NPY++ P+Y  E+I  Y+ R  +E PPHIYAIAD AYR+M    +DQ I+ TGESG+GKTE +K ++QY+A+V    +      ++L  SN I +
Sbjct:   44 RYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVDRVKEQLLQSNPILE 156          
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO45835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW9])

HSP 1 Score: 98.9821 bits (245), Expect = 1.295e-25
Identity = 51/115 (44.35%), Postives = 74/115 (64.35%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK-------LSASNAIAQ 324
            R+    IYTY G   V +NPYK L IY D+ I+ YK R+ +ERPPHI+A+AD +YR M +  ED  I+ +GESG+GKTE +K +++Y+A++    K ++       L  SNAI +
Sbjct:   32 RFHKERIYTYIGEVVVSVNPYKTLDIYGDDKIQEYKMREMYERPPHIFALADASYRAMKRRSEDTCIMISGESGSGKTEASKIIMRYIAAITNLSKQKEIERVKDILLKSNAILE 146          
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 94.7449 bits (234), Expect = 4.233e-24
Identity = 45/109 (41.28%), Postives = 74/109 (67.89%), Query Frame = 1
Query:   10 SGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASV-AASMKNQ---KLSASNAIAQ 324
            S  IYTY G+  V +NPY+ LP+Y  +I+  Y+GR   +  PHI+A+A+ A+++M++D  +QS++ +GESGAGKT + K  ++Y ++V  AS + Q   K+ A+N I +
Sbjct:   82 SNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQIEKKVIATNPIME 190          
BLAST of Myosin head vs. Ensembl Medaka
Match: ENSORLT00000027221.1 (pep primary_assembly:ASM223467v1:8:1035349:1037376:1 gene:ENSORLG00000024767.1 transcript:ENSORLT00000027221.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 1.839e-57
Identity = 81/99 (81.82%), Postives = 90/99 (90.91%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RYFS LIYTYSGLFCVV+NPYK LPIY+++IIE YKG+KRHE PPHIY+I D AYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLA +A+S K +K
Sbjct:  105 RYFSSLIYTYSGLFCVVVNPYKMLPIYSEKIIEMYKGKKRHEVPPHIYSITDNAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLAVIASSHKPKK 203          
BLAST of Myosin head vs. Ensembl Medaka
Match: ENSORLT00000030436.1 (pep primary_assembly:ASM223467v1:1:2801292:2804693:1 gene:ENSORLG00000022891.1 transcript:ENSORLT00000030436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 1.248e-56
Identity = 80/99 (80.81%), Postives = 92/99 (92.93%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+  YKG+KRHE PPHIYAI D+AYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K++K
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKHLPIYSEEIVNMYKGKKRHEMPPHIYAITDSAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSFKSKK 200          
BLAST of Myosin head vs. Ensembl Medaka
Match: ENSORLT00000000812.2 (pep primary_assembly:ASM223467v1:1:2915408:2941664:-1 gene:ENSORLG00000025127.1 transcript:ENSORLT00000000812.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 6.750e-56
Identity = 81/99 (81.82%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY+D IIE Y+G+KRHE PPHIYAI+++AYR MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKNLPIYSDNIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK 200          
BLAST of Myosin head vs. Ensembl Medaka
Match: ENSORLT00000018832.2 (pep primary_assembly:ASM223467v1:8:20496780:20537749:1 gene:ENSORLG00000015025.2 transcript:ENSORLT00000018832.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 4.798e-55
Identity = 80/99 (80.81%), Postives = 91/99 (91.92%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQK 297
            RY+SGLIYTYSGLFCVV+NPYK LPIY++ IIE Y+G+KRHE PPHIYAI+++AYR MLQDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K
Sbjct:  108 RYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRK 206          
BLAST of Myosin head vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 180.259 bits (456), Expect = 1.225e-53
Identity = 83/108 (76.85%), Postives = 97/108 (89.81%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQ 324
            RY+SGLIYTYSGLFCVV+NPYK LPIY++EI+E YKG+KRHE PPHIYAI DTAYR+M+QDREDQSILCTGESGAGKTENTKKVIQYLA VA+S K +K  +S+ ++ 
Sbjct:  102 RYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKKDQSSSILSH 209          
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 231.491 bits (589), Expect = 1.163e-71
Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH
Sbjct:  110 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 219          
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 231.491 bits (589), Expect = 1.163e-71
Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH
Sbjct:  110 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 219          
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 231.491 bits (589), Expect = 1.269e-71
Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH
Sbjct:  110 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 219          
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 231.491 bits (589), Expect = 1.269e-71
Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH
Sbjct:  110 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 219          
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000062420.1 (SMESG000062420.1)

HSP 1 Score: 202.601 bits (514), Expect = 1.322e-61
Identity = 92/110 (83.64%), Postives = 103/110 (93.64%), Query Frame = 1
Query:    1 RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFH 330
            RYFS LIYTYSGLFCVV+NPYKRLPIY + +IEWYKGRKRHERPPHIYA+ D AYRNMLQD+E+QSILCTGESGAGKTENTKKVIQYLASVA S+KNQK +ASNA++QF+
Sbjct:  105 RYFSDLIYTYSGLFCVVVNPYKRLPIYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFY 214          
The following BLAST results are available for this feature:
BLAST of Myosin head vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH91.286e-5882.83myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH115.381e-5583.84myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH141.685e-5377.78myosin heavy chain 14 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH99.237e-5382.83myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH111.068e-5283.84myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Myosin head vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmy-17.116e-5276.70Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
nmy-24.446e-4673.79Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5... [more]
myo-58.698e-4167.74MYOsin heavy chain structural genes [Source:UniPr... [more]
myo-63.816e-4057.27MYOsin heavy chain structural genes [Source:UniPr... [more]
myo-14.985e-4067.71Myosin-1 [Source:UniProtKB/Swiss-Prot;Acc:P02567][more]
back to top
BLAST of Myosin head vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zip5.933e-4981.91gene:FBgn0265434 transcript:FBtr0302572[more]
zip5.933e-4981.91gene:FBgn0265434 transcript:FBtr0302574[more]
zip5.933e-4981.91gene:FBgn0265434 transcript:FBtr0100466[more]
zip5.936e-4981.91gene:FBgn0265434 transcript:FBtr0072398[more]
zip6.228e-4981.91gene:FBgn0265434 transcript:FBtr0302573[more]
back to top
BLAST of Myosin head vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh11b2.720e-5879.61myosin, heavy chain 11b, smooth muscle [Source:ZFI... [more]
myh9a2.338e-5782.83myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh9a2.175e-5478.50myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh9b9.376e-5475.93myosin, heavy chain 9b, non-muscle [Source:ZFIN;Ac... [more]
myh9a1.766e-5377.78myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
back to top
BLAST of Myosin head vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH115.257e-5384.85myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
MYH115.736e-5384.85myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
MYH115.737e-5384.85myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
MYH115.737e-5384.85myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
MYH115.738e-5384.85myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
back to top
BLAST of Myosin head vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh107.659e-5680.81myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh94.881e-5382.83myosin, heavy polypeptide 9, non-muscle [Source:MG... [more]
Myh115.927e-5382.35myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
Myh116.040e-5382.35myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
Myh116.043e-5382.35myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
back to top
BLAST of Myosin head vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10587|MYH11_CHICK2.207e-5284.85Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 PE=1 S... [more]
sp|P14105|MYH9_CHICK3.039e-5282.83Myosin-9 OS=Gallus gallus OX=9031 GN=MYH9 PE=2 SV=... [more]
sp|P35748|MYH11_RABIT3.069e-5283.84Myosin-11 OS=Oryctolagus cuniculus OX=9986 GN=MYH1... [more]
sp|Q8VDD5|MYH9_MOUSE3.414e-5282.83Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=... [more]
sp|P35579|MYH9_HUMAN4.436e-5282.83Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4[more]
back to top
BLAST of Myosin head vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CJH55.282e-6886.36Myosin head OS=Fasciola hepatica OX=6192 GN=D915_0... [more]
A0A4S2M5692.828e-6684.55Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A0R3SZA81.220e-6584.55Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3P7NPR81.073e-6385.45Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A564Y9128.079e-6380.91Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
back to top
BLAST of Myosin head vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh103.255e-5580.81myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh104.856e-5580.81myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh9a1.031e-5383.84myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myh9b1.202e-5281.82myosin, heavy chain 9b, non-muscle [Source:ZFIN;Ac... [more]
myh11a5.962e-5275.93myosin-11-like [Source:NCBI gene;Acc:103025732][more]
back to top
BLAST of Myosin head vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh102.309e-5482.83myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
ENSPMAT00000005905.11.814e-3964.52pep scaffold:Pmarinus_7.0:GL476612:176223:319014:-... [more]
ENSPMAT00000005582.11.888e-3955.46pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 ... [more]
ENSPMAT00000002731.13.836e-3954.62pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
ENSPMAT00000003821.14.464e-3864.52pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 g... [more]
back to top
BLAST of Myosin head vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO12.453e-3153.33Type II myosin heavy chain; required for wild-type... [more]
MYO38.248e-2644.68One of two type I myosins; localizes to actin cort... [more]
MYO51.609e-2543.62One of two type I myosin motors; contains proline-... [more]
MYO21.755e-2339.67Type V myosin motor involved in actin-based transp... [more]
MYO42.509e-2342.11Type V myosin motor involved in actin-based transp... [more]
back to top
BLAST of Myosin head vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MYHC-ST1.592e-4570.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276731.222e-2752.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495152.622e-2746.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458351.295e-2544.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418194.233e-2441.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin head vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027221.11.839e-5781.82pep primary_assembly:ASM223467v1:8:1035349:1037376... [more]
ENSORLT00000030436.11.248e-5680.81pep primary_assembly:ASM223467v1:1:2801292:2804693... [more]
ENSORLT00000000812.26.750e-5681.82pep primary_assembly:ASM223467v1:1:2915408:2941664... [more]
ENSORLT00000018832.24.798e-5580.81pep primary_assembly:ASM223467v1:8:20496780:205377... [more]
myh9b1.225e-5376.85myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
back to top
BLAST of Myosin head vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049494.11.163e-71100.00SMESG000049494.1[more]
SMESG000049494.11.163e-71100.00SMESG000049494.1[more]
SMESG000049494.11.269e-71100.00SMESG000049494.1[more]
SMESG000049494.11.269e-71100.00SMESG000049494.1[more]
SMESG000062420.11.322e-6183.64SMESG000062420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001196 ID=SMED30001196|Name=Myosin head|organism=Schmidtea mediterranea sexual|type=transcript|length=330bp
AGATACTTCAGTGGATTAATTTATACTTATTCTGGGTTGTTCTGTGTGGT
ATTAAATCCTTACAAAAGACTTCCGATTTACAATGATGAAATAATCGAAT
GGTATAAAGGACGAAAACGTCACGAAAGACCACCTCACATATATGCAATC
GCAGATACCGCCTACAGAAACATGCTACAAGACAGAGAAGATCAATCAAT
TCTTTGCACCGGTGAATCTGGAGCTGGTAAAACGGAAAATACGAAAAAAG
TAATCCAATATCTAGCCTCGGTTGCAGCAAGTATGAAAAATCAGAAACTC
TCCGCCTCAAATGCAATCGCTCAATTCCAT
back to top

protein sequence of SMED30001196-orf-1

>SMED30001196-orf-1 ID=SMED30001196-orf-1|Name=SMED30001196-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
RYFSGLIYTYSGLFCVVLNPYKRLPIYNDEIIEWYKGRKRHERPPHIYAI
ADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKL
SASNAIAQFH
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001609Myosin_head_motor_dom
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0000166nucleotide binding
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 8..27
score: 65.04
coord: 64..89
score: 72.15
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 1..99
e-value: 6.7E-48
score: 163.4
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 1..110
score: 49.774
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..99
e-value: 5.4E-50
score: 172.2
NoneNo IPR availablePANTHERPTHR45615:SF31MYOSIN-14coord: 1..99
NoneNo IPR availablePANTHERPTHR45615FAMILY NOT NAMEDcoord: 1..99
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..97