da protein

Overview
Nameda protein (AGZ94908.1)
Smed IDSMED30001195
Length (bp)3373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of da protein (SMED30001195) t-SNE clustered cells

Violin plots show distribution of expression levels for da protein (SMED30001195) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of da protein (SMED30001195) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for da protein (SMED30001195) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001195

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30001195SMESG000032044.1 KF487093smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx musculatureSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30001195SMESG000032044.1 dd_Smed_v4_5579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of da protein vs. Ensembl Human
Match: TCF12 (transcription factor 12 [Source:HGNC Symbol;Acc:HGNC:11623])

HSP 1 Score: 152.14 bits (383), Expect = 7.764e-40
Identity = 72/91 (79.12%), Postives = 77/91 (84.62%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            D D  PEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:  197 DEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 287          
BLAST of da protein vs. Ensembl Human
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 154.836 bits (390), Expect = 1.366e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  334 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 434          
BLAST of da protein vs. Ensembl Human
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 154.836 bits (390), Expect = 1.542e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  338 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 438          
BLAST of da protein vs. Ensembl Human
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 155.992 bits (393), Expect = 1.569e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  390 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 490          
BLAST of da protein vs. Ensembl Human
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 155.992 bits (393), Expect = 1.997e-39
Identity = 76/104 (73.08%), Postives = 81/104 (77.88%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP 2037
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK    P  + L  P
Sbjct:  394 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGP 497          
BLAST of da protein vs. Ensembl Celegans
Match: hlh-2 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:G5EEG9])

HSP 1 Score: 102.064 bits (253), Expect = 1.414e-22
Identity = 50/78 (64.10%), Postives = 61/78 (78.21%), Query Frame = 1
Query: 1759 REKSRRQANNARERVRVRDINDAFKELGRMCMMHLKH-DRPQTKLTILQQAVNVITSLEQQVRERNLNPK-QACLKRR 1986
            ++  RR  NNARERVRVRDIN AFKELGRMC  H ++ +R QTKL IL  AV+VIT LE+QVR+RN+NPK  A +KR+
Sbjct:  299 KDTDRRSQNNARERVRVRDINSAFKELGRMCTQHNQNTERNQTKLGILHNAVSVITQLEEQVRQRNMNPKVMAGMKRK 376          
BLAST of da protein vs. Ensembl Fly
Match: da (gene:FBgn0267821 transcript:FBtr0332196)

HSP 1 Score: 159.073 bits (401), Expect = 9.527e-40
Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMP 2013
            D D  P  K +REK RRQANNARER+R+RDIN+A KELGRMCM HLK D+PQTKL IL  AV VI +LEQQVRERNLNPK ACLKRREEEK+ED P
Sbjct:  540 DDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGP 635          
BLAST of da protein vs. Ensembl Fly
Match: da (gene:FBgn0267821 transcript:FBtr0080008)

HSP 1 Score: 159.073 bits (401), Expect = 9.527e-40
Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMP 2013
            D D  P  K +REK RRQANNARER+R+RDIN+A KELGRMCM HLK D+PQTKL IL  AV VI +LEQQVRERNLNPK ACLKRREEEK+ED P
Sbjct:  540 DDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGP 635          
BLAST of da protein vs. Ensembl Fly
Match: da (gene:FBgn0267821 transcript:FBtr0332195)

HSP 1 Score: 159.073 bits (401), Expect = 9.527e-40
Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMP 2013
            D D  P  K +REK RRQANNARER+R+RDIN+A KELGRMCM HLK D+PQTKL IL  AV VI +LEQQVRERNLNPK ACLKRREEEK+ED P
Sbjct:  540 DDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGP 635          
BLAST of da protein vs. Ensembl Fly
Match: da (gene:FBgn0267821 transcript:FBtr0474232)

HSP 1 Score: 157.918 bits (398), Expect = 3.205e-39
Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMP 2013
            D D  P  K +REK RRQANNARER+R+RDIN+A KELGRMCM HLK D+PQTKL IL  AV VI +LEQQVRERNLNPK ACLKRREEEK+ED P
Sbjct:  540 DDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGP 635          
BLAST of da protein vs. Ensembl Zebrafish
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 159.844 bits (403), Expect = 3.912e-41
Identity = 84/128 (65.62%), Postives = 91/128 (71.09%), Query Frame = 1
Query: 1666 HKRRADNSTESICDDSE-------GTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            H R   N  +S  DDS           D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +
Sbjct:  348 HNRDNRNGDDSNGDDSTVVNNSSPANDDEDLTPEQKLEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGAPLSL 475          
BLAST of da protein vs. Ensembl Zebrafish
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 156.377 bits (394), Expect = 1.221e-40
Identity = 76/99 (76.77%), Postives = 82/99 (82.83%), Query Frame = 1
Query: 1732 DETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +
Sbjct:  294 DLTPEQKLEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGAPLSL 392          
BLAST of da protein vs. Ensembl Zebrafish
Match: tcf12 (transcription factor 12 [Source:ZFIN;Acc:ZDB-GENE-040516-11])

HSP 1 Score: 151.369 bits (381), Expect = 1.456e-40
Identity = 71/91 (78.02%), Postives = 77/91 (84.62%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            D D  PEQK  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:  158 DEDLNPEQKAERERERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 248          
BLAST of da protein vs. Ensembl Zebrafish
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 157.532 bits (397), Expect = 1.685e-40
Identity = 76/99 (76.77%), Postives = 82/99 (82.83%), Query Frame = 1
Query: 1732 DETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +
Sbjct:  347 DLTPEQKLEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGAPLSL 445          
BLAST of da protein vs. Ensembl Zebrafish
Match: TCF4 (transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11634])

HSP 1 Score: 157.532 bits (397), Expect = 3.529e-40
Identity = 76/99 (76.77%), Postives = 82/99 (82.83%), Query Frame = 1
Query: 1732 DETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +
Sbjct:  396 DLTPEQKLEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGAPLSL 494          
BLAST of da protein vs. Ensembl Xenopus
Match: tcf4 (transcription factor 4 [Source:NCBI gene;Acc:100124777])

HSP 1 Score: 159.073 bits (401), Expect = 6.440e-40
Identity = 81/125 (64.80%), Postives = 93/125 (74.40%), Query Frame = 1
Query: 1663 PHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP 2037
            P++  A++ TES   +++   D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK    P  + L  P
Sbjct:  469 PYRDLAESRTESWIHNND---DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDPSPLSLAGP 590          
BLAST of da protein vs. Ensembl Xenopus
Match: tcf4 (transcription factor 4 [Source:NCBI gene;Acc:100124777])

HSP 1 Score: 155.606 bits (392), Expect = 1.757e-39
Identity = 76/104 (73.08%), Postives = 81/104 (77.88%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP 2037
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK    P  + L  P
Sbjct:  387 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDPSPLSLAGP 490          
BLAST of da protein vs. Ensembl Xenopus
Match: tcf4 (transcription factor 4 [Source:NCBI gene;Acc:100124777])

HSP 1 Score: 155.221 bits (391), Expect = 7.157e-39
Identity = 76/104 (73.08%), Postives = 81/104 (77.88%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP 2037
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK    P  + L  P
Sbjct:  452 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDPSPLSLAGP 555          
BLAST of da protein vs. Ensembl Xenopus
Match: cnnm4 (cyclin and CBS domain divalent metal cation transport mediator 4 [Source:Xenbase;Acc:XB-GENE-999369])

HSP 1 Score: 152.525 bits (384), Expect = 9.333e-39
Identity = 71/91 (78.02%), Postives = 77/91 (84.62%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            D D  PEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI +LEQQVRERNLNPK ACLKRREEEK
Sbjct:  338 DEDLNPEQKLEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILNLEQQVRERNLNPKAACLKRREEEK 428          
BLAST of da protein vs. Ensembl Xenopus
Match: tcf3 (transcription factor 3 [Source:NCBI gene;Acc:100101779])

HSP 1 Score: 155.221 bits (391), Expect = 1.064e-38
Identity = 115/322 (35.71%), Postives = 160/322 (49.69%), Query Frame = 1
Query: 1159 MVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTM-RATYTDLSSG--TNLLSSASQ--MFPGETDLSNLSSAPNM-GPNVCISTLPQTMPLDTSLGVTNSSLPSDHXXXXXXXXXXXXXXXXXXXXXXRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIA 2106
            + P ++ ++  L   M+  L   IH++++H      +L    G  ++ ++  AT + L SG    +LS A++  M    T+ + L SA NM    V +   P ++P  T    + S LP                         RA       ++   +    +N S    +    K      + +  +D E   D +  PEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HL  ++PQTKL IL QAV+VI SLEQQVRERNLNPK ACLKRREEEK   +   +GL+           GGH  +  S N + 
Sbjct:  318 LSPSYDGTLHTLQNKMEDRLDEAIHVLRSHAVGQTGSL--PGGHEDIHSLLSATASVLGSGFPAAVLSLANRHSMLNSHTEEA-LPSASNMLHSQVTVPAQPGSLPDLTRPQDSYSGLPG----------------------LGRAVPPGRAPEIKRESKEDEENRSVGDLSDDEKKESKTQRSRTRYEDEE---DDNLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILSLEQQVRERNLNPKAACLKRREEEKVSGVDPQMGLS-----------GGHPGVGDSHNPVG 600          
BLAST of da protein vs. Ensembl Mouse
Match: Tcf4 (transcription factor 4 [Source:MGI Symbol;Acc:MGI:98506])

HSP 1 Score: 156.377 bits (394), Expect = 7.713e-40
Identity = 77/99 (77.78%), Postives = 81/99 (81.82%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPL 2016
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL
Sbjct:  390 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPL 488          
BLAST of da protein vs. Ensembl Mouse
Match: Tcf4 (transcription factor 4 [Source:MGI Symbol;Acc:MGI:98506])

HSP 1 Score: 156.377 bits (394), Expect = 1.019e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  394 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 494          
BLAST of da protein vs. Ensembl Mouse
Match: Tcf4 (transcription factor 4 [Source:MGI Symbol;Acc:MGI:98506])

HSP 1 Score: 156.377 bits (394), Expect = 1.351e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  420 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 520          
BLAST of da protein vs. Ensembl Mouse
Match: Tcf4 (transcription factor 4 [Source:MGI Symbol;Acc:MGI:98506])

HSP 1 Score: 156.377 bits (394), Expect = 1.351e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  420 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 520          
BLAST of da protein vs. Ensembl Mouse
Match: Tcf4 (transcription factor 4 [Source:MGI Symbol;Acc:MGI:98506])

HSP 1 Score: 156.377 bits (394), Expect = 1.351e-39
Identity = 77/101 (76.24%), Postives = 82/101 (81.19%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGV 2022
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  SE  PL +
Sbjct:  420 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL 520          
BLAST of da protein vs. UniProt/SwissProt
Match: sp|Q28772|HTF4_PAPHA (Transcription factor 12 (Fragment) OS=Papio hamadryas OX=9557 GN=TCF12 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.055e-39
Identity = 72/91 (79.12%), Postives = 77/91 (84.62%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            D D  PEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:   41 DEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 131          
BLAST of da protein vs. UniProt/SwissProt
Match: sp|Q91605|HTF4_XENLA (Transcription factor XE1.1 (Fragment) OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 3.382e-39
Identity = 71/91 (78.02%), Postives = 77/91 (84.62%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            D D  PEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI +LEQQVRERNLNPK ACLKRREEEK
Sbjct:   33 DEDLNPEQKVEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILNLEQQVRERNLNPKAACLKRREEEK 123          
BLAST of da protein vs. UniProt/SwissProt
Match: sp|P11420|DA_DROME (Protein daughterless OS=Drosophila melanogaster OX=7227 GN=da PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 9.550e-39
Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMP 2013
            D D  P  K +REK RRQANNARER+R+RDIN+A KELGRMCM HLK D+PQTKL IL  AV VI +LEQQVRERNLNPK ACLKRREEEK+ED P
Sbjct:  540 DDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGP 635          
BLAST of da protein vs. UniProt/SwissProt
Match: sp|Q60420|HTF4_MESAU (Transcription factor 12 (Fragment) OS=Mesocricetus auratus OX=10036 GN=TCF12 PE=2 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 1.718e-38
Identity = 72/91 (79.12%), Postives = 77/91 (84.62%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            D D  PEQK  REK RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:  318 DEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 408          
BLAST of da protein vs. UniProt/SwissProt
Match: sp|Q62655|ITF2_RAT (Transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Tcf4 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 2.470e-38
Identity = 76/104 (73.08%), Postives = 81/104 (77.88%), Query Frame = 1
Query: 1726 DPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP 2037
            D D TPEQK  REK RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK    P  + L  P
Sbjct:  472 DEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGP 575          
BLAST of da protein vs. TrEMBL
Match: U5YQB7 (Da protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=da PE=2 SV=1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 347/349 (99.43%), Postives = 349/349 (100.00%), Query Frame = 1
Query: 1672 RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGIXXXXXXXXXXFMRKIMSNRPESSNFXXXXXXXXXXXXXXXXXXXXXXXXXXXHSLKXXXXXXXXXXXXXXFPVSASRLKSEAIV 2718
            RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKS+SDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSH+WQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV
Sbjct:    1 RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSISDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHIWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV 349          
BLAST of da protein vs. TrEMBL
Match: A0A5J4NPP3 (BHLH domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0015258 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 3.891e-48
Identity = 105/168 (62.50%), Postives = 121/168 (72.02%), Query Frame = 1
Query: 1690 TESICD-DSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGA 2190
            T S+C  DSE TIDPDETPEQK  RE++RRQANNARER+RVRDINDAFKELGRMCMMHL  +R QTKLTILQQAV++ITSLEQQVRERNLNPKQACLKRREEEKSE    G       C     +LGG    + S   ++T    N  +    SSG+ +SN  A+ G+
Sbjct:  197 TPSLCGTDSEETIDPDETPEQKAERERNRRQANNARERIRVRDINDAFKELGRMCMMHLNSERQQTKLTILQQAVSLITSLEQQVRERNLNPKQACLKRREEEKSESHFGGNASQSRGC-----VLGGAASGTESGTHMSTGIGNNGFTG---SSGNALSNSTASMGS 356          
BLAST of da protein vs. TrEMBL
Match: A0A5K3FCJ5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 9.444e-48
Identity = 113/208 (54.33%), Postives = 131/208 (62.98%), Query Frame = 1
Query: 1696 SICDDSEG--TID--PDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQT 2307
            S+  DSEG  ++D   DETPEQK  REKSRRQANNARERVRVRDINDAFKELGRMCM+HLK++RPQTKLTILQQAV +ITSLEQQVRERNLNPKQACL+RREEEKSED     GL+   CS+        L + S    +    SL+S + +    G             +    +   MGSM   GYP  Y   P   SH W   +T
Sbjct:  111 SVGTDSEGANSLDGRDDETPEQKAEREKSRRQANNARERVRVRDINDAFKELGRMCMIHLKNERPQTKLTILQQAVTLITSLEQQVRERNLNPKQACLRRREEEKSED---AAGLH---CSSD---YTEKLPLESQTGQV----SLSSSAPAPYDHGM------------YQQSTYPPNMGSM---GYPTLYTTYPQPLSHDWSGQRT 290          
BLAST of da protein vs. TrEMBL
Match: A0A183K8J6 (BHLH domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS11325 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 2.276e-47
Identity = 91/109 (83.49%), Postives = 100/109 (91.74%), Query Frame = 1
Query: 1690 TESICD-DSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMP 2013
            T S+C  DSE TIDPDETPEQ+  RE+SRRQANNARER+RVRDINDAFKELGRMCMMHL ++RPQTKLTILQQAV++ITSLEQQVRERNLNPKQACLKRREEEKS + P
Sbjct:  481 TPSVCGTDSEETIDPDETPEQRAERERSRRQANNARERIRVRDINDAFKELGRMCMMHLNNERPQTKLTILQQAVSLITSLEQQVRERNLNPKQACLKRREEEKSGEAP 589          
BLAST of da protein vs. TrEMBL
Match: A0A0R3UMD9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8908 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.653e-47
Identity = 90/108 (83.33%), Postives = 98/108 (90.74%), Query Frame = 1
Query: 1696 SICDDSEG--TID--PDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSED 2007
            S+  DSEG  ++D   DETPEQK  REKSRRQANNARERVRVRDINDAFKELGRMCM+HLK++RPQTKLTILQQAV +ITSLEQQVRERNLNPKQACL+RREEEKSED
Sbjct:   48 SVGTDSEGANSLDGRDDETPEQKAEREKSRRQANNARERVRVRDINDAFKELGRMCMIHLKNERPQTKLTILQQAVTLITSLEQQVRERNLNPKQACLRRREEEKSED 155          
BLAST of da protein vs. Ensembl Cavefish
Match: ENSAMXT00000038274.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000314.1:6662:9842:1 gene:ENSAMXG00000033082.1 transcript:ENSAMXT00000038274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 7.881e-41
Identity = 73/98 (74.49%), Postives = 79/98 (80.61%), Query Frame = 1
Query: 1705 DDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            DD     D D  PEQK  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:   30 DDISINEDEDLNPEQKAERERERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 127          
BLAST of da protein vs. Ensembl Cavefish
Match: TCF4 (transcription factor 4 [Source:NCBI gene;Acc:103029501])

HSP 1 Score: 156.762 bits (395), Expect = 2.363e-39
Identity = 86/157 (54.78%), Postives = 103/157 (65.61%), Query Frame = 1
Query: 1573 RAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHK----RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGVG 2025
            RA +     Q TS+ +S  ++      N Q  K    ++ D  ++ +        D D TPEQK  RE+ RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +G
Sbjct:  456 RALSSGLQGQSTSSVSSDIKSEDEGDENLQESKGLDSKKDDGDSKDLKAIESNNDDEDLTPEQKIERERERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGPPLSLG 612          
BLAST of da protein vs. Ensembl Cavefish
Match: TCF4 (transcription factor 4 [Source:NCBI gene;Acc:103029501])

HSP 1 Score: 157.147 bits (396), Expect = 3.034e-39
Identity = 86/157 (54.78%), Postives = 103/157 (65.61%), Query Frame = 1
Query: 1573 RAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHK----RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGVG 2025
            RA +     Q TS+ +S  ++      N Q  K    ++ D  ++ +        D D TPEQK  RE+ RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +G
Sbjct:  486 RALSSGLQGQSTSSVSSDIKSEDEGDENLQESKGLDSKKDDGDSKDLKAIESNNDDEDLTPEQKIERERERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGPPLSLG 642          
BLAST of da protein vs. Ensembl Cavefish
Match: TCF4 (transcription factor 4 [Source:NCBI gene;Acc:103029501])

HSP 1 Score: 156.762 bits (395), Expect = 3.192e-39
Identity = 86/157 (54.78%), Postives = 103/157 (65.61%), Query Frame = 1
Query: 1573 RAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHK----RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGVG 2025
            RA +     Q TS+ +S  ++      N Q  K    ++ D  ++ +        D D TPEQK  RE+ RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +G
Sbjct:  474 RALSSGLQGQSTSSVSSDIKSEDEGDENLQESKGLDSKKDDGDSKDLKAIESNNDDEDLTPEQKIERERERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGPPLSLG 630          
BLAST of da protein vs. Ensembl Cavefish
Match: TCF4 (transcription factor 4 [Source:NCBI gene;Acc:103029501])

HSP 1 Score: 157.147 bits (396), Expect = 3.227e-39
Identity = 86/157 (54.78%), Postives = 103/157 (65.61%), Query Frame = 1
Query: 1573 RAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHK----RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK--SEDMPLGVG 2025
            RA +     Q TS+ +S  ++      N Q  K    ++ D  ++ +        D D TPEQK  RE+ RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK  S+  PL +G
Sbjct:  498 RALSSGLQGQSTSSVSSDIKSEDEGDENLQESKGLDSKKDDGDSKDLKAIESNNDDEDLTPEQKIERERERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSDGPPLSLG 654          
BLAST of da protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001068.1 (pep scaffold:Pmarinus_7.0:GL476437:411121:438397:-1 gene:ENSPMAG00000000958.1 transcript:ENSPMAT00000001068.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 5.783e-42
Identity = 81/122 (66.39%), Postives = 89/122 (72.95%), Query Frame = 1
Query: 1711 SEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHL 2076
            S  T D D TPEQK  RE+ RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK   +P   G   P   +  PL  GH+
Sbjct:  163 SSSTEDEDLTPEQKAERERERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSGLPSEPGSGHPGMGD-TPL--GHM 281          
BLAST of da protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001067.1 (pep scaffold:Pmarinus_7.0:GL476437:411121:442191:-1 gene:ENSPMAG00000000958.1 transcript:ENSPMAT00000001067.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 6.107e-42
Identity = 81/122 (66.39%), Postives = 89/122 (72.95%), Query Frame = 1
Query: 1711 SEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHL 2076
            S  T D D TPEQK  RE+ RR ANNARER+RVRDIN+AFKELGRM  +HLK D+PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK   +P   G   P   +  PL  GH+
Sbjct:  205 SSSTEDEDLTPEQKAERERERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSGLPSEPGSGHPGMGD-TPL--GHM 323          
BLAST of da protein vs. Ensembl Nematostella
Match: EDO41030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L5])

HSP 1 Score: 123.635 bits (309), Expect = 5.040e-29
Identity = 63/110 (57.27%), Postives = 69/110 (62.73%), Query Frame = 1
Query: 1756 LREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDR---------------------------------PQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRR 1986
            +RE+ RR ANNARERVRVRDIN+AFKELGRMC MH+K D+                                 PQTKL IL QAV+VITSLE QVRERNLNPK ACLKRR
Sbjct:  460 VREQERRYANNARERVRVRDINEAFKELGRMCDMHMKGDKTSTNSKQTKERQAVAKARQKDWSLNDASYGSNVPQTKLVILHQAVSVITSLESQVRERNLNPKAACLKRR 569          
BLAST of da protein vs. Ensembl Medaka
Match: tcf3b (E2A1 transcription factor [Source:NCBI gene;Acc:100820722])

HSP 1 Score: 157.532 bits (397), Expect = 1.347e-39
Identity = 78/111 (70.27%), Postives = 85/111 (76.58%), Query Frame = 1
Query: 1741 PEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP-PCSNGVPLLGG 2070
            PE K  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HL HD+PQTKL IL QAVNVI +LEQQVRERNLNPK ACLKRREEEK      GVG   P   S G P +GG
Sbjct:  508 PEVKMERERERRVANNARERLRVRDINEAFKELGRMCQLHLSHDKPQTKLLILHQAVNVILNLEQQVRERNLNPKAACLKRREEEKVS----GVGAEAPMQLSGGHPSMGG 614          
BLAST of da protein vs. Ensembl Medaka
Match: tcf3b (E2A1 transcription factor [Source:NCBI gene;Acc:100820722])

HSP 1 Score: 157.147 bits (396), Expect = 1.729e-39
Identity = 78/111 (70.27%), Postives = 85/111 (76.58%), Query Frame = 1
Query: 1741 PEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMP-PCSNGVPLLGG 2070
            PE K  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HL HD+PQTKL IL QAVNVI +LEQQVRERNLNPK ACLKRREEEK      GVG   P   S G P +GG
Sbjct:  502 PEVKMERERERRVANNARERLRVRDINEAFKELGRMCQLHLSHDKPQTKLLILHQAVNVILNLEQQVRERNLNPKAACLKRREEEKVS----GVGAEAPMQLSGGHPSMGG 608          
BLAST of da protein vs. Ensembl Medaka
Match: tcf12 (transcription factor 12 [Source:NCBI gene;Acc:101162824])

HSP 1 Score: 154.836 bits (390), Expect = 2.085e-38
Identity = 72/93 (77.42%), Postives = 78/93 (83.87%), Query Frame = 1
Query: 1720 TIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            T D D  PEQK  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:  559 TEDEDLNPEQKAERERERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 651          
BLAST of da protein vs. Ensembl Medaka
Match: tcf12 (transcription factor 12 [Source:NCBI gene;Acc:101162824])

HSP 1 Score: 154.066 bits (388), Expect = 3.350e-38
Identity = 72/93 (77.42%), Postives = 78/93 (83.87%), Query Frame = 1
Query: 1720 TIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            T D D  PEQK  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:  564 TEDEDLNPEQKAERERERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 656          
BLAST of da protein vs. Ensembl Medaka
Match: tcf12 (transcription factor 12 [Source:NCBI gene;Acc:101162824])

HSP 1 Score: 154.066 bits (388), Expect = 3.656e-38
Identity = 72/93 (77.42%), Postives = 78/93 (83.87%), Query Frame = 1
Query: 1720 TIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEK 1998
            T D D  PEQK  RE+ RR ANNARER+RVRDIN+AFKELGRMC +HLK ++PQTKL IL QAV VI SLEQQVRERNLNPK ACLKRREEEK
Sbjct:  587 TEDEDLNPEQKAERERERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEK 679          
BLAST of da protein vs. Planmine SMEST
Match: SMESG000032044.1 (SMESG000032044.1)

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 604/604 (100.00%), Postives = 604/604 (100.00%), Query Frame = 1
Query:  907 ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHXXXXXXXXXXXXXXXXXXXXXXRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGIXXXXXXXXXXFMRKIMSNRPESSNFXXXXXXXXXXXXXXXXXXXXXXXXXXXHSLKXXXXXXXXXXXXXXFPVSASRLKSEAIV 2718
            ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSANSGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV
Sbjct:  173 ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSANSGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV 776          

HSP 2 Score: 120.553 bits (301), Expect = 1.942e-27
Identity = 58/64 (90.62%), Postives = 62/64 (96.88%), Query Frame = 2
Query:  704 RYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFELK 895
            + ++VYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFE +
Sbjct:  112 QKDKVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFESR 175          
BLAST of da protein vs. Planmine SMEST
Match: SMESG000032044.1 (SMESG000032044.1)

HSP 1 Score: 1063.14 bits (2748), Expect = 0.000e+0
Identity = 604/604 (100.00%), Postives = 604/604 (100.00%), Query Frame = 1
Query:  907 ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHXXXXXXXXXXXXXXXXXXXXXXRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGIXXXXXXXXXXFMRKIMSNRPESSNFXXXXXXXXXXXXXXXXXXXXXXXXXXXHSLKXXXXXXXXXXXXXXFPVSASRLKSEAIV 2718
            ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSANSGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV
Sbjct:   89 ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSANSGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV 692          

HSP 2 Score: 187.963 bits (476), Expect = 2.223e-49
Identity = 89/91 (97.80%), Postives = 90/91 (98.90%), Query Frame = 2
Query:  623 MLGMDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFELK 895
            MLGMDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFE +
Sbjct:    1 MLGMDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFESR 91          
BLAST of da protein vs. Planmine SMEST
Match: SMESG000032044.1 (SMESG000032044.1)

HSP 1 Score: 1063.14 bits (2748), Expect = 0.000e+0
Identity = 604/604 (100.00%), Postives = 604/604 (100.00%), Query Frame = 1
Query:  907 ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHXXXXXXXXXXXXXXXXXXXXXXRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGIXXXXXXXXXXFMRKIMSNRPESSNFXXXXXXXXXXXXXXXXXXXXXXXXXXXHSLKXXXXXXXXXXXXXXFPVSASRLKSEAIV 2718
            ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSANSGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV
Sbjct:   86 ESRPDMWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPTDYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQNTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMFPGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSANSGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHKRRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDINDAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQACLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSLNSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDPSSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYSHTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDSEEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIV 689          

HSP 2 Score: 181.415 bits (459), Expect = 3.170e-47
Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 2
Query:  632 MDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFELK 895
            MDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFE +
Sbjct:    1 MDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDLISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFESR 88          
The following BLAST results are available for this feature:
BLAST of da protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCF127.764e-4079.12transcription factor 12 [Source:HGNC Symbol;Acc:HG... [more]
TCF41.366e-3976.24transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
TCF41.542e-3976.24transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
TCF41.569e-3976.24transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
TCF41.997e-3973.08transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of da protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hlh-21.414e-2264.10Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of da protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
da9.527e-4075.00gene:FBgn0267821 transcript:FBtr0332196[more]
da9.527e-4075.00gene:FBgn0267821 transcript:FBtr0080008[more]
da9.527e-4075.00gene:FBgn0267821 transcript:FBtr0332195[more]
da3.205e-3975.00gene:FBgn0267821 transcript:FBtr0474232[more]
back to top
BLAST of da protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCF43.912e-4165.63transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
TCF41.221e-4076.77transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
tcf121.456e-4078.02transcription factor 12 [Source:ZFIN;Acc:ZDB-GENE-... [more]
TCF41.685e-4076.77transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
TCF43.529e-4076.77transcription factor 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of da protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcf46.440e-4064.80transcription factor 4 [Source:NCBI gene;Acc:10012... [more]
tcf41.757e-3973.08transcription factor 4 [Source:NCBI gene;Acc:10012... [more]
tcf47.157e-3973.08transcription factor 4 [Source:NCBI gene;Acc:10012... [more]
cnnm49.333e-3978.02cyclin and CBS domain divalent metal cation transp... [more]
tcf31.064e-3835.71transcription factor 3 [Source:NCBI gene;Acc:10010... [more]
back to top
BLAST of da protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcf47.713e-4077.78transcription factor 4 [Source:MGI Symbol;Acc:MGI:... [more]
Tcf41.019e-3976.24transcription factor 4 [Source:MGI Symbol;Acc:MGI:... [more]
Tcf41.351e-3976.24transcription factor 4 [Source:MGI Symbol;Acc:MGI:... [more]
Tcf41.351e-3976.24transcription factor 4 [Source:MGI Symbol;Acc:MGI:... [more]
Tcf41.351e-3976.24transcription factor 4 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of da protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28772|HTF4_PAPHA1.055e-3979.12Transcription factor 12 (Fragment) OS=Papio hamadr... [more]
sp|Q91605|HTF4_XENLA3.382e-3978.02Transcription factor XE1.1 (Fragment) OS=Xenopus l... [more]
sp|P11420|DA_DROME9.550e-3975.00Protein daughterless OS=Drosophila melanogaster OX... [more]
sp|Q60420|HTF4_MESAU1.718e-3879.12Transcription factor 12 (Fragment) OS=Mesocricetus... [more]
sp|Q62655|ITF2_RAT2.470e-3873.08Transcription factor 4 OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of da protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YQB70.000e+099.43Da protein (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A5J4NPP33.891e-4862.50BHLH domain-containing protein OS=Paragonimus west... [more]
A0A5K3FCJ59.444e-4854.33Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183K8J62.276e-4783.49BHLH domain-containing protein OS=Schistosoma cura... [more]
A0A0R3UMD92.653e-4783.33Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of da protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000038274.17.881e-4174.49pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
TCF42.363e-3954.78transcription factor 4 [Source:NCBI gene;Acc:10302... [more]
TCF43.034e-3954.78transcription factor 4 [Source:NCBI gene;Acc:10302... [more]
TCF43.192e-3954.78transcription factor 4 [Source:NCBI gene;Acc:10302... [more]
TCF43.227e-3954.78transcription factor 4 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of da protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001068.15.783e-4266.39pep scaffold:Pmarinus_7.0:GL476437:411121:438397:-... [more]
ENSPMAT00000001067.16.107e-4266.39pep scaffold:Pmarinus_7.0:GL476437:411121:442191:-... [more]
back to top
BLAST of da protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of da protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO410305.040e-2957.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of da protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcf3b1.347e-3970.27E2A1 transcription factor [Source:NCBI gene;Acc:10... [more]
tcf3b1.729e-3970.27E2A1 transcription factor [Source:NCBI gene;Acc:10... [more]
tcf122.085e-3877.42transcription factor 12 [Source:NCBI gene;Acc:1011... [more]
tcf123.350e-3877.42transcription factor 12 [Source:NCBI gene;Acc:1011... [more]
tcf123.656e-3877.42transcription factor 12 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of da protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032044.11.942e-27100.00SMESG000032044.1[more]
SMESG000032044.12.223e-49100.00SMESG000032044.1[more]
SMESG000032044.13.170e-47100.00SMESG000032044.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001195
GenBankAGZ94908.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001195 ID=SMED30001195|Name=da protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3373bp
ATTATTATTATTATTATTATTTTAATTAGTATCTCCATAGTTTAACAATG
GGTTCCCCAAAGATGATCTTAGTAAATATTTCTTATTGGTAATTTCTTAT
TATTATTATTTCAGTGATACAATCAGTTTCCTCAGATTTATTCTCAGTTT
CTCCACTGATTTTAAATGAGAATAAACTACCGGCTCTCTTTAGGGCCACA
ATTGATGACTGGACAAATAATTCGAATTGGTTGAAAATGTGTAAATGAGA
AGATTTTACTATTTGAAATAAATATAGGTTGTTGGCTACATTGTATATTT
TACGTGATATTTTTTATATTTCATTTACTTATATATATTACCACTATTTT
TTGTAAAAGGCAATTTAAAAAGTAATTTATTTTATATTAGTTAATGTTTC
TAATACAAATGTTAATTTTTTTTCAGAAAACTCTATTCAGAAACTTGCAT
CATGACGGTTTTCTTTAGACCCACCAGCGATAGTTGTTCAGAAATTATTA
TTATTACTACTACTACTACTATTATTATTATTATCTTCATCATCATCATT
GAAATTCCTTTTTTTGATTATATCCATTTCGAATATTTTGCGGAGAATTT
GTTTCTTATCAATAGTTTATTCATGTTGGGTATGGATGAAAACTATTTTG
AAAGTTGTAACCAGTTTCCGGATTCGAACAATCCCATGGATTATTTTCAA
ATTAGATACAATCAGGTATACTCTCCAAATAATACCGACCCTAGTGATTT
AATATCGTCTGATCCAACTTCATACACAAACACAAGCTCAATGGTGTATC
GTTTATCAGATATGAAGAACAATCAAATTCTACCATTGTCAAACGGTAAC
ACAGATTTATACGAACAATCAAATTATTTTCCATTTGAACTTAAGTTATT
GGAAACGAATCTCGACCAGATATGTGGAATCCTCAGTACAATTACAGTCA
TTCCCAAGCTACCACTGATGCTTTTAATCTCTACATGTGTCCCAATGGCC
CAGTCAGTGACTACAGAACGACATATTCATCTAATCCTTTGCTCAACAAT
CCTTCAGGTTACATGCCGACTGATTATTATCAACAGAAACTAAGCGCTAG
TGATCCAGTGGTAACATGCACTGCGTCGCTTGTTAGCATGAGTAACTGTG
CTAACGGCATGGTGCCTGGATTTGAAGCTTCGATTTCAAATTTAAGTCAG
CATATGGATTCGACTCTCCAGAATACTATCCATTTAATAAAGAATCATAT
GGATGCAGGAGTTGAAGCCCTTTATGATATAGCGGGTGCCAACAATTTAG
ACACGATGCGAGCCACTTATACCGATCTGAGTTCGGGTACAAATTTATTG
TCATCTGCAAGTCAAATGTTTCCTGGAGAAACAGATCTCTCTAATTTATC
ATCCGCTCCAAACATGGGTCCTAATGTGTGTATTAGTACATTACCACAGA
CTATGCCTCTAGATACAAGTCTCGGAGTAACAAATTCGTCTTTACCCAGT
GATCATTCATCTTCAGCTAATTCTGGTTCTTCAAACGGGAAATCGGGTTC
CTCTCAAAAAACCTCTGGAACTCGAGCTTTTAATCAAGTTTTCGGAAGTC
AAATGACGAGCAACGCCACTTCTAAATCACAAAATAATTCAACCGCACCT
CCAAATCCACAGCCTCATAAACGAAGAGCAGACAACAGCACAGAGAGTAT
TTGTGATGATTCTGAAGGAACCATTGATCCTGATGAGACCCCGGAACAGA
AACATTTGCGAGAAAAGTCCCGTCGCCAAGCAAATAATGCCAGGGAACGC
GTACGAGTTCGTGACATAAACGACGCCTTCAAGGAACTAGGACGCATGTG
CATGATGCATTTAAAGCATGACAGACCACAGACTAAATTGACGATTCTCC
AACAAGCTGTCAATGTCATTACTAGTCTTGAACAGCAAGTCAGAGAGCGC
AATTTAAATCCAAAACAAGCCTGTTTAAAACGCAGAGAAGAAGAAAAAAG
TGAAGACATGCCTTTGGGGGTCGGTTTAAATATGCCGCCATGTTCCAATG
GTGTCCCATTACTTGGTGGGCATTTGAAGATATCATCATCACAAAACGAC
ATAGCAACTAACTTCAGTCTCAATTCTAAGTCTATGTCGGATATTTCCTC
TGGCCACTGTATATCTAATCAGAAAGCAGCTCAAGGAGCTCCTTTTAGCC
TCGATGCTTTTCGGCACCAAATGGGTTCAATGGTATCATCAGGTTATCCA
GGTCAGTACCCTATTGATCCATCGTCTACATCACACATGTGGCAAACTTA
TCAGACAAATACAAAATTTCAAGATCAAATTAATCCCTCTTTATACTTGC
AAACTACTGATTCAGAGGCCAAAACTGGTCTCGATCCTGTGACTAGCACT
TCAAATTATCATCCTTACTCTCACACTACAGGCATTACTTCATCGATCAA
CGATTTTTTAGGTATTAGCAGTTCGGCTGTGTCCTTCTCCGACTCATTCA
TGAGAAAGATTATGTCTAACCGACCGGAATCAAGTAATTTCGATGCGGAA
AACGAAGATCCTAGTGATTCTGAAGAAGATGATGATGAAGAAGATAACAA
TGATCCACAACTAGATGATGACCATTCGCTCAAATCCTGTCAATCCCAGA
ATCATAACAGCAACAGTGAATCCTCATTTCCTGTTTCCGCCTCAAGACTG
AAATCAGAAGCAATAGTTAGCTCTTCCGATCCCAACTCTAACTCATAGAT
ATAATATCAATCAATATAAATGTGTATATTTATCCATTATCATTGATTTG
TTGTTGGATTATTGCTGTAAACATTACCGAAACTTTTTTTTCGTTTAAAA
GAAAACAATCCATTTAATGCTATTTTTGAGTGCTTTAAATTTTTGAATAT
CGATTTCCTTTGAGATGTGAATCTTGGGATTGTTTGGGTGCCGAGGAGCT
AATATTGTTACTGTTGCTGTTGACGTTCTTATTGTTGTTGTTATTGGTTG
ACGAGAATTTGTATATATTGTGTTTTAGTCCATCACATTTTATTGACTTG
CGGAAATGACAAAAATCGATTATATTTGTAAATAATATTTAATTTCGATT
TTAGAGTATCGGAGGAAATCGATATAAATAAATAATATATCTATTGATCA
CCACTAACTGCAATCGGGTGTTGGTAAAAAAAAATTTGGAAATTATTTGA
AATTCAAAATTACTTGTTTCACAATCTATATAATCAATTTTATGACAGTT
TTTGTTGATTTTTAATCGACAGATATGAAATCTATATATTTATATATCGA
TCCAATGTGTTTTTGATTTCTGTTTCTCAATGAGTTGCTGTTTGTTAGAG
TTGATAGAACGTGTGCAATTTAA
back to top

protein sequence of SMED30001195-orf-1

>SMED30001195-orf-1 ID=SMED30001195-orf-1|Name=SMED30001195-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=214bp
MTVFFRPTSDSCSEIIIITTTTTIIIIIFIIIIEIPFFDYIHFEYFAENL
FLINSLFMLGMDENYFESCNQFPDSNNPMDYFQIRYNQVYSPNNTDPSDL
ISSDPTSYTNTSSMVYRLSDMKNNQILPLSNGNTDLYEQSNYFPFELKLL
ETNLDQICGILSTITVIPKLPLMLLISTCVPMAQSVTTERHIHLILCSTI
LQVTCRLIIINRN*
back to top

protein sequence of SMED30001195-orf-2

>SMED30001195-orf-2 ID=SMED30001195-orf-2|Name=SMED30001195-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=609bp
MWNPQYNYSHSQATTDAFNLYMCPNGPVSDYRTTYSSNPLLNNPSGYMPT
DYYQQKLSASDPVVTCTASLVSMSNCANGMVPGFEASISNLSQHMDSTLQ
NTIHLIKNHMDAGVEALYDIAGANNLDTMRATYTDLSSGTNLLSSASQMF
PGETDLSNLSSAPNMGPNVCISTLPQTMPLDTSLGVTNSSLPSDHSSSAN
SGSSNGKSGSSQKTSGTRAFNQVFGSQMTSNATSKSQNNSTAPPNPQPHK
RRADNSTESICDDSEGTIDPDETPEQKHLREKSRRQANNARERVRVRDIN
DAFKELGRMCMMHLKHDRPQTKLTILQQAVNVITSLEQQVRERNLNPKQA
CLKRREEEKSEDMPLGVGLNMPPCSNGVPLLGGHLKISSSQNDIATNFSL
NSKSMSDISSGHCISNQKAAQGAPFSLDAFRHQMGSMVSSGYPGQYPIDP
SSTSHMWQTYQTNTKFQDQINPSLYLQTTDSEAKTGLDPVTSTSNYHPYS
HTTGITSSINDFLGISSSAVSFSDSFMRKIMSNRPESSNFDAENEDPSDS
EEDDDEEDNNDPQLDDDHSLKSCQSQNHNSNSESSFPVSASRLKSEAIVS
SSDPNSNS*
back to top
Aliases
The feature 'da protein' has the following synonyms
Synonym
da
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0000478pharynx musculature
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 289..342
e-value: 1.7E-12
score: 57.5
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 284..337
e-value: 6.9E-12
score: 45.1
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 283..336
score: 13.522
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 281..341
e-value: 5.27302E-13
score: 61.8463
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 270..350
e-value: 1.8E-35
score: 122.4
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 275..342
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..291
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 542..563
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 533..608
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 228..291
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 573..608
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 228..246
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 189..215
NoneNo IPR availablePANTHERPTHR11793BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTORcoord: 66..366