GCR121

Overview
NameGCR121
Smed IDSMED30001189
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR121 (SMED30001189) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR121 (SMED30001189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001189SMESG000032103.1 SMESG000032100.1 SmedASXL_078936SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30001189SMESG000032103.1 SMESG000032100.1 SmedASXL_031545SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR121 vs. Ensembl Human
Match: ADGRE2 (adhesion G protein-coupled receptor E2 [Source:HGNC Symbol;Acc:HGNC:3337])

HSP 1 Score: 58.151 bits (139), Expect = 1.746e-8
Identity = 62/251 (24.70%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  486 MALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LGIMQISILFDWKILNTISSAVNSCLGIFIGFVF-ICNGRIWRLYFKRRSALSKEKSTSQL 1229
            + L +S CL + +  FLV        + CS I    H+  L+ L WM+L A+   +    RN+      +S+N+F   L+F     + + +P V       +     P  YG    CWL      ++G  GP  A F ++L+  +V ++ +   +    SL    S  RNT+++   +     I G +  LGI+Q+      +++  + + +NS  G+FI  V+ + + ++   Y K    + K K+ S++
Sbjct:  429 LHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL--YLFLTARNLT-VVNYSSINRFMKKLMF----PVGYGVPAVTVAISAAS----RPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRL---SSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAA--RVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEM 663          
BLAST of GCR121 vs. Ensembl Human
Match: ADGRE2 (adhesion G protein-coupled receptor E2 [Source:HGNC Symbol;Acc:HGNC:3337])

HSP 1 Score: 57.7658 bits (138), Expect = 2.485e-8
Identity = 62/251 (24.70%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  486 MALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LGIMQISILFDWKILNTISSAVNSCLGIFIGFVF-ICNGRIWRLYFKRRSALSKEKSTSQL 1229
            + L +S CL + +  FLV        + CS I    H+  L+ L WM+L A+   +    RN+      +S+N+F   L+F     + + +P V       +     P  YG    CWL      ++G  GP  A F ++L+  +V ++ +   +    SL    S  RNT+++   +     I G +  LGI+Q+      +++  + + +NS  G+FI  V+ + + ++   Y K    + K K+ S++
Sbjct:  478 LHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL--YLFLTARNLT-VVNYSSINRFMKKLMF----PVGYGVPAVTVAISAAS----RPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRL---SSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAA--RVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEM 712          
BLAST of GCR121 vs. Ensembl Human
Match: ADGRE2 (adhesion G protein-coupled receptor E2 [Source:HGNC Symbol;Acc:HGNC:3337])

HSP 1 Score: 57.3806 bits (137), Expect = 3.081e-8
Identity = 62/251 (24.70%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  486 MALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LGIMQISILFDWKILNTISSAVNSCLGIFIGFVF-ICNGRIWRLYFKRRSALSKEKSTSQL 1229
            + L +S CL + +  FLV        + CS I    H+  L+ L WM+L A+   +    RN+      +S+N+F   L+F     + + +P V       +     P  YG    CWL      ++G  GP  A F ++L+  +V ++ +   +    SL    S  RNT+++   +     I G +  LGI+Q+      +++  + + +NS  G+FI  V+ + + ++   Y K    + K K+ S++
Sbjct:  522 LHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL--YLFLTARNLT-VVNYSSINRFMKKLMF----PVGYGVPAVTVAISAAS----RPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRL---SSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAA--RVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEM 756          
BLAST of GCR121 vs. Ensembl Human
Match: ADGRE2 (adhesion G protein-coupled receptor E2 [Source:HGNC Symbol;Acc:HGNC:3337])

HSP 1 Score: 56.9954 bits (136), Expect = 4.522e-8
Identity = 62/251 (24.70%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  486 MALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LGIMQISILFDWKILNTISSAVNSCLGIFIGFVF-ICNGRIWRLYFKRRSALSKEKSTSQL 1229
            + L +S CL + +  FLV        + CS I    H+  L+ L WM+L A+   +    RN+      +S+N+F   L+F     + + +P V       +     P  YG    CWL      ++G  GP  A F ++L+  +V ++ +   +    SL    S  RNT+++   +     I G +  LGI+Q+      +++  + + +NS  G+FI  V+ + + ++   Y K    + K K+ S++
Sbjct:  560 LHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL--YLFLTARNLT-VVNYSSINRFMKKLMF----PVGYGVPAVTVAISAAS----RPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRL---SSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAA--RVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEM 794          
BLAST of GCR121 vs. Ensembl Human
Match: ADGRE2 (adhesion G protein-coupled receptor E2 [Source:HGNC Symbol;Acc:HGNC:3337])

HSP 1 Score: 56.9954 bits (136), Expect = 4.545e-8
Identity = 62/251 (24.70%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  486 MALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LGIMQISILFDWKILNTISSAVNSCLGIFIGFVF-ICNGRIWRLYFKRRSALSKEKSTSQL 1229
            + L +S CL + +  FLV        + CS I    H+  L+ L WM+L A+   +    RN+      +S+N+F   L+F     + + +P V       +     P  YG    CWL      ++G  GP  A F ++L+  +V ++ +   +    SL    S  RNT+++   +     I G +  LGI+Q+      +++  + + +NS  G+FI  V+ + + ++   Y K    + K K+ S++
Sbjct:  513 LHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL--YLFLTARNLT-VVNYSSINRFMKKLMF----PVGYGVPAVTVAISAAS----RPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRL---SSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAA--RVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEM 747          
BLAST of GCR121 vs. UniProt/SwissProt
Match: sp|Q9UHX3|AGRE2_HUMAN (Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 2.690e-7
Identity = 62/251 (24.70%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  486 MALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LGIMQISILFDWKILNTISSAVNSCLGIFIGFVF-ICNGRIWRLYFKRRSALSKEKSTSQL 1229
            + L +S CL + +  FLV        + CS I    H+  L+ L WM+L A+   +    RN+      +S+N+F   L+F     + + +P V       +     P  YG    CWL      ++G  GP  A F ++L+  +V ++ +   +    SL    S  RNT+++   +     I G +  LGI+Q+      +++  + + +NS  G+FI  V+ + + ++   Y K    + K K+ S++
Sbjct:  571 LHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEAL--YLFLTARNLT-VVNYSSINRFMKKLMF----PVGYGVPAVTVAISAAS----RPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRL---SSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAA--RVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEM 805          
BLAST of GCR121 vs. TrEMBL
Match: A0A193KUT0 (GCR121 OS=Schmidtea mediterranea OX=79327 GN=gcr121 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.677e-19
Identity = 93/363 (25.62%), Postives = 163/363 (44.90%), Query Frame = 3
Query:  165 ISSNTS-NAQTCQTVIYQIITEGT-----TLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAF---SGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAV--RNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSKEKST 1220
            I +N S + Q CQ  IY I  E        L K     N  S   L    T++     C N   N   +S+  +++  + WI +IL P+SI+GL+ TI TY    +LR   G+    +S CLL+ Y  F  ++    S +  + C    ++ HFA L    W    A+++  T     RN ++R        +GI L ++SL         +I + C  +C   L V Y     CWL+  +SIL G+T PA+  F  +L      I+ +   ++ T  ++   S  +   LI+  ++KL V+ G++     ++I       +   + + +  GI +   F+   ++ +L+ ++ ++   + ST
Sbjct:  478 IENNRSFHPQNCQKYIYSIFKEDKISKELVLLKMRTELNGTSDEDLELDGTTLS-HFTCAN--MNLVLHSSTGRYATINAWINLILTPISIIGLICTIYTYLSFRILRNLSGICTTNLSICLLMNYLMFFTLSLMKESRAGLLGCRIGAVLNHFAALCVFSWSFCTAIEAHFTITKISRNSSNRNRILFTIGYGIPLGYISLC--------LIGYLCD-SCFGNLSVQYADSGMCWLAPGLSILLGMTIPALFCFLSTLAIFTFTIHSLLSILKETSQVS---SKYKQNYLIVTITVKLSVLLGLAWLFPSLNIWIGSAEFDIFCNILLASQGILVAICFLSTPKVRKLFRRKPTSFKTQSST 825          
BLAST of GCR121 vs. TrEMBL
Match: A0A3M6T4U7 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005188 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.368e-14
Identity = 78/303 (25.74%), Postives = 147/303 (48.51%), Query Frame = 3
Query:  345 RQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFAC---GYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTI---SSAVNSCLGIFIGFVFI----CNGRIWRLYFKRRSALSKEKSTS 1223
            R+N   S+ S A F IT   +  SI  L   ++ Y     L+  PG   +++S  LL+    FL    S  + + C  + ++ HF +LS   WM ++A D+A TF+++    RR  +   K     +F+   ++ + +P VI   C    +T  +   + YG +  CW+S + ++ F +  P  AT   +++     IY I+  +Q   ++ ++   NR+   + L  +KL  + G++  I++++   +WK  N +   S+ +NS  G FI   F+      G +   + KRR+ + K +++S
Sbjct: 1113 RKNEWYSE-SSALFLITFTGMLFSIFSLCLLLIVYVSFKDLKNLPGRCVISLSAALLLYQITFLSAKKSTEVDVLCKAVAILLHFFILSTFAWMSIMAFDAANTFSIKVTVRRRQPSDTRK-----IFIKYCIVGWGLPAVIVGLCSVLDHTGTFH--IGYGNLVYCWISDSKALTFAMVIPVSATLVFNIVCFTKNIYVIHH-LQMAANMAVS---NRSNASLTLICVKLTTVMGLTW-ILELAA--NWKQTNFLRYPSTVLNSLQGFFITLCFVTTKKVRGLVRERFSKRRNEVVKVQASS 1400          

HSP 2 Score: 69.3218 bits (168), Expect = 9.520e-9
Identity = 73/278 (26.26%), Postives = 123/278 (44.24%), Query Frame = 3
Query:  411 LSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVI-NFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWK---ILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKR---RSALSKEKSTS 1223
            LSIV L   +  Y     LR  PG   + +S  LL   + FL    S  + + C  + ++ HF  LS   WM ++A D+A TF        R  +   K     +F+   ++ + +P VI  F           V YG    CW+S N ++   +  P  A    ++I    ++Y I R +Q   +L  + S   +   ++L  IKL  + G++  I+Q++    W+    L   S+ +NS  G+FI   F+   ++  L+ +R   R + S E  T+
Sbjct:  455 LSIVSLCFLLAVYLSFKELRNLPGRCVINLSGALLCYQAFFLSAKKSTEVPILCQAVAILIHFFALSAFSWMAVMAFDTASTFTPTVADTSRQPSDTRK-----IFIKYCILGWGLPAVIVGFCIVLDLTGTFHVGYGNFLFCWISDNTALTVVMVTPVSAALIFNVICFAKSVYAI-RHLQQAAALAASNS---SKASLILICIKLTTVMGLTW-ILQLAA--KWRHTEFLQYPSAVLNSMQGLFITSCFVTTKKVRGLFKERFSNRRSRSVEPQTN 720          
BLAST of GCR121 vs. TrEMBL
Match: R7URJ0 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_216805 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.156e-11
Identity = 77/306 (25.16%), Postives = 140/306 (45.75%), Query Frame = 3
Query:  318 MCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSW---IVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVI-NFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSKEKSTS 1223
            +C N S+++ Q +   +FS A   ++VI   +SIV L   ++ YS+   LR   GL  +++S CLLI    FL   F+GS +   SW   I ++ H+  L+   WM ++A D   TF   +    R  + + KF    ++  L  ++  +  ++ NF  G +   + P  YG    CW+    +++     P       +L+   + ++ I +S++++   T  K  +R+        +KL  I G++     ++ +FD  +L  +    NS  G  I F F+   ++  L    R   SKE  + 
Sbjct:  426 ICTNFSKDYLQEAIDLKFSSAQTVVSVIGQVISIVCLSVHLLVYSMFRKLRNLAGLNIMSLSGCLLIAQLLFL---FAGSASASYSWCFSIGVLVHYFFLASFLWMNVMAFDICRTFVKFSKPSAR-DDFLQKFLRYCVYCFLVALLIVLSAIVANFTLGDS--LYRPA-YGE-DICWIKNRKALIVFFAAPVAVIVTSNLVYFFITLWSIQKSMEASKMATNNKKGDRDR---FWLYVKLSTIMGLTWVFGFVAAIFDVDVLWYLFIIFNSLQGAMICFAFVMTKQVLSLL---RGKFSKEPRSQ 717          
BLAST of GCR121 vs. TrEMBL
Match: A0A0L8GFJ1 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034324mg PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.169e-11
Identity = 89/384 (23.18%), Postives = 175/384 (45.57%), Query Frame = 3
Query:  117 TFKSSKLLQQFTCNKTISSNTSNAQTCQTVIY--QIITEGTTLSKFIDAENNNSALHL----------AFFNTSIGLRNMCKNESRNFRQNSN-LSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTN-------SMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSK 1208
            T K   L++  +C K    +  N   C+ VIY  Q+    T+L++      N+  L+L           F   S G+ ++C N   N   N N LS++S A+ +IT++ + +SI  L  TI+ Y     LRT PG + +++   L +    FL+ +   +  + C  + ++ H++ L+   WM +++ D+  TF+      R+          S+  +   L+ V+++++  + PG           + L   YG    CW++   S+L+    P M    +++I+ I+ I G+Y + + +     +K  + + K   + SIKL ++ G++     +        L+ +   +NS +G+FI   F+    + R  F+    ++K
Sbjct:   73 TEKKHTLVKLPSCPKHAVYDM-NTNKCRQVIYHHQLNCTTTSLNESEYYITNDGRLYLNNTQRLMNQSEFIRNSQGIISICVNNGTNDISNINGLSKYSVAESYITLVGLVISIPALAITIIVYLCIPDLRTLPGKLLISVLSALFVAELLFLISSQVTTSTVLCKSLAVVLHYSFLATFFWMNVMSFDAWYTFSGFIQLQRKGKGTKRLVLYSLYAWICPLVIVTISLIFEYTPGN----------HGLSPDYGN-GICWITNGKSLLWFFAIPVMVILCLNIIAFILTIRGLYLASKLS-----SKFLSEHNKQEFIISIKLFLVMGLTWTFAFLYTFTKIDELSLLFCILNSFVGLFICLSFLSTKIVRRSIFRNWHKITK 439          
BLAST of GCR121 vs. TrEMBL
Match: A0A0L8GGP4 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034326mg PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.027e-10
Identity = 85/354 (24.01%), Postives = 160/354 (45.20%), Query Frame = 3
Query:  183 NAQTCQTVIYQIITEGTTLSKFIDAE-----------NNNSAL--HLAFFNTSIGLRNMCKNESRNFRQNSN-LSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIM---------LLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWR 1175
            N++ C+ VIY      TT ++  ++E           NN   L     F   S G+ NMC N   N   N N +S++S  D +IT++ + +SI  L  TI+ Y     LRT PG + +++   L +    FL+ +   +  + C  + ++ H++ L+   WM +++ D+  TF+   +   R+     K  ++         L+ V+++++  + PG           + L   YG    CW++   S+L+    P M    +++I+ I+   G+Y S    G L+ +K  +++ K   +  IKL  I G++     +      +  + +   +NS +GIFI   F+    + R
Sbjct:  311 NSKECRQVIYHPPLNCTT-TRLNESEYYITSDGRLYLNNTQRLLNQSEFIRDSQGIINMCVNNGTNNISNINGISKYSVVDGYITLVGLVISIPALAITIIVYLCIPDLRTLPGKLLISLLSALFVAELLFLISSQVTTSTVLCKSLAVVMHYSFLATFFWMNVMSFDAWHTFS--GLTQLRSKEKHTKRFVLYSLYAWICPLVIVTISLIFEYTPGN----------HGLSPEYGN-GICWITNGKSLLWLFAIPVMFIICLNIIAFILTARGLYLS----GKLS-SKYLSKHNKDEFIICIKLFFIMGLTWAFAFLYTFTRIEEFSLLFCILNSFVGIFICVSFLSTKIVRR 645          
BLAST of GCR121 vs. Ensembl Nematostella
Match: EDO34420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE2])

HSP 1 Score: 56.9954 bits (136), Expect = 8.827e-9
Identity = 62/280 (22.14%), Postives = 126/280 (45.00%), Query Frame = 3
Query:  390 ITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIML-FSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSKEKSTSQ 1226
            +T+    LS++ L+  I +Y++   LR  PG + L+++  +L+ +  + ++  S + A+ C  + +  HFALLS  CWM ++A D   TF       RRT +  +  G   ++ + +  I      I+F+   +  +   + YGR   C++    ++L+    P       + I+L   ++ I R+++   S    +    N  +I    +  +G+   ++      +  F W     +    NS  G  I   ++ N R+  +Y  R +  S  K+++Q
Sbjct:  414 LTIAGCALSMISLVVLIFSYAVLPELRNLPGRVVLSLAITMLLYHLLYFLVNQSDTRAL-CVAVAVSLHFALLSAFCWMNVLAFDVHHTFT--KPGQRRTASRGHCPGTYAIYAAYSWGIPLAIVTISFSVDLSGSWR--IGYGRGEYCFIENPSAMLYLFLLPVAIILLYNFIALFHTMWHI-RAVRKKTSKASNQQRKPNLPIICFKMTSAMGITWVLAYFASTQATSFLWYAFVIL----NSLQGFLILLSYVLNRRVLSMY--RETLQSMRKTSTQ 681          
BLAST of GCR121 vs. Ensembl Nematostella
Match: EDO36509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH3])

HSP 1 Score: 49.2914 bits (116), Expect = 2.243e-6
Identity = 67/306 (21.90%), Postives = 126/306 (41.18%), Query Frame = 3
Query:  318 MCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIM----------LLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYR----SIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMS--LG-IMQISILFDWKILNTISSAVNSCL-GIFIGFVFICNGRIWRLY 1181
            +C+N S  +   S   + SE    +T + + +S++ L   ++TYS+ S LRT PG   + +S  +L++   +L  +        C+ + ++ H+  L+   W  +IA D+   F+ R+    +T    N  G +          LLFV++T  I  + G +             + YG    CW++           P +  FG+ ++ ++V     Y     +I++T       S +   K      +++  I G +   G I  + I   W +       + +CL G++I   F    R   LY
Sbjct:  735 ICRNYSNAYTIRS--EKGSEVLRMVTFVCLLISVIALGFVLVTYSLFSELRTTPGKNLMNLSTAILLSQIFWLSGSGQVHDRTACTVVAILLHYFFLASFIWTAIIAWDTWRAFSHRSHRSAKTMKRENLIGTLRCMAVGWLPALLFVAITTAID-LSGAV------------AIGYGSDVACWITNGT--------PLLVVFGLPVVVILVFNSIFYALTIIAIRATAKQARFASSDSRQKAHFWIYLRIAAIMGFTWVFGFIAAVGITALWYVF-----VILNCLQGVYIALAFALTERARNLY 1012          
BLAST of GCR121 vs. Ensembl Medaka
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101165348])

HSP 1 Score: 54.299 bits (129), Expect = 2.098e-7
Identity = 60/258 (23.26%), Postives = 106/258 (41.09%), Query Frame = 3
Query:  390 ITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMD-SAMTFAVRNMAH-RRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFIC 1157
            IT + I LS+V LL ++ T+     L++    +   +   L I  S FLV    G   + C+    + HF  L+   WM L  +    M   V    H RR    M  +G+  L V+++  + +                   +YG    CWL  +   ++   GPA     +++I L +A+Y ++     T  L        N K  ++ +I L  + G++     + +     ++  + +  NS  G+FI F+F C
Sbjct:  869 ITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCISLFIAESLFLVGINRGDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRRYFYMVGYGVPALIVAVSAAVDY------------------RSYGTDQVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMF---HHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVVMAYLFTIFNSLQGMFI-FIFHC 1104          
BLAST of GCR121 vs. Ensembl Medaka
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101165348])

HSP 1 Score: 53.9138 bits (128), Expect = 2.358e-7
Identity = 60/258 (23.26%), Postives = 106/258 (41.09%), Query Frame = 3
Query:  390 ITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMD-SAMTFAVRNMAH-RRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFIC 1157
            IT + I LS+V LL ++ T+     L++    +   +   L I  S FLV    G   + C+    + HF  L+   WM L  +    M   V    H RR    M  +G+  L V+++  + +                   +YG    CWL  +   ++   GPA     +++I L +A+Y ++     T  L        N K  ++ +I L  + G++     + +     ++  + +  NS  G+FI F+F C
Sbjct:  869 ITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCISLFIAESLFLVGINRGDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRRYFYMVGYGVPALIVAVSAAVDY------------------RSYGTDQVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMF---HHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVVMAYLFTIFNSLQGMFI-FIFHC 1104          
BLAST of GCR121 vs. Ensembl Medaka
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101165348])

HSP 1 Score: 53.9138 bits (128), Expect = 2.358e-7
Identity = 60/258 (23.26%), Postives = 106/258 (41.09%), Query Frame = 3
Query:  390 ITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMD-SAMTFAVRNMAH-RRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFIC 1157
            IT + I LS+V LL ++ T+     L++    +   +   L I  S FLV    G   + C+    + HF  L+   WM L  +    M   V    H RR    M  +G+  L V+++  + +                   +YG    CWL  +   ++   GPA     +++I L +A+Y ++     T  L        N K  ++ +I L  + G++     + +     ++  + +  NS  G+FI F+F C
Sbjct:  869 ITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCISLFIAESLFLVGINRGDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRRYFYMVGYGVPALIVAVSAAVDY------------------RSYGTDQVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMF---HHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVVMAYLFTIFNSLQGMFI-FIFHC 1104          
BLAST of GCR121 vs. Ensembl Medaka
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101165348])

HSP 1 Score: 53.9138 bits (128), Expect = 2.419e-7
Identity = 60/258 (23.26%), Postives = 106/258 (41.09%), Query Frame = 3
Query:  390 ITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMD-SAMTFAVRNMAH-RRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFIC 1157
            IT + I LS+V LL ++ T+     L++    +   +   L I  S FLV    G   + C+    + HF  L+   WM L  +    M   V    H RR    M  +G+  L V+++  + +                   +YG    CWL  +   ++   GPA     +++I L +A+Y ++     T  L        N K  ++ +I L  + G++     + +     ++  + +  NS  G+FI F+F C
Sbjct:  864 ITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCISLFIAESLFLVGINRGDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRRYFYMVGYGVPALIVAVSAAVDY------------------RSYGTDQVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMF---HHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVVMAYLFTIFNSLQGMFI-FIFHC 1099          
BLAST of GCR121 vs. Ensembl Medaka
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101165348])

HSP 1 Score: 53.9138 bits (128), Expect = 2.459e-7
Identity = 60/258 (23.26%), Postives = 106/258 (41.09%), Query Frame = 3
Query:  390 ITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMD-SAMTFAVRNMAH-RRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFIC 1157
            IT + I LS+V LL ++ T+     L++    +   +   L I  S FLV    G   + C+    + HF  L+   WM L  +    M   V    H RR    M  +G+  L V+++  + +                   +YG    CWL  +   ++   GPA     +++I L +A+Y ++     T  L        N K  ++ +I L  + G++     + +     ++  + +  NS  G+FI F+F C
Sbjct:  856 ITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCISLFIAESLFLVGINRGDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRRYFYMVGYGVPALIVAVSAAVDY------------------RSYGTDQVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMF---HHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVVMAYLFTIFNSLQGMFI-FIFHC 1091          
BLAST of GCR121 vs. Planmine SMEST
Match: SMESG000032100.1 (SMESG000032100.1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 402/409 (98.29%), Postives = 406/409 (99.27%), Query Frame = 3
Query:    3 YMSRKETTDVSLTNTLFNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSKEKSTSQL 1229
            YMSRKET DVSLTNTL+NTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFA++NMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFK+RSA S EKSTSQL
Sbjct:  440 YMSRKETIDVSLTNTLYNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFALKNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKKRSAYSTEKSTSQL 848          
BLAST of GCR121 vs. Planmine SMEST
Match: SMESG000032103.1 (SMESG000032103.1)

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 404/409 (98.78%), Postives = 404/409 (98.78%), Query Frame = 3
Query:    3 YMSRKETTDVSLTNTLFNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSKEKSTSQL 1229
            YM RKET DVSLTNTLFNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFV LTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLIS IVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVF CNGRIWRLYFKRRSALSKEKSTSQL
Sbjct:  360 YMGRKETIDVSLTNTLFNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVLLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISFIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFNCNGRIWRLYFKRRSALSKEKSTSQL 768          
BLAST of GCR121 vs. Planmine SMEST
Match: SMESG000032093.1 (SMESG000032093.1)

HSP 1 Score: 395.586 bits (1015), Expect = 2.625e-130
Identity = 205/387 (52.97%), Postives = 268/387 (69.25%), Query Frame = 3
Query:   30 VSLTNTLFNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFTCNKTIS-SNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTSIGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFK 1187
            +S++NTL ++ C  +    + N +QL+  T  S     + +C  T    +TS  +TC+ +IYQII E    S F+   N      L  FN+SI +R +C NESRN+ +N     FSEADFWIT+ILIPLSI+GL  TI+TY +H+ LRTFPGLM L+MS  LLITY GFL IAFS + A+DC+WIVMITHFALLSCLCWMMLIA D+AMTF+              KF I L+ V L V+IFW PGVIN+ACGY CL  L VTYGR+PTCWLSG++SIL+GVT PA  T  IS+ISL  +++GI RSI+ T  +  +K  NRN+ L++LFSIKLG++TG+++G+MQ+SILF+WK +N + SA+NS LG+ I  +F CN R+  LY K
Sbjct:  434 ISISNTLADSLCIPKELKKLWNVSQLFNETIFSKINYTKPSCIDTNPFGSTSKLETCENIIYQIINENLPPS-FLQQINAKQTFIL--FNSSIAVRKICNNESRNYSENPKFHSFSEADFWITIILIPLSIIGLSMTILTYCLHAALRTFPGLMVLSMSISLLITYCGFLAIAFSANYAIDCNWIVMITHFALLSCLCWMMLIAADAAMTFSRLKAVTNTKGKLKKKFIISLIEVHLIVLIFWSPGVINYACGYQCLGLLSVTYGRIPTCWLSGSLSILYGVTSPATLTLLISMISLASSVFGIIRSIRKTSKVIQSKRSNRNSNLLLLFSIKLGILTGVTIGMMQLSILFEWKSVNLVFSAINSSLGVAIMVLFTCNNRVLNLYRK 817          
BLAST of GCR121 vs. Planmine SMEST
Match: SMESG000033615.1 (SMESG000033615.1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.125e-9
Identity = 68/283 (24.03%), Postives = 116/283 (40.99%), Query Frame = 3
Query:  384 FWITVILIPLSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCL-LITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVR--NMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSALSKEKSTS 1223
            + I+     LS+V L   I+ Y  H V + F G + + +S CL LI +   LV       +  C ++ +  HF  LS   WM + A+D   TF  +  N   +R   S + + ++    S +V+      VI      T     P  YG  P CW +     L     P      + L + I+  +  Y+  ++     I K  + N+ L +   ++L  + G+   +   +I    +IL ++ S VN   G  +   F+C  R   L   R   +++  S S
Sbjct:  126 YHISFAFTCLSLVSLFFLIILYLTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLIGFSTSGSVVGI---SVITEYFDKTNSTLRP-QYGG-PYCWFTSKFGGLIYYFIPVCL---LLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWL--CMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKS 398          
BLAST of GCR121 vs. Planmine SMEST
Match: SMESG000033614.1 (SMESG000033614.1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.304e-7
Identity = 58/260 (22.31%), Postives = 102/260 (39.23%), Query Frame = 3
Query:  411 LSIVGLLATIMTYSIHSVLRTFPGLMALAMSYCL-LITYSGFLVIAFSGSLAMDCSWIVMITHFALLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIFWIPGVINFACGYTCLYW------LPVTYGRVPTCWLSGNISILFGVTGPAMATFGISLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSLGIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRI 1169
            LS+V L   I+ Y  H V +   G + + +S CL LI +   LV       +  C ++ +  HF  LS   WM + A+D   TF  ++        S+NK      F    + +F + G +         Y+      L   YG  P CW +     L     P       ++I+     Y ++++ +    +      N +    +   ++L  + G+   +  I+I     IL ++ S VN   G  +   F+C  R+
Sbjct:  292 LSLVSLFFLIILYLTHQVFKNLGGYLTICLSICLWLINFMSLLVTNTQIVKSASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKSA-------SINKNRGWKTFCIYFICVFAVSGCV-VGISVIIEYFDKTNSTLRPQYGG-PHCWFTSKFGGLIWYFIPVCLLLLWNIITCGFVFYQLFKTAKECRIIN-----NNDLNSTLWLCMRLTAVFGVGYVLQIIAIFTQLNILISLGSMVNCLQGFMLTLCFVCTKRV 537          
The following BLAST results are available for this feature:
BLAST of GCR121 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADGRE21.746e-824.70adhesion G protein-coupled receptor E2 [Source:HGN... [more]
ADGRE22.485e-824.70adhesion G protein-coupled receptor E2 [Source:HGN... [more]
ADGRE23.081e-824.70adhesion G protein-coupled receptor E2 [Source:HGN... [more]
ADGRE24.522e-824.70adhesion G protein-coupled receptor E2 [Source:HGN... [more]
ADGRE24.545e-824.70adhesion G protein-coupled receptor E2 [Source:HGN... [more]
back to top
BLAST of GCR121 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9UHX3|AGRE2_HUMAN2.690e-724.70Adhesion G protein-coupled receptor E2 OS=Homo sap... [more]
back to top
BLAST of GCR121 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUT05.677e-1925.62GCR121 OS=Schmidtea mediterranea OX=79327 GN=gcr12... [more]
A0A3M6T4U71.368e-1425.74Uncharacterized protein OS=Pocillopora damicornis ... [more]
R7URJ02.156e-1125.16G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A0L8GFJ14.169e-1123.18G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A0L8GGP41.027e-1024.01G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
back to top
BLAST of GCR121 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR121 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO344208.827e-922.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365092.243e-621.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR121 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADGRL32.098e-723.26adhesion G protein-coupled receptor L3 [Source:NCB... [more]
ADGRL32.358e-723.26adhesion G protein-coupled receptor L3 [Source:NCB... [more]
ADGRL32.358e-723.26adhesion G protein-coupled receptor L3 [Source:NCB... [more]
ADGRL32.419e-723.26adhesion G protein-coupled receptor L3 [Source:NCB... [more]
ADGRL32.459e-723.26adhesion G protein-coupled receptor L3 [Source:NCB... [more]
back to top
BLAST of GCR121 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032100.10.000e+098.29SMESG000032100.1[more]
SMESG000032103.10.000e+098.78SMESG000032103.1[more]
SMESG000032093.12.625e-13052.97SMESG000032093.1[more]
SMESG000033615.12.125e-924.03SMESG000033615.1[more]
SMESG000033614.11.304e-722.31SMESG000033614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001189 ID=SMED30001189|Name=GCR121|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
CGTATATGAGTAGGAAAGAAACCACCGATGTTTCCTTAACCAATACGTTA
TTTAATACATTTTGTCCCGACGAAAGATTTTCTATAATGAACAATTTCAC
TCAGCTCTACACCTATACCTTCAAATCTTCTAAGCTTCTACAACAATTCA
CGTGTAACAAAACGATATCAAGCAATACGTCAAATGCACAGACATGCCAA
ACTGTGATATACCAAATTATTACAGAAGGGACGACTTTATCGAAATTTAT
TGACGCAGAAAACAACAATTCCGCGTTACATCTTGCATTTTTCAACACGT
CGATTGGTCTAAGAAATATGTGTAAAAATGAATCAAGAAACTTTAGACAG
AATTCAAATTTAAGTCAGTTTTCTGAGGCTGACTTTTGGATCACAGTCAT
TTTGATTCCGTTATCAATAGTCGGACTTTTGGCTACGATAATGACCTACT
CTATTCATTCGGTTCTACGGACGTTTCCTGGTTTAATGGCGTTGGCTATG
AGCTACTGTTTACTGATAACGTATTCGGGATTCCTGGTGATTGCGTTTAG
TGGTTCACTTGCCATGGATTGCAGCTGGATTGTGATGATCACTCATTTTG
CGTTGTTGTCTTGTTTGTGTTGGATGATGCTAATCGCAATGGATTCGGCA
ATGACGTTTGCTGTGAGAAATATGGCGCATAGGAGAACAACAAATTCAAT
GAATAAATTCGGAATTATGCTCCTATTTGTTTCGTTGACTGTGATGATTT
TCTGGATACCCGGAGTAATAAATTTTGCGTGTGGATATACGTGCTTATAT
TGGCTACCAGTAACGTATGGCCGAGTTCCAACGTGTTGGCTAAGTGGTAA
CATTTCGATTCTGTTTGGAGTTACTGGACCAGCTATGGCTACATTTGGAA
TTTCACTCATTTCATTAATTGTAGCTATATACGGAATATACAGATCAATC
CAGAGTACAGGATCATTGACGATTGCTAAATCACCTAACAGAAATACAAA
GTTGATAATGTTATTCTCTATTAAACTCGGGGTGATCACTGGAATGTCCC
TTGGCATCATGCAAATTAGTATTCTGTTTGATTGGAAAATTCTCAATACC
ATTTCCAGTGCAGTGAACTCGTGTTTGGGAATTTTCATAGGATTCGTGTT
CATCTGTAACGGTAGAATATGGAGATTATATTTTAAAAGAAGATCCGCTC
TTTCAAAGGAAAAGTCTACAAGCCAACTTTAGAAAAATAATTTTATTACT
TGCACTTGG
back to top

protein sequence of SMED30001189-orf-1

>SMED30001189-orf-1 ID=SMED30001189-orf-1|Name=SMED30001189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MNTNPMKIPKHEFTALEMVLRIFQSNRILICMMPRDIPVITPSLIENNII
NFVFLLGDLAIVNDPVLWIDLYIPYIATINEMSEIPNVAIAGPVTPNRIE
MLPLSQHVGTRPYVTGSQYKHVYPHAKFITPGIQKIITVNETNRSIIPNL
FIEFVVLLCAIFLTANVIAESIAISIIQHKQDNNAK*
back to top

protein sequence of SMED30001189-orf-2

>SMED30001189-orf-2 ID=SMED30001189-orf-2|Name=SMED30001189-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
YMSRKETTDVSLTNTLFNTFCPDERFSIMNNFTQLYTYTFKSSKLLQQFT
CNKTISSNTSNAQTCQTVIYQIITEGTTLSKFIDAENNNSALHLAFFNTS
IGLRNMCKNESRNFRQNSNLSQFSEADFWITVILIPLSIVGLLATIMTYS
IHSVLRTFPGLMALAMSYCLLITYSGFLVIAFSGSLAMDCSWIVMITHFA
LLSCLCWMMLIAMDSAMTFAVRNMAHRRTTNSMNKFGIMLLFVSLTVMIF
WIPGVINFACGYTCLYWLPVTYGRVPTCWLSGNISILFGVTGPAMATFGI
SLISLIVAIYGIYRSIQSTGSLTIAKSPNRNTKLIMLFSIKLGVITGMSL
GIMQISILFDWKILNTISSAVNSCLGIFIGFVFICNGRIWRLYFKRRSAL
SKEKSTSQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 110..408
e-value: 1.9E-21
score: 78.3
NoneNo IPR availablePANTHERPTHR45902FAMILY NOT NAMEDcoord: 20..406
NoneNo IPR availableCDDcd150397tmB3_Methuselah-likecoord: 124..396
e-value: 2.16984E-26
score: 104.999
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 334..353
NoneNo IPR availableTMHMMTMhelixcoord: 291..313
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 161..183
NoneNo IPR availableTMHMMTMhelixcoord: 129..151
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 127..387
score: 10.994