Transmembrane protein 231

Overview
NameTransmembrane protein 231
Smed IDSMED30001185
Length (bp)968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 231 (SMED30001185) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 231 (SMED30001185) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 231 (SMED30001185) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 231 (SMED30001185) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001185

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001185SMESG000032658.1 SmedASXL_013768SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001185SMESG000032658.1 dd_Smed_v4_16131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001185SMESG000032658.1 dd_Smed_v4_16131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001185SMESG000032658.1 dd_Smed_v6_16131_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001185SMESG000032658.1 dd_Smed_v4_16131_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 231 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 109.383 bits (272), Expect = 4.820e-27
Identity = 75/296 (25.34%), Postives = 137/296 (46.28%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNY----QNYILISLPTITP----TNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNK 866
            MA  E+F  P  R Y + L SKA               L++A+ + GF++  +   E P V      +   +LG E+     +   P+ N  L  +  RVP ++ +  D N DG  D+ +  +E P+ S E +   Q+ + F ++L R+  L ++  A+ + S  +  + L VN DL  QQ  PL+       Y +  +   +P     ++  ++ ++  +  + V+ +    W  GR+    F +   +      + Y+PGFW   K+AW+Q+ SI +   +  + IK F+F+N+
Sbjct:    1 MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFN-RLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQ 295          
BLAST of Transmembrane protein 231 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 97.8265 bits (242), Expect = 1.303e-22
Identity = 62/250 (24.80%), Postives = 118/250 (47.20%), Query Frame = 3
Query:  150 GFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNY----QNYILISLPTITP----TNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNK 866
            GF++  +   E P V      +   +LG E+     +   P+ N  L  +  RVP ++ +  D N DG  D+ +  +E P+ S E +   Q+ + F ++L R+  L ++  A+ + S  +  + L VN DL  QQ  PL+       Y +  +   +P     ++  ++ ++  +  + V+ +    W  GR+    F +   +      + Y+PGFW   K+AW+Q+ SI +   +  + IK F+F+N+
Sbjct:   76 GFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFN-RLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQ 324          
BLAST of Transmembrane protein 231 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 76.6406 bits (187), Expect = 1.557e-15
Identity = 64/288 (22.22%), Postives = 118/288 (40.97%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNK 866
            MA  E+F  P  R Y + L SKA               L++A+ + GF++  +   E P V      +   +LG E+     +   P+ N  L  +  RVP ++ +  D N DG  D+ +  +E P+ S E +   Q+ + F ++L                   ++  N T          +P  Y              ++  ++ ++  +  + V+ +    W  GR+    F +   +      + Y+PGFW   K+AW+Q+ SI +   +  + IK F+F+N+
Sbjct:    1 MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFN-RLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLH------------------ISVINGT----------SPFAYD------------YDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQ 247          
BLAST of Transmembrane protein 231 vs. Ensembl Celegans
Match: tmem-231 (TMEM (Human TransMEMbrane protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q22804])

HSP 1 Score: 53.5286 bits (127), Expect = 5.983e-8
Identity = 69/300 (23.00%), Postives = 120/300 (40.00%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAID------SNSDGLNDIHNINIEFPMNS-----NEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILI---SLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQF-ASIAIFAFYFQQLIKEFLFKNK 866
            M  V+IF  P  R Y S+  S + F      +   F+ ++I + T G +  TN   E P +++  + I    G +   +      +NS   +       L     D       N +  N +  +NIEF M++     N  IY+F + +  D+     T L L D    + +  +  A +   A L   Q+ P   + +I I       +    +  VL        +L ++ +     +  S   +  + ++L +     IYK GFW   KW WIQ+ AS  I  + F      ++F+N+
Sbjct:    1 MPHVDIFTEPVYRTYRSSECSWSAFYIKLVNVFRYFLPILIIFITDGLWKKTNTFREVPNISVTGDFIAYAYGHDRSIISSSYSVLNSAASSEQLSTSQLLHHFSDVSEENKQNFNNQNSLQTLNIEFQMSTQNLSINTLIYAFSLRMRLDYHSIVDTELFLTDT--IQLTSPI--AQIQTIARLSMDQSNPFFTKEHIRIIDRRRQDVEHYQIHSVLKRITGAPIALKMERKSTLLLSAPSSPQSLSISLSLAVPEMEFIYKTGFWELLKWFWIQYLASFTIVDYVFTSC-TSYMFRNR 295          
BLAST of Transmembrane protein 231 vs. Ensembl Zebrafish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 122.865 bits (307), Expect = 2.737e-32
Identity = 77/304 (25.33%), Postives = 153/304 (50.33%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYY----GLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF +++  P   RY + + ++A       +       L++AY ++GF++  N   E PVV    + I  +LG+ + T  Y      P+ N  L  ++ R+P ++ Q  D N DG +D+  + I  P+   E+++S Q+ + F +QL R++ + ++  A+ ++S  +  + L +  DL   Q  PL ++        + I  S P  +  ++ +++  +  +  +  +      W  GR+    F++   ++     + Y+PGFW T K+AWIQ+ S+ +   +  Q I+ F+F+N+ +P+I I
Sbjct:    1 MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLVAYRSQGFWLKRNSYEEQPVVKFQYDLI--LLGVTDTTGNYLAWSTFPNFN-RLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQLFRMSTVVMQTLAFIQHSSPVPGSQLFICGDLRLNQRTPLPHRGLHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANAPFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTITI 301          
BLAST of Transmembrane protein 231 vs. Ensembl Zebrafish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 90.5077 bits (223), Expect = 9.638e-21
Identity = 68/296 (22.97%), Postives = 132/296 (44.59%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYY----GLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF +++  P   RY + + ++A       +       L++AY ++GF++  N   E PVV    + I  +LG+ + T  Y      P+ N  L  ++ R+P ++ Q  D N DG +D+  + I  P+   E+++S Q+ + F +QL                                        + + I  S P  +  ++ +++  +  +  +  +      W  GR+    F++   ++     + Y+PGFW T K+AWIQ+ S+ +   +  Q I+ F+F+N+ +P+I I
Sbjct:    1 MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLVAYRSQGFWLKRNSYEEQPVVKFQYDLI--LLGVTDTTGNYLAWSTFPNFN-RLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQL----------------------------------------FVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANAPFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTITI 253          
BLAST of Transmembrane protein 231 vs. Ensembl Xenopus
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:100145127])

HSP 1 Score: 123.25 bits (308), Expect = 3.624e-32
Identity = 80/300 (26.67%), Postives = 146/300 (48.67%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLG--IENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSI 881
            MA  E++  P   RY S++ SKA       ++      L++A+ + GF++ T+   E P V    + +   L     N   +   P  N NL  +  R+P ++ +  D N DG  D+ N  +E P+   + IY  Q+ + F +QL +++   ++  A  +YS  +  + L +N DL  QQ  PLN++        + I  S P  +   + +++ S+  +  + V+      W  GR+ +D F +K  +     ++ Y PGFW   K+AWIQ+ SI +   +  + IK F+F+N+ + ++
Sbjct:    1 MALYEVYSHPALLRYRSSICSKATLFILIVLLLTYIPPLLVAFRSYGFWLKTSTYEEQPNVRFQYDVLLIALSSTTGNYLAWSTYPGFN-NLVGDKLRLPHISAREEDRNQDGKMDLLNFQLELPLQPTDNIYGVQLILTFSYQLSKMSTFIMQSMALIQYSSPIPGSQLYMNGDLKLQQRQPLNHRGLDTTYNVSVINRSSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASDPFVIKAVIRYPVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQNQVLTTV 299          
BLAST of Transmembrane protein 231 vs. Ensembl Mouse
Match: Tmem231 (transmembrane protein 231 [Source:MGI Symbol;Acc:MGI:2685024])

HSP 1 Score: 114.775 bits (286), Expect = 3.286e-29
Identity = 79/303 (26.07%), Postives = 140/303 (46.20%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNY-ILISLPTITPT-------NMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MA   +F  P  R Y + L SKA               L++A+ + GF++  +   E P V      +   +LG E +    +   P+ N  L     RVP ++ +  D N DG  D+    +E P+   E +   Q+ + F +QL R++  E++  A+ + S  +  + L VN DL  QQ  PL+Y+   I  ++  I  T       ++  ++ ++  +  + V+ +    W  GR+    F +   +      + Y+PGFW   K+AWIQ+ SI +   +  + IK F+F+N+ + SI +
Sbjct:    1 MALYHLFSHPIERAYRAGLCSKAALFLLLTTALTYIPPLLVAFRSHGFWLKRSSYEEQPNVRFQHQVLLVALLGPEPEAFLAWSTFPTFN-RLQGAHLRVPLVSSREEDRNQDGKMDVLYFKLELPLQPTEHVLGVQLILTFSYQLHRMSTFEMQSMAFLQSSFAVPGSQLYVNGDLRLQQKQPLSYRGLDIRYNVSVINGTSPFAQDYDLTHIVAAYQERNVTTVLSDPNPIWLVGRAAEAPFVIHAVIRYPTEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVVTSIPV 302          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|F7B645|TM231_XENTR (Transmembrane protein 231 OS=Xenopus tropicalis OX=8364 GN=tmem231 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.920e-31
Identity = 80/300 (26.67%), Postives = 146/300 (48.67%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLG--IENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSI 881
            MA  E++  P   RY S++ SKA       ++      L++A+ + GF++ T+   E P V    + +   L     N   +   P  N NL  +  R+P ++ +  D N DG  D+ N  +E P+   + IY  Q+ + F +QL +++   ++  A  +YS  +  + L +N DL  QQ  PLN++        + I  S P  +   + +++ S+  +  + V+      W  GR+ +D F +K  +     ++ Y PGFW   K+AWIQ+ SI +   +  + IK F+F+N+ + ++
Sbjct:    1 MALYEVYSHPALLRYRSSICSKATLFILIVLLLTYIPPLLVAFRSYGFWLKTSTYEEQPNVRFQYDVLLIALSSTTGNYLAWSTYPGFN-NLVGDKLRLPHISAREEDRNQDGKMDLLNFQLELPLQPTDNIYGVQLILTFSYQLSKMSTFIMQSMALIQYSSPIPGSQLYMNGDLKLQQRQPLNHRGLDTTYNVSVINRSSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASDPFVIKAVIRYPVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQNQVLTTV 299          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|Q7T316|TM231_DANRE (Transmembrane protein 231 OS=Danio rerio OX=7955 GN=tmem231 PE=2 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 2.066e-31
Identity = 77/304 (25.33%), Postives = 153/304 (50.33%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYY----GLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF +++  P   RY + + ++A       +       L++AY ++GF++  N   E PVV    + I  +LG+ + T  Y      P+ N  L  ++ R+P ++ Q  D N DG +D+  + I  P+   E+++S Q+ + F +QL R++ + ++  A+ ++S  +  + L +  DL   Q  PL ++        + I  S P  +  ++ +++  +  +  +  +      W  GR+    F++   ++     + Y+PGFW T K+AWIQ+ S+ +   +  Q I+ F+F+N+ +P+I I
Sbjct:    1 MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLVAYRSQGFWLKRNSYEEQPVVKFQYDLI--LLGVTDTTGNYLAWSTFPNFN-RLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQLFRMSTVVMQTLAFIQHSSPVPGSQLFICGDLRLNQRTPLPHRGLHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANAPFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTITI 301          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|A7MB75|TM231_BOVIN (Transmembrane protein 231 OS=Bos taurus OX=9913 GN=TMEM231 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 9.765e-29
Identity = 79/305 (25.90%), Postives = 140/305 (45.90%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMS 893
            MA  E+F  P  R Y + L SKA               L++A+ + GF++  +   E P V      +   +LG E      +   P+ N  L     RVP ++ +  D N DG  D+ +  +E P+ S E++   Q+ + F +QL R++   ++  A+ + S  L  + L VN DL  QQ  PL Y         + I  + P  +  ++  ++ ++  +  + ++ +    W  GR+    F V   +      + Y PGFW   K+AWIQ+ SI +   +  + IK F+F+N+ + +I + +
Sbjct:    1 MALYELFAHPVERGYRAGLCSKAALFLLLATALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGSEPGGFLAWSTFPAFN-RLQEGHLRVPLVSAREEDRNQDGKMDMLHFKLELPLQSTEQVLGVQLILTFSYQLHRMSTFVMQSMAFLQSSFALPGSQLYVNGDLRLQQKQPLGYGGLDVRYNVSVINGTSPFASDYDLTRIVAAYQERNVTTILTDPSPIWLVGRAAEAPFVVNAVIRYPVEVISYLPGFWEMIKFAWIQYVSILLIFLWAFERIKRFVFQNQVVTTIPVTA 304          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|Q3U284|TM231_MOUSE (Transmembrane protein 231 OS=Mus musculus OX=10090 GN=Tmem231 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.299e-28
Identity = 79/303 (26.07%), Postives = 140/303 (46.20%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNY-ILISLPTITPT-------NMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MA   +F  P  R Y + L SKA               L++A+ + GF++  +   E P V      +   +LG E +    +   P+ N  L     RVP ++ +  D N DG  D+    +E P+   E +   Q+ + F +QL R++  E++  A+ + S  +  + L VN DL  QQ  PL+Y+   I  ++  I  T       ++  ++ ++  +  + V+ +    W  GR+    F +   +      + Y+PGFW   K+AWIQ+ SI +   +  + IK F+F+N+ + SI +
Sbjct:    1 MALYHLFSHPIERAYRAGLCSKAALFLLLTTALTYIPPLLVAFRSHGFWLKRSSYEEQPNVRFQHQVLLVALLGPEPEAFLAWSTFPTFN-RLQGAHLRVPLVSSREEDRNQDGKMDVLYFKLELPLQPTEHVLGVQLILTFSYQLHRMSTFEMQSMAFLQSSFAVPGSQLYVNGDLRLQQKQPLSYRGLDIRYNVSVINGTSPFAQDYDLTHIVAAYQERNVTTVLSDPNPIWLVGRAAEAPFVIHAVIRYPTEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVVTSIPV 302          
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Match: sp|Q5FVM1|TM231_RAT (Transmembrane protein 231 OS=Rattus norvegicus OX=10116 GN=Tmem231 PE=2 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 3.195e-28
Identity = 79/303 (26.07%), Postives = 141/303 (46.53%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIY-CVLGIENKTL--YYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNY-ILISLPTITPT-------NMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MA   +F  P  R Y + L SKA               L++A+ + GF++  +   E P V      +   +LG E      +   P+ N  L     RVP ++ +  D N DG  D+    +E P+ S E++   Q+ + F +QL R++  E++  A+ + S  +  + L VN DL  QQ  PL+Y+   +  ++  I  T       ++  ++ ++  +  + V+ +    W  GR+    F +   +      + Y+PGFW   K+AWIQ+ SI +   +  + IK F+F+N+ + SI +
Sbjct:    1 MALYHLFSHPIERAYRAGLCSKAALFLLLATALTYIPPLLVAFRSHGFWLKRSNYEEQPNVRFQHQVLLVALLGPEPGAFLAWSTYPTFN-RLQGVHLRVPLVSTREEDRNQDGKMDVLYFKLELPLQSTEQVLGVQLILTFSYQLHRMSTFEMQSMAFLQSSFAVPGSQLHVNGDLRLQQKQPLSYRGLDVRYNVSVINGTSPFAHDYDLTHIVAAYQERNVTTVLSDPNPIWLVGRAAEAPFVIDAVIRYPVEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVVTSIPV 302          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A1I8FJ06 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019546g2 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.447e-35
Identity = 85/305 (27.87%), Postives = 148/305 (48.52%), Query Frame = 3
Query:   24 EIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNY----QNYILISLPTITPTNM---DDVLDSFYS--QKASLVV--KNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMSDLEC 905
            EIF  P  R+Y + L SKAF   +  +       +II Y + GF+   +   E P V   +  I  +   + +  +   P++N NL  ++   P L  + +DSN DG ND  ++ +E P+   E + S  + + FD+ + R++   ++  A   Y   L  + LTV+ DL   Q   L Y    Q Y+    P +  ++M   D  L + ++  QK ++    +N    W+TGR   + FK+   +      + Y+PGFW+  KWAW+Q+ S+ +   +    +K F+F+N+ +PS+V     +C
Sbjct:    3 EIFWQPEIRKYKAGLCSKAFVFSFMCVAATFVFPIIIVYRSHGFWATEDTYREQPAVGFKRQAILQLQTSQQQYTWSTYPNLN-NLQQSNLLSPVLRIREVDSNLDGRNDFLHLQMEIPLADTESVQSVGLMLVFDYWIVRMSNFRMESLALINYDSSLAGSTLTVSGDLTLNQKELLGYKGTDQRYVT---PVVNSSSMVASDYKLSTIFAKYQKRNITTSFENALYSWETGRPAGEPFKINATIFYTTPLISYRPGFWYALKWAWVQYVSVMLIFLFIVDRVKVFVFENQIVPSVVQRPHFDC 303          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A267EJN7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019546g1 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.551e-35
Identity = 85/305 (27.87%), Postives = 148/305 (48.52%), Query Frame = 3
Query:   24 EIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNY----QNYILISLPTITPTNM---DDVLDSFYS--QKASLVV--KNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMSDLEC 905
            EIF  P  R+Y + L SKAF   +  +       +II Y + GF+   +   E P V   +  I  +   + +  +   P++N NL  ++   P L  + +DSN DG ND  ++ +E P+   E + S  + + FD+ + R++   ++  A   Y   L  + LTV+ DL   Q   L Y    Q Y+    P +  ++M   D  L + ++  QK ++    +N    W+TGR   + FK+   +      + Y+PGFW+  KWAW+Q+ S+ +   +    +K F+F+N+ +PS+V     +C
Sbjct:   26 EIFWQPEIRKYKAGLCSKAFVFSFMCVAATFVFPIIIVYRSHGFWATEDTYREQPAVGFKRQAILQLQTSQQQYTWSTYPNLN-NLQQSNLLSPVLRIREVDSNLDGRNDFLHLQMEIPLADTESVQSVGLMLVFDYWIVRMSNFRMESLALINYDSSLAGSTLTVSGDLTLNQKELLGYKGTDQRYVT---PVVNSSSMVASDYKLSTIFAKYQKRNITTSFENALYSWETGRPAGEPFKINATIFYTTPLISYRPGFWYALKWAWVQYVSVMLIFLFIVDRVKVFVFENQIVPSVVQRPHFDC 326          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A3Q2W7I5 (Transmembrane protein 231 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.256e-33
Identity = 80/303 (26.40%), Postives = 154/303 (50.83%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYG---LPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILI--------SLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF E++  P   RY +++ +KA       +       L++AY ++GF++  +   E PVV   +     V     +  Y      P +N+ L AN  R+P++  +  D N DG  D+    ++ P+  NE++YS Q+ + F +QL R++ + ++  AY ++S  +  A L ++ DL  QQ  PL ++    I        S P  +  ++++++ S+ ++  + V+      W  GR+    F++K  +      + Y+PGFW T K+AWIQ+ SI +   +  + I+ F+F+N+ + ++ +
Sbjct:    1 MAFYEVYSHPALIRYKTSVCTKATLFLVVVLCLTYIPPLLVAYRSQGFWIKRSTYEEQPVVR-FQYQTLLVAATSTRGEYVAWSTFPQLNNMLGAN-LRIPAVTVREEDQNQDGKLDLLVFQLQLPLKPNEQVYSIQLLLTFSYQLFRMSTVVMQSLAYMQHSSSVPGAKLFISGDLRLQQRTPLPHRGLYNIYNVSVIDGSSPFASAYDLENIIRSYQNRNLTTVLSCPIPVWTIGRAAAAPFELKAEIRYPVEVISYRPGFWETIKFAWIQYVSILLIFLWVFERIQRFVFQNQVLTTVPV 301          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A3P8X4I6 (Transmembrane protein 231 OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.231e-33
Identity = 74/302 (24.50%), Postives = 155/302 (51.32%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLG--IENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF E++  P   RY +++ +KA       +       L++AY ++GF+   +   E PVV      +       + +   +   P +N N+   ++R+P+++ +  D N DG  D+    ++ P+ ++E++YS Q+ + F +QL R++ + ++  AY ++S  +  A L +  DL  QQ APL ++        + I  S P ++  ++++++ S+ S+  + V+      W  GR+    F++   +      + Y+PGFW T K AWIQ+ S+ +   +  + ++ F+F+N+ + ++ +
Sbjct:    1 MAFYEVYSHPALIRYKTSVCTKATLFLVAILCLTYISPLLVAYRSQGFWTKRSTYEEQPVVRYRYEALLVAATSPLGDHVTWSTFPYLN-NMLGPNFRIPAVSVREEDQNQDGKLDLLIFKLQLPLRADEQVYSVQLLLTFSYQLHRMSTVVMQTLAYVQHSSSVPGAKLFIGGDLRLQQRAPLAHRGLNNIYNVSVIDGSSPFVSSYDLENIMRSYQSRNLTTVLSCPSPVWTLGRAEGSPFELSAEIRYPLEVISYRPGFWETIKLAWIQYVSVLLIFLWVSERVQRFVFQNQVLTTVPV 301          
BLAST of Transmembrane protein 231 vs. TrEMBL
Match: A0A3Q1FRF9 (Transmembrane protein 231 OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 5.674e-33
Identity = 78/301 (25.91%), Postives = 156/301 (51.83%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNI-LKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ------NYILI--SLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF E++  P   RY +++ +KA       +       L++AY ++GF+V  +   E PVV    +  +     ++   + +   S  +N+  N+ R+P+++ + +D N DG  D+    ++ P+  +E+IYS Q+ + F +QL R++ + ++  AY ++S  +  A L ++ DL  QQ  PL ++      N  +I  S P  +  ++D+++ S+  +  S V+      W  GR+    F++   +      + Y+PGFW T K AWIQ+ S+ +   +  + I+ F+F+N+ + ++ +
Sbjct:    1 MAFYEVYSHPAVVRYRTSVCTKATVFLLVVLGLTYIPPLLVAYRSQGFWVKRSTYEEQPVVKFQYETLLMAATSVQGDFVAWSSFSHLNNMLGNNLRIPAVSVREVDQNQDGKLDLLIFQLQLPLKPDEQIYSIQLLLTFSYQLFRMSTVVMQSLAYVQHSSSVPGAKLFISGDLKLQQRTPLPHRGLYNVYNVSVINGSSPFASSYDLDNIIRSYQDRNLSTVLSCPMPVWTVGRAAGSPFELNAEIRYPLEVISYRPGFWETIKMAWIQYVSVLLVFLWVFERIQRFVFQNQVLTTVPV 301          
BLAST of Transmembrane protein 231 vs. Ensembl Cavefish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:103032427])

HSP 1 Score: 116.701 bits (291), Expect = 4.610e-30
Identity = 71/300 (23.67%), Postives = 147/300 (49.00%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYC-VLGIENKTLYYG-LPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ--------NYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSI 881
            MAF E++  P   RY + + ++A               L++AY ++GF++  +   E PVV      +     G   + + +   P  N  L  ++ R+P+++ +  DSN DG +D   + +  P+ + E+IYS Q+ + F +QL R++ + ++  A+ ++S  +  + L +N DL   Q  PL ++        + +    P  T  ++  ++ ++ ++  +  +      W  GR+    F++   +     T+ Y+PGFW   K+AWIQ+ S+ +   +    I+ F+F+N+ +P++
Sbjct:    1 MAFYEVYSHPALIRYKTNVCTRATLFVLMVFCLTYIPPLLVAYKSQGFWLKRSTYEEQPVVQFQYQMLMIGATGTAGEFVAWSTFPDFN-RLLGSNLRIPAVSVKEEDSNQDGKSDRLRLQLSVPLKAEEQIYSIQLLLTFSYQLFRMSTVVMQSMAFIQHSSSVPGSQLFINGDLRLHQQIPLPHRGLHAAYNVSVVETGSPFATSYDLASIIRAYQARNLTTYLSCPTPVWIIGRAVNAPFQINAEVRYPLETISYRPGFWEMIKFAWIQYVSVLLVFLWLFNHIQTFVFQNQVLPTV 299          
BLAST of Transmembrane protein 231 vs. Ensembl Sea Lamprey
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 119.398 bits (298), Expect = 6.724e-32
Identity = 79/301 (26.25%), Postives = 148/301 (49.17%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSI-NSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQ------NYILI--SLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MA+ E+F  P   RY ++L SKA       ++      L++ Y ++GF++ T   VE P V   K N   +L +E  ++     +  N N        P +  +  D N DG  D  + ++  PM + +++    + + F ++L R+  L ++  A  ++S  L+ + L+VN DL  +Q  PL ++      N  ++  S P     +  +++ ++  +  S V+ N    W++GR+GT  F + + +    A   Y+PGFW   K+ W+Q+ S+ +   +  Q IK F+F+N+ + +I I
Sbjct:    1 MAY-EVFSHPALVRYRTSLFSKASLFIVATLLLTYIPPLLVVYRSQGFWLRTASFVEQPTV---KFNYDIMLLLETNSMPIAWSTFENLNSLLPKLHTPFVTAREEDVNLDGKADRLHCSLSMPMTAADEVVGVHLLLTFSYKLFRMPTLVMQSMALVQHSSPLHGSELSVNGDLRLRQREPLAHRGLDTRYNVSVVNGSSPFAEAYDFTEIIHAYQERNVSTVLGNTMAMWKSGRAGTIPFVINLLIRYPDAIDTYQPGFWEQIKFGWVQYVSVLLIFHWVFQRIKTFVFENQVLRTIPI 297          
BLAST of Transmembrane protein 231 vs. Ensembl Nematostella
Match: EDO45914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA3])

HSP 1 Score: 114.39 bits (285), Expect = 1.122e-29
Identity = 82/307 (26.71%), Postives = 144/307 (46.91%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLG-IENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQN-YILISLPTITPT-------NMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIA-IFAFYFQQLIKEFLFKNKYIPSIVIMSDLE 902
            M   E+ R P  ++Y + + S+A    +  +       LIIAY T GF++  +   E P V      +    G      L Y      + L  ++ R+P +     D+N DG +D  +  I  P+ ++E IYS Q+ + FD++L +   L+++  A    S  +  A  +   DL  +Q + L ++  Y   ++P I  T       N+  +  S+  +  S    + +  W  GR+    F VK  +N    T++Y+PGFW   KWAW+Q+ +I  IF F F Q +K F+F+ + + ++ +  + E
Sbjct:    1 MVMYEVHRHPVLQKYKTHICSRATLFQFFVVWLTFLPPLIIAYVTYGFWMKESTFREQPDVYYKHQLLLVAQGNTPGSFLAYSTFQNFNQLLKDNLRIPMIKSWEEDTNLDGKHDALHFEIHLPLKNSESIYSIQLILIFDYRLHQYVNLQMESLACISMSSPIAGAEFSTVGDLTLKQRSLLPHKGIYSTYNVPIIDGTSTLVDSYNLHQIFKSYIKRNVSTEYVSPYSIWTGGRAAGQPFVVKGTVNYPEETIMYRPGFWQMIKWAWVQYLAILFIFLFVFSQ-VKRFVFEEQIVSTVPMKIEKE 306          
BLAST of Transmembrane protein 231 vs. Ensembl Medaka
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:101168706])

HSP 1 Score: 124.79 bits (312), Expect = 3.978e-33
Identity = 73/302 (24.17%), Postives = 155/302 (51.32%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNI-LKNNIYCVLGIENKTLYYG-LPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILI--------SLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF E++  P   RY +++ +KA       +       L++AY ++GF++  +   E PVV    +  +    G +   + +   P +N N+   + R+P+++ +  D N DG  D+    ++ P+ +NE++YS Q+ + F +QL R++ + ++  A+ + +  +  A L ++ DL  QQ  PL ++    I        S P  +  ++++++ S+ ++  + V+      W  G +    F++ + +      + Y+PGFW T K+AWIQ+ SI +   +  + ++ F+F+N+ + ++ I
Sbjct:    1 MAFYEVYSHPAVIRYKTSVCTKATLFLVVVLCLTYIPPLLVAYRSQGFWLKRSTYEEQPVVRFQYQTLMVAATGTQGDYVAWSTFPHLN-NMLGPNLRIPAVSVKEEDLNKDGKLDLLTFQLQLPLKNNEQVYSVQLLLTFSYQLFRMSTVVMQSLAFVQLASPVPGAKLFISGDLRLQQRTPLPHRGLYNIYNVSVIDGSSPFASAYDLENIVRSYQARNLTTVLSCPMPVWTVGPAAGSPFELNVEIRYPVEVITYRPGFWETIKFAWIQYVSILLIFIWVFERVQRFVFQNQVLTTVSI 301          
BLAST of Transmembrane protein 231 vs. Ensembl Medaka
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:101168706])

HSP 1 Score: 69.3218 bits (168), Expect = 2.990e-13
Identity = 61/294 (20.75%), Postives = 130/294 (44.22%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNI-LKNNIYCVLGIENKTLYYG-LPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVI 887
            MAF E++  P   RY +++ +KA       +       L++AY ++GF++  +   E PVV    +  +    G +   + +   P +N N+   + R+P+++ +  D N DG  D+    ++ P+ +NE++YS Q+ + F +QL                                        + + I  S P  +  ++++++ S+ ++  + V+      W  G +    F++ + +   P  +I  P F F    AWIQ+ SI +   +  + ++ F+F+N+ + ++ I
Sbjct:    1 MAFYEVYSHPAVIRYKTSVCTKATLFLVVVLCLTYIPPLLVAYRSQGFWLKRSTYEEQPVVRFQYQTLMVAATGTQGDYVAWSTFPHLN-NMLGPNLRIPAVSVKEEDLNKDGKLDLLTFQLQLPLKNNEQVYSVQLLLTFSYQL----------------------------------------FVSVIDGSSPFASAYDLENIVRSYQARNLTTVLSCPMPVWTVGPAAGSPFELNVEIRY-PVEVITYP-FCF----AWIQYVSILLIFIWVFERVQRFVFQNQVLTTVSI 247          
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Match: SMESG000032658.1 (SMESG000032658.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMSDLECHCLSKDKK 929
            MAFVEIFRSPCRRRYFSTLISKAFFVHYGFIITAIFISLIIAYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMSDLECHCLSKDKK
Sbjct:    1 MAFVEIFRSPCRRRYFSTLISKAFFVHYGFIITAIFISLIIAYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMSDLECHCLSKDKK 306          
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Match: SMESG000032658.1 (SMESG000032658.1)

HSP 1 Score: 473.011 bits (1216), Expect = 2.622e-170
Identity = 247/249 (99.20%), Postives = 248/249 (99.60%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYK 758
            MAFVEIFRSPCRRRYFSTLISKAFFVHYGFIITAIFISLIIAYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATL+ K
Sbjct:    1 MAFVEIFRSPCRRRYFSTLISKAFFVHYGFIITAIFISLIIAYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLMCK 249          
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Match: SMESG000054111.1 (SMESG000054111.1)

HSP 1 Score: 56.6102 bits (135), Expect = 7.095e-9
Identity = 71/296 (23.99%), Postives = 130/296 (43.92%), Query Frame = 3
Query:   12 MAFVEIFRSPCRRRYFSTLISKAFFVHYGXXXXXXXXXXXXXYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYR-VPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRR-LTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILI---------SLPTITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQ-FASIAIFAFYFQQLIKEFLFKN 863
            M F  ++R     +Y+  + S+A      F +T +F+S I AY   GFY  +  I   P+V++ ++    ++ + +  +Y       SNL A++   +P ++    DSN DG+N+  N+ ++     N+ I   +  + FD+ +   ++ L+++               L V   L   Q   L     + I         S   +     D++  +   +  +L + +    WQ      D F+V I +  NP  L Y   FW   KWAW+Q F  + +F F FQ+  K+F+F++
Sbjct:    1 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQD--MALMFLSDSGVYSW-----SNLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIYNNTYYNSSSSANVLANPFDNLPGNISGRNFTLKLMDLSTGWQLS-PNPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRF-KDFVFES 284          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 231 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM2314.820e-2725.34transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
TMEM2311.303e-2224.80transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
TMEM2311.557e-1522.22transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem-2315.983e-823.00TMEM (Human TransMEMbrane protein) homolog [Sourc... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2312.737e-3225.33transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
tmem2319.638e-2122.97transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2313.624e-3226.67transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem2313.286e-2926.07transmembrane protein 231 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 231 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F7B645|TM231_XENTR1.920e-3126.67Transmembrane protein 231 OS=Xenopus tropicalis OX... [more]
sp|Q7T316|TM231_DANRE2.066e-3125.33Transmembrane protein 231 OS=Danio rerio OX=7955 G... [more]
sp|A7MB75|TM231_BOVIN9.765e-2925.90Transmembrane protein 231 OS=Bos taurus OX=9913 GN... [more]
sp|Q3U284|TM231_MOUSE2.299e-2826.07Transmembrane protein 231 OS=Mus musculus OX=10090... [more]
sp|Q5FVM1|TM231_RAT3.195e-2826.07Transmembrane protein 231 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Transmembrane protein 231 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FJ062.447e-3527.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EJN73.551e-3527.87Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3Q2W7I53.256e-3326.40Transmembrane protein 231 OS=Haplochromis burtoni ... [more]
A0A3P8X4I64.231e-3324.50Transmembrane protein 231 OS=Cynoglossus semilaevi... [more]
A0A3Q1FRF95.674e-3325.91Transmembrane protein 231 OS=Acanthochromis polyac... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2314.610e-3023.67transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2316.724e-3226.25transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO459141.122e-2926.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 231 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2313.978e-3324.17transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
tmem2312.990e-1320.75transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 231 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032658.10.000e+0100.00SMESG000032658.1[more]
SMESG000032658.12.622e-17099.20SMESG000032658.1[more]
SMESG000054111.17.095e-923.99SMESG000054111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001185 ID=SMED30001185|Name=Transmembrane protein 231|organism=Schmidtea mediterranea sexual|type=transcript|length=968bp
GTGTATAGTAAATGGCATTTGTAGAAATATTTAGGTCACCTTGTAGACGA
AGATATTTTTCAACATTGATTTCTAAAGCATTCTTTGTTCATTATGGATT
TATAATAACTGCTATATTTATTTCACTTATTATTGCTTACACAACTAAAG
GATTTTATGTATTTACTAATCAAATTGTGGAAGATCCAGTGGTAAATATA
TTAAAAAACAATATTTACTGTGTATTGGGAATCGAGAATAAAACGTTGTA
CTATGGTTTACCAAGCATTAATAGTAATTTATATGCGAATTCATATCGAG
TTCCATCCTTAAATTTTCAAGCAATTGATTCTAACAGTGACGGATTAAAT
GACATACACAATATAAACATTGAATTTCCAATGAATTCCAATGAAAAAAT
TTATAGCTTTCAAATCTTTATTGGTTTTGATTTTCAACTTCGAAGGTTAA
CAAGACTGGAGTTAAAAGACTATGCTTATTTCGAATATTCTGGCGGACTA
AATGCTGCCAATTTAACTGTAAACGCTGATCTTTTATTCCAACAAAATGC
CCCTTTAAACTATCAAAATTATATTCTAATTTCATTACCCACTATCACAC
CAACAAATATGGATGATGTCCTCGATAGTTTCTATTCTCAAAAAGCTTCA
CTTGTGGTGAAAAATCAATTTGTACAATGGCAAACTGGTCGCAGTGGCAC
GGACGCATTTAAAGTTAAAATTGCTTTAAATATAAATCCAGCCACATTGA
TTTACAAGCCCGGATTCTGGTTTACAGCAAAATGGGCCTGGATTCAGTTT
GCTTCCATTGCAATTTTTGCTTTTTATTTTCAACAATTAATTAAAGAATT
TCTTTTCAAAAACAAATATATTCCATCTATTGTCATCATGTCTGATTTGG
AGTGCCACTGTTTATCAAAAGATAAAAAGATTTGAAATTTTTTTATATGC
TTCTAGTTTCTAATTATC
back to top

protein sequence of SMED30001185-orf-1

>SMED30001185-orf-1 ID=SMED30001185-orf-1|Name=SMED30001185-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MAFVEIFRSPCRRRYFSTLISKAFFVHYGFIITAIFISLIIAYTTKGFYV
FTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYRVPSL
NFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRRLTRLE
LKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPTITPTNM
DDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKP
GFWFTAKWAWIQFASIAIFAFYFQQLIKEFLFKNKYIPSIVIMSDLECHC
LSKDKKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019306TMEM231
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005929cilium
GO:0016020membrane
GO:0016021integral component of membrane
GO:0035869ciliary transition zone
GO:0036038MKS complex
GO:0042995cell projection
GO:0060170ciliary membrane
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019306Transmembrane protein 231PFAMPF10149TM231coord: 1..290
e-value: 9.3E-52
score: 176.2
IPR019306Transmembrane protein 231PANTHERPTHR14605CHST5 PROTEINcoord: 1..291
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 23..45