beta,beta-carotene 15,15'-dioxygenase

Overview
Namebeta,beta-carotene 15,15'-dioxygenase
Smed IDSMED30001151
Length (bp)1890
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta,beta-carotene 15,15'-dioxygenase (SMED30001151) t-SNE clustered cells

Violin plots show distribution of expression levels for beta,beta-carotene 15,15'-dioxygenase (SMED30001151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta,beta-carotene 15,15'-dioxygenase (SMED30001151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta,beta-carotene 15,15'-dioxygenase (SMED30001151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001151SMESG000051674.1 PL05006B2C12ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30001151SMESG000051674.1 dd_Smed_v4_4523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001151SMESG000051674.1 dd_Smed_v4_4523_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Human
Match: BCO2 (beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:HGNC:18503])

HSP 1 Score: 312.768 bits (800), Expect = 2.363e-98
Identity = 190/528 (35.98%), Postives = 285/528 (53.98%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-----NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVP-SYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV-VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G  P W+ GSL R GPGKFE G DKY+H FDG+A++ ++ +  G VT++S+++QS +Y  N A NRIV+SEFGT A PDPC+++F R  + FE       MTDNT+V       + +  TET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P   SY    +PP          EK D+ + + G +++  I +  K  PSYYHSFG+T NY I +E PL +++  +  +KI G + ++   W PQ  T  HV+++ +G+LL   Y + P  TFH INA+ED+G ++ID C  DNG     Y + NL    + L      +A S PRR ++PL     +    NL  L  T+ +A    +    C   + H E+L     +E P I Y+ ++GKKY + YG     +  + L KVD   KT  VW  E+  Y  E +FV  P  +     +ED GV+L+ ++    T +      ++ +DAK+ +E+ R E   V +P  FHG F PI
Sbjct:   40 GHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLD-GTAYNMGNSFGPYGFSYKVIRVPP----------EKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVW-REDGFYPSEPVFVPAPGTN-----EEDGGVILSVVI----TPNQNESNFILVLDAKNFEELGRAEV-PVQMPYGFHGTFIPI 545          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Human
Match: BCO2 (beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:HGNC:18503])

HSP 1 Score: 312.768 bits (800), Expect = 2.363e-98
Identity = 190/528 (35.98%), Postives = 285/528 (53.98%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-----NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVP-SYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV-VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G  P W+ GSL R GPGKFE G DKY+H FDG+A++ ++ +  G VT++S+++QS +Y  N A NRIV+SEFGT A PDPC+++F R  + FE       MTDNT+V       + +  TET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P   SY    +PP          EK D+ + + G +++  I +  K  PSYYHSFG+T NY I +E PL +++  +  +KI G + ++   W PQ  T  HV+++ +G+LL   Y + P  TFH INA+ED+G ++ID C  DNG     Y + NL    + L      +A S PRR ++PL     +    NL  L  T+ +A    +    C   + H E+L     +E P I Y+ ++GKKY + YG     +  + L KVD   KT  VW  E+  Y  E +FV  P  +     +ED GV+L+ ++    T +      ++ +DAK+ +E+ R E   V +P  FHG F PI
Sbjct:   40 GHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLD-GTAYNMGNSFGPYGFSYKVIRVPP----------EKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVW-REDGFYPSEPVFVPAPGTN-----EEDGGVILSVVI----TPNQNESNFILVLDAKNFEELGRAEV-PVQMPYGFHGTFIPI 545          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Human
Match: BCO2 (beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:HGNC:18503])

HSP 1 Score: 312.383 bits (799), Expect = 8.862e-98
Identity = 190/528 (35.98%), Postives = 285/528 (53.98%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-----NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVP-SYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV-VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G  P W+ GSL R GPGKFE G DKY+H FDG+A++ ++ +  G VT++S+++QS +Y  N A NRIV+SEFGT A PDPC+++F R  + FE       MTDNT+V       + +  TET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P   SY    +PP          EK D+ + + G +++  I +  K  PSYYHSFG+T NY I +E PL +++  +  +KI G + ++   W PQ  T  HV+++ +G+LL   Y + P  TFH INA+ED+G ++ID C  DNG     Y + NL    + L      +A S PRR ++PL     +    NL  L  T+ +A    +    C   + H E+L     +E P I Y+ ++GKKY + YG     +  + L KVD   KT  VW  E+  Y  E +FV  P  +     +ED GV+L+ ++    T +      ++ +DAK+ +E+ R E   V +P  FHG F PI
Sbjct:   74 GHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLD-GTAYNMGNSFGPYGFSYKVIRVPP----------EKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVW-REDGFYPSEPVFVPAPGTN-----EEDGGVILSVVI----TPNQNESNFILVLDAKNFEELGRAEV-PVQMPYGFHGTFIPI 579          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Human
Match: BCO2 (beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:HGNC:18503])

HSP 1 Score: 310.071 bits (793), Expect = 2.012e-97
Identity = 187/523 (35.76%), Postives = 282/523 (53.92%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-----NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVP-SYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV-VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G  P W+ GSL R GPGKFE G DKY+H FDG+A++ ++ +  G VT++S+++QS +Y  N A NRIV+SEFGT A PDPC+++F R  + FE       MTDNT+V       + +  TET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P   SY    +PP          EK D+ + + G +++  I +  K  PSYYHSFG+T NY I +E PL +++  +  +KI G + ++   W PQ  T  HV+++ +G+LL   Y + P  TFH INA+ED+G ++ID C  DNG     Y + NL    + L      +A S PRR ++PL     +    NL  L  T+ +A    +    C   + H E+L     +E P I Y+ ++GKKY + YG     L   D+  K  +VW  E+  Y  E +FV  P  +     +ED GV+L+ ++    T +      ++ +DAK+ +E+ R E   V +P  FHG F PI
Sbjct:   40 GHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLD-GTAYNMGNSFGPYGFSYKVIRVPP----------EKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVG-DSLIKVDVVW-REDGFYPSEPVFVPAPGTN-----EEDGGVILSVVI----TPNQNESNFILVLDAKNFEELGRAEV-PVQMPYGFHGTFIPI 539          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Human
Match: RPE65 (retinoid isomerohydrolase RPE65 [Source:HGNC Symbol;Acc:HGNC:10294])

HSP 1 Score: 305.449 bits (781), Expect = 1.021e-95
Identity = 189/533 (35.46%), Postives = 297/533 (55.72%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN-EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKT-KIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMN-LFVDSLKDKF---PKSAPSSP----RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEEL--SDNAFMELPTINYNAYNGKKYRYLYGVAEN-----MLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P+T    G +P W+ GSL R GPG FEVGS+ + H FDG A++ ++   +G VT+  ++I++ +Y+R M   RIV++EFGT A+PDPC++IF+R  ++F   E+TDN  V V+PVG++ +  TET+ I +I+P  L TI  V   N V+VN ATAH HI+ + G V+ +G  F      +Y    IPP++           D E  ++ ++IV +     +  PSY HSFG+T NY + +E P+ I++   + +  +WG++  + F+        +H+ D+   + L++ Y T P   FHHIN YED G +++D C +     V N L++ +L++ +    K+A  +P    RR ++PL  D K+    NL++LPNT  TA +  +      +    E L        E P INY  Y GK Y Y YG+  N      L K++ +TK + VW  E   Y  E IFV HP+A      +ED GV+L+ ++V         Y  L+ ++AK + E+ R E   ++IP++FHG+F+
Sbjct:   25 PLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIEND-GTVYNIGNCFGKNFSIAYNIVKIPPLQA----------DKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNID-KADTGKNLVTLPNTTATAILCSDE----TIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVW-QEPDSYPSEPIFVSHPDA-----LEEDDGVVLS-VVVSPGAGQKPAY--LLILNAKDLSEVARAEVE-INIPVTFHGLFK 531          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Celegans
Match: bcmo-1 (Beta-Carotene 15,15'-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q9U2E4])

HSP 1 Score: 266.159 bits (679), Expect = 3.042e-81
Identity = 162/526 (30.80%), Postives = 276/526 (52.47%), Query Frame = 2
Query:  209 IGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN--EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-DKFPKSAPSSP--RRLIVPLKFDEKSACDINLI-SLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG------VAENM--LKKVDTETKTSIVWCNEEPGYAC-ESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPIN 1741
            +G +P ++ G++ RNGPG F VG ++Y H FDGL  +QRY+  DGK+ + ++Y++S++Y + + A RIV   FGT ++PDPC++IF++  + F N  E  DN++V   PVGD L+  TET  ++R+D   L T+ +  F   V V+  TAH   D E G V+ +G    P  ++ F      K       N+K + +        +G+I A   L P+Y HSFG++ENY +  E P+ + +   + ++   ++  +  +W   +   I ++++ +GE L      +P FTFHH N +E  G +V+DYC  +N      L + ++K  +F   A   P   R+IVP+     +    NL+ S+P  +   +I++   D   +      + + + ME P  ++   N K+YRY++G      +  N+  + K D +    ++W  E P   C E IFV +P        +ED G+L+ PI+    +   ++   ++ +DAK+++E  R E     IPL FH  ++P N
Sbjct:   25 VGSVPSYLTGTMLRNGPGMFTVGEEEYKHWFDGLGFMQRYHFEDGKMFYSARYLESEAYTKTVEAQRIVAGTFGTLSFPDPCKTIFSKYFSEFMNHSEKHDNSNVAFTPVGDSLYACTETPHMYRVDLDTLKTLEAADFSKFVAVHSCTAHQLYD-ENGDVYNIGSRFGPESAHVFTVTKNPK-------NQKSENDHSWEHTSKIGEIKASDPLYPTYMHSFGMSENYLVMFESPVRLHLQKYLLSEFVRATYHDCLEWHGDKDVSIFILNKKTGEQLPLTLKMNPFFTFHHANTFEKDGCLVMDYCRIENAGKFDTLLISNMKTGEFQYDAKFLPYLTRVIVPMSVSSSAKPGDNLLKSVPWASGCTSILQ---DDGSIRLTERRVCETS-MEFPRYHWEKINMKEYRYVFGSTVFGRIDGNLAGVVKADLKFGNHLIWNRENPHQICGEPIFVPNPEGI-----EEDDGILIVPIM----SSSEKQVPFVLILDAKTLEETARFEIPEARIPLGFHAFYKPKN 529          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Celegans
Match: bcmo-2 (Beta-Carotene 15,15'-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q9TXT9])

HSP 1 Score: 245.358 bits (625), Expect = 2.775e-73
Identity = 164/524 (31.30%), Postives = 259/524 (49.43%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFF--ENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-DKFPKSAPSSP--RRLIVPLKFDEKSACDINLISLPN--TNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGV-------AENM--LKKVDTETKTSIVWCNEEPGYAC-ESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            G +P ++KG++ RNGPG FE+G  KY H FDG+  +QRY+  DGK+ + ++Y++S++Y +NM A RIV   FGT ++PDPC+SIF+R  + F     + DN +V   PVGD L+  TET  +HR+D   L T+  V F   V ++  TAH   D E G V+ +G    P  ++ F      K       N + D ++       +G+I       P+Y HSFG++ENY I  E P+ I I   +  +   ++  +  KW   +   I ++++ +GE +       P FTFHH N +E  G +V+DYC  +       L ++++K   F   A   P   R+I+PL   + +    +L+        C+A       D   +    + + D + ME P  ++   N K Y Y+YG        +E +  + K D E     VW  E     C E IFV +P         ED G+L+ P++    T+   +   ++ ++AK++ EI R       IPL FH  +Q
Sbjct:   26 GSVPSYLKGTMLRNGPGMFEIGDTKYQHWFDGMGFIQRYHFEDGKMYYSARYLESENYKKNMEAQRIVTGSFGTASFPDPCKSIFSRFFSSFVQSEGIHDNANVAFAPVGDGLYACTETPNMHRVDLDSLDTLEPVDFSKYVALHTCTAHQLFD-ENGDVYNIGSRFGPDAAHVFTVTKNPK-------NLQSDSDRSWEHTTKIGEIRCSETFYPTYMHSFGMSENYLIMFESPIRIDIKKFIMKRFITTTFRDCMKWHADKDVKIFILNKKTGEQVPLKLKMAPFFTFHHANTFERDGCLVVDYCRIEQAGNFDALLIENMKTGNFQNDALFLPYLTRVIIPLSIPDGAQPGDDLLKPLGWAKGCSAIF----QDDGKIRLKEKRVCDIS-MEFPRYHWEKINMKPYNYVYGSSVLGAQKSETLPGIVKADLENGDHKVWRRENDKQICGEPIFVPNPEG-----VREDDGILIVPVM----TISDGQRPFVLILEAKNLTEIARYTIPEARIPLGFHAFYQ 527          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Fly
Match: ninaB (gene:FBgn0002937 transcript:FBtr0082820)

HSP 1 Score: 243.817 bits (621), Expect = 8.765e-72
Identity = 121/364 (33.24%), Postives = 211/364 (57.97%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFA-NYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKD-----KFPKSAPSSPRRLIVPL 1231
             +S  ++ + P+ G + G +P WI GSL RNGPG ++VG   + H FD  A++ R+ I +G+VT+Q++++ +++  +N +A RIVV+EFGT A PDPC SIF+R +  F  +  TDN+ + ++P GD+ +T TET  +HRI+P  L T   +   + V V   T+H H+   +G V+ LG       P+Y   + P                E++   A +V  +  RWKL+P Y H+FG+T++Y++ +E PL++S+ + +K ++ G +++   KW+    T+ H++DR SG+L+   Y ++  F  H IN +E  GH+V+D C Y N  ++  ++++++ +      +       P R ++PL
Sbjct:   46 LRSCEREIVDPIEGHHSGHIPKWICGSLLRNGPGSWKVGDMTFGHLFDCSALLHRFAIRNGRVTYQNRFVDTETLRKNRSAQRIVVTEFGTAAVPDPCHSIFDRFAAIFRPDSGTDNSMISIYPFGDQYYTFTETPFMHRINPCTLATEARICTTDFVGVVNHTSHPHV-LPSGTVYNLGTTMTRSGPAYTILSFP--------------HGEQMFEDAHVVATLPCRWKLHPGYMHTFGLTDHYFVIVEQPLSVSLTEYIKAQLGGQNLSACLKWFEDRPTLFHLIDRVSGKLV-QTYESEAFFYLHIINCFERDGHVVVDICSYRNPEMINCMYLEAIANMQTNPNYATLFRGRPLRFVLPL 393          

HSP 2 Score: 72.0182 bits (175), Expect = 8.328e-13
Identity = 58/193 (30.05%), Postives = 91/193 (47.15%), Query Frame = 2
Query: 1181 KFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENM-------LKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVS-IPLSFHGVFQP 1735
            K   +   SP+R     +++E++   +NL+++  +   A   +  N    +    E L D    E P I Y  Y GK YRY Y ++ ++       L KVD   K+ + WC EE  Y  E IFV  P     +P  ED GV+L  +++       +RY  L+ + AK+M E+ R +F +   +P   HG F P
Sbjct:  442 KQATAGEESPKRDAKRGRYEEENL--VNLVTMEGSQ--AEAFQGTNG---IQLRPEMLCDWG-CETPRIYYERYMGKNYRYFYAISSDVDAVNPGTLIKVDVWNKSCLTWC-EENVYPSEPIFVPSP-----DPKSEDDGVILASMVLGGL---NDRYVGLIVLCAKTMTELGRCDFHTNGPVPKCLHGWFAP 617          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Zebrafish
Match: bco2a (beta-carotene oxygenase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8039])

HSP 1 Score: 338.191 bits (866), Expect = 4.614e-108
Identity = 204/539 (37.85%), Postives = 302/539 (56.03%), Query Frame = 2
Query:  167 SALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEK-LLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFV-------DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH-CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPG-YACESIFVKHPNADDNNPGDEDYGVLLTPIL--VRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            S++K+   P+     G +P WI GSL RNGPGKFE G+  Y+H FDG+A++ R+ I DG+VT++S+++QS SY +    NRI+VSEFGT A PDPC++IF R LS F   + TDN SV       + + STET+ +HR+DP  L +   V + N V VN ATAH H D + G  + +G  N      A + I         R++ + D  K  L GAKI+  I  R K  PSYYHSFG++ENY + +E P+ + +  ++  ++WG+SI     W P ++TI H++D+ +G+ +   Y T  L TFH INA+E  G +++D C  D+G  + N  +       ++L + +   +   PRR ++PL    ++  + NL +  ++  TA         C     H E+L D   +E P INY  YN K YRY YG     +  + L K+D ETK   +W   +P  Y  E +F+  PNA+     DED GV+L+ I+  V+DK+        L+ +DAK+ +E+ R E   V+IP  FHGVF
Sbjct:   55 SSVKETPEPIPTTVTGTIPTWIHGSLLRNGPGKFEFGNQSYNHWFDGMALMHRFQIEDGQVTYRSRFLQSDSYKKCSERNRIMVSEFGTVALPDPCKNIFQRFLSRFEVLKPTDNASVNFVKYKGDYYVSTETNYMHRVDPETLESKQKVDWSNFVAVNGATAHPHFDPD-GTAYNMG--NSYRNKGAMYNI--------IRVSPERDGPKDTLEGAKILCSIAPRDKSKPSYYHSFGMSENYVVFIEQPIIMDLFKIITGRLWGNSINRGIYWDPNQETIFHLIDKQTGKEMPVKYYTKALSTFHQINAFEQDGFLMLDMCCSDDGEAINNFLIQNMRQSGEALDEMYNTMSRPLPRRFVLPLHISSETPLEQNLNTRLDSTATAVCRTKTQVFCTFEDLHGEDLKDYGGLEFPHINYAKYNTKPYRYYYGCGFRHIVGDSLIKMDLETKKLKIW--RQPDLYPSEPVFIPSPNAE-----DEDDGVILSVIITPVKDKST------FLLVLDAKTFEELGRAEV-PVNIPYGFHGVF 568          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Zebrafish
Match: bco2l (beta-carotene 15, 15-dioxygenase 2, like [Source:ZFIN;Acc:ZDB-GENE-010509-1])

HSP 1 Score: 330.102 bits (845), Expect = 3.416e-105
Identity = 196/536 (36.57%), Postives = 299/536 (55.78%), Query Frame = 2
Query:  167 SALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK------DKFPKSAPSS-PRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH--CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            S++++   P+T +  G +P WI GS  RNGPGKFE G  K++H FDG+A++  + I DG+VT+ S+++QS SY++N   NRIVVSEFGT A PDPC++IF R  + F+  + TDN  V       + + STET+ + +IDPV L T   V +   + VN ATAH H D+E    +           Y    +PP +K+D          +  L+GA+I+  I A     PSYYHSF ++ENY + +E P+ + ++  M  +I G S  +   W P+  TI HV DR++G+LL+  Y +  +F  H INAYE+ G++++D C  D+G V+    +++L+      DKF  S  ++ PRR ++PL+  E    D NLI+LP T  TA+ V+ +    + H   ++++L     +E P INY  YN + YRY Y      V  + L K+D E K   VW  +   +  E +F+  P+A      DED GV+++ I+    T   ++   L+ +DAK+  E+ R E   V IP   HG+F
Sbjct:   32 SSVEETPDPITTLIKGQIPSWINGSFLRNGPGKFEFGESKFTHWFDGMALMHHFNIKDGQVTYSSRFLQSDSYVQNSEKNRIVVSEFGTLATPDPCKNIFARFFSRFQIPKTTDNAGVNFVKYKGDFYVSTETNFMRKIDPVSLETKEKVDWSKFIAVNAATAHPHYDREGATYNMGNSYGRKGFFYHILRVPPCEKQDD---------DADLSGAEILCSIPAADPRKPSYYHSFVMSENYIVFIEQPIKLDLLKFMLYRIAGKSFHKVMSWNPELDTIFHVADRHTGQLLNTKYYSSAMFALHQINAYEENGYLIMDMCCGDDGNVIGEFTLENLQSTGEDLDKFFNSLCTNLPRRYVLPLEVKEDEPNDQNLINLPYT--TASAVKTQTGVFLYHEDLYNDDLLQYGGLEFPQINYANYNARPYRYFYACGFGHVFGDSLLKMDLEGKKLKVW-RQAGMFPSEPVFIPAPDAQ-----DEDDGVVMSVII----TPREKKSSFLLVLDAKTFTELGRAEV-PVDIPYGTHGLF 545          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Zebrafish
Match: bco2b (beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GENE-060421-7448])

HSP 1 Score: 319.316 bits (817), Expect = 5.815e-101
Identity = 188/523 (35.95%), Postives = 285/523 (54.49%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPS--YAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-------DKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH-CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            G +P WIKG+  RNGPGKFE+G   ++H FDG+A++ +++I DGKVT+ S+++ S SY  N+  NRI+VSEFGT A PDPC++ F R LS F   +++DN +V       + + STET+ +H+IDP  L T   V +   + VN ATAH H+D + G  + +G  +Y V    Y    +PP K+  +  L           GA +V  I +  K  PSYYHSF ++ENY + +E P+ + ++ ++  K+ G  I E   W P+  T+ HV+++ +G+L    Y T PL TFH IN YED G +++D C  D+G  + N  + +LK       + +       PRR ++PL  D  +    NLI+  N+  TA   +N    C     H E+L +   +E P INY+  N   YRY YG     +  + L K+D + K   VW      +  E +FV  P A      +ED GV+L+ ++    T + ++   L+ +DAK+ +E+ R E    +IP  FHG FQ
Sbjct:   55 GNVPSWIKGNFLRNGPGKFEIGRSSFNHWFDGMALLHQFHIEDGKVTYMSRFLNSDSYKENLEHNRIIVSEFGTVAMPDPCKNFFQRFLSRFELPKLSDNANVSFVQYKGDYYVSTETNFMHKIDPETLETKEKVDWSKFIAVNGATAHPHVDSD-GTTYNMG-NSYTVKGAFYNIIMVPPNKENPNDTLE----------GASVVCSIPSEDKSKPSYYHSFAMSENYVVFIEQPIKMDLLKIVTGKLRGKGINEGVYWDPKRNTVFHVINKRTGKLSLVKYYTKPLSTFHQINCYEDNGFLIMDMCSSDDGQAINNYVIQNLKKSGSALDEVYNTLCRVFPRRFVLPLNVDSDTPHGENLITCFNSTATAIKTDNNKVFCTYEDLHGEDLHEYGGLEFPHINYSMCNSHPYRYFYGCGFRHLVGDSLIKMDLQGKQIKVW-KHAGMFPSEPVFVSSPGA-----VEEDDGVILSVVI----TPNQDKSTFLLVLDAKTFEELGRAEVPK-NIPYGFHGTFQ 554          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Zebrafish
Match: bco1l (beta-carotene oxygenase 1, like [Source:ZFIN;Acc:ZDB-GENE-040426-1191])

HSP 1 Score: 315.849 bits (808), Expect = 7.939e-100
Identity = 188/528 (35.61%), Postives = 299/528 (56.63%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN---EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFA--NYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKI----WGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSP-------RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVA------ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            G +P W++G+L RNGPG F VG+  Y H FDG+A++  +   DG+V ++S+Y++S++Y +N+AA+RIVVSEFGT  YPDPC++IF+R  ++  N   + TDN  + +   G++ + S+E + I++IDP+ L T+G   + N + +N ATAH H D+E G  + +G A  N   P Y  F +P       +  ++K + +  L+  + V  I  R  L PSY+HSFG+TENY I +E    + IV +         WGS +    K+   +  + H++++ +G+ +S  Y TDP  TFHHINAYED GH+V D   Y +  +    ++ ++K    +   ++        +R ++P+  D+++  DINL+ L +T  TA + E+ +    V+C  + +     +ELP INY  +N KK RY YG         N + KVD  T+T  +W  EE  Y  E +F+  P+A      DED GV+L+ ++    + + +R   LV +DAKS KEI R    + SI +  HG+F
Sbjct:   32 GSIPPWLQGTLLRNGPGLFSVGNTSYKHWFDGMALIHSFTFKDGEVFYRSKYLKSETYKKNIAADRIVVSEFGTMVYPDPCKNIFSRAFSYMMNAIPDFTDNNLINIIKYGEDYYASSEVNYINQIDPLTLETLGRTNYRNHIAINLATAHPHYDEE-GNTYNMGTAIMNLGRPKYVIFKVP-------ANTSDKENKKPALSEVEQVCSIPIRSSLYPSYFHSFGMTENYIIFVEQAFKLDIVKLATAYFRDINWGSCL----KFDQDDINVFHLVNKKTGKAVSVKYYTDPFVTFHHINAYEDDGHVVFDLITYKDSKLYDMFYIQNMKQDVKRFIETNKDFAQPVCQRFVLPVNVDKETPQDINLVKLQDTTATAVLKEDGS----VYCTPDIIFKG--LELPAINYK-FNSKKNRYFYGTRVEWSPYPNKVAKVDVVTRTHKIWTEEE-CYPSEPVFIASPDA-----VDEDDGVILSSVV----SFNPQRPPFLVVLDAKSFKEIARATIDA-SIHMDLHGLF 529          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Zebrafish
Match: rpe65c (retinoid isomerohydrolase RPE65 c [Source:NCBI gene;Acc:100004076])

HSP 1 Score: 303.523 bits (776), Expect = 3.728e-95
Identity = 183/534 (34.27%), Postives = 303/534 (56.74%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN-EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKT-KIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMN-LFVDSLK---DKFPKSAPSSP----RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEEL--SDNAFMELPTINYNAYNGKKYRYLYGVAEN-----MLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            P+     G +P W+ GSL R GPG FEVG + + H FDG A++ ++ + DG+VT+  ++I++ +Y+R M   R+V++EFGTTAYPDPC++IF+R   +F+  E+TDN  V ++P+G++ +  TET+ I ++DP  L T+  V   N ++VN  TAH HI+ + G V+ +G  F      +Y    IPP++++ S +  +          +KI+ +  +  +  PSY HSFGITEN+++ +E P+ I+++  + +  I GS+  + F+   +  T  H+  +N G+ + H + T     FHHIN +ED+G IV+D C +     V N L++ +L+   ++  K+A  +P    RR ++PL    +     NL+SLP T  TA +   R+D   V    E L        E P INY+ +NGK Y + YG+  N      + K++ ++K + +W  E   Y  E +FV+ P+A+     DED GVLL+ ++   K   ++R   L+ + A  + EI R E   V IP++ HG+++P
Sbjct:   25 PIPAHVSGEIPAWLSGSLLRMGPGLFEVGDEPFYHLFDGQALLHKFDLKDGRVTYHRRFIRTDAYVRAMTEKRVVITEFGTTAYPDPCKNIFSRFFTYFQGIEVTDNCLVNIYPIGEDFYACTETNFITKVDPDTLETVKKVDLCNYLSVNGLTAHPHIEAD-GTVYNIGNCFGKNMSLAYNIVKIPPLQEDKSDQFEK----------SKILVQFPSSERFKPSYVHSFGITENHFVFVETPVKINLLKFLTSWSIRGSNYMDCFESNDKMGTWFHLAAKNPGKYIDHKFRTSAFNIFHHINCFEDQGFIVVDLCTWKGHEFVYNYLYLANLRQNWEEVKKAALRAPQPEVRRYVLPLDIHREEQGK-NLVSLPYTTATAVM---RSDG-TVWLEPEVLFSGPRQAFEFPQINYSKFNGKDYTFAYGLGLNHFVPDRICKLNVKSKETWIW-QEPDAYPSEPLFVQSPDAE-----DEDDGVLLSIVV---KPGVSQRPAFLLILKATDLTEIARAEV-DVLIPVTLHGIYKP 532          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Xenopus
Match: camk2g (calcium/calmodulin dependent protein kinase (CaM kinase) II gamma [Source:Xenbase;Acc:XB-GENE-868520])

HSP 1 Score: 333.954 bits (855), Expect = 1.188e-106
Identity = 209/532 (39.29%), Postives = 288/532 (54.14%), Query Frame = 2
Query:  188 YPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNLFV--DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYGVA-----ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            +P+    IG +P WIKGS  RNGPGKFE G DK++H FDG+A++ ++ I +G VT+ S++++S SY  N + NRI VSEFGTTA PDPC+SIF R LS F     TDN S+      ++ + STET+++H+++   L T   V +   V VN ATAH H D +    +           Y    IP    E           E  L G +IV  I A+  + PSYYHSFG+TENY I +E P+ I+++ ++ + + G+SIA++  W P   T+ HV ++++GEL    +   P   FH INAYEDKG IV D C   +G     Y + NL     +L   +  +A S P R ++PL  D  +  D NLISL  T  TA    NR D   V C  E L D        +E P INY+ YN KKYRY YG        + L KVD +TK   +W  EE  Y  E +FV  P+       +ED GV+L+ ++    T   E+   L+ +DAK+  EI R E   V +P  FHG+F
Sbjct:   24 HPIPTQIIGTVPSWIKGSFLRNGPGKFEFGEDKFNHWFDGMALMHKFTIENGNVTYMSRFLESDSYKTNRSENRIAVSEFGTTAMPDPCKSIFYRFLSRFEMPNPTDNGSINFMKYQNDYYVSTETNLMHKVNSDLLVTKEKVDWSKYVAVNGATAHPHYDPDGTTYNMGNSYGKQGTHYNIIKIPATGPE----------TEGTLQGVQIVCCIPAKNTMRPSYYHSFGMTENYIIFVEQPIKINVLRILTSNLSGASIADSITWDPSCDTVFHVANKHTGELHPVTFHALPFGMFHQINAYEDKGCIVFDLCSLKDGKILSVYQLQNLHKAGQALDQVYNSAARSFPCRYVLPLNTDSNTPQDRNLISLSYTTATAT---NRADG-TVWCTPESLYDTTMEEQGGLEFPAINYSKYNTKKYRYFYGCGFQHLIGSSLIKVDIQTKKLKIW-QEEGFYPSEPVFVSSPDLK-----EEDSGVILSVVV----TPHQEKSTFLLILDAKTFAEIGRAEV-PVHMPYGFHGIF 530          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Xenopus
Match: camk2g (calcium/calmodulin dependent protein kinase (CaM kinase) II gamma [Source:Xenbase;Acc:XB-GENE-868520])

HSP 1 Score: 333.569 bits (854), Expect = 1.286e-106
Identity = 209/532 (39.29%), Postives = 288/532 (54.14%), Query Frame = 2
Query:  188 YPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNLFV--DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYGVA-----ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            +P+    IG +P WIKGS  RNGPGKFE G DK++H FDG+A++ ++ I +G VT+ S++++S SY  N + NRI VSEFGTTA PDPC+SIF R LS F     TDN S+      ++ + STET+++H+++   L T   V +   V VN ATAH H D +    +           Y    IP    E           E  L G +IV  I A+  + PSYYHSFG+TENY I +E P+ I+++ ++ + + G+SIA++  W P   T+ HV ++++GEL    +   P   FH INAYEDKG IV D C   +G     Y + NL     +L   +  +A S P R ++PL  D  +  D NLISL  T  TA    NR D   V C  E L D        +E P INY+ YN KKYRY YG        + L KVD +TK   +W  EE  Y  E +FV  P+       +ED GV+L+ ++    T   E+   L+ +DAK+  EI R E   V +P  FHG+F
Sbjct:   19 HPIPTQIIGTVPSWIKGSFLRNGPGKFEFGEDKFNHWFDGMALMHKFTIENGNVTYMSRFLESDSYKTNRSENRIAVSEFGTTAMPDPCKSIFYRFLSRFEMPNPTDNGSINFMKYQNDYYVSTETNLMHKVNSDLLVTKEKVDWSKYVAVNGATAHPHYDPDGTTYNMGNSYGKQGTHYNIIKIPATGPE----------TEGTLQGVQIVCCIPAKNTMRPSYYHSFGMTENYIIFVEQPIKINVLRILTSNLSGASIADSITWDPSCDTVFHVANKHTGELHPVTFHALPFGMFHQINAYEDKGCIVFDLCSLKDGKILSVYQLQNLHKAGQALDQVYNSAARSFPCRYVLPLNTDSNTPQDRNLISLSYTTATAT---NRADG-TVWCTPESLYDTTMEEQGGLEFPAINYSKYNTKKYRYFYGCGFQHLIGSSLIKVDIQTKKLKIW-QEEGFYPSEPVFVSSPDLK-----EEDSGVILSVVV----TPHQEKSTFLLILDAKTFAEIGRAEV-PVHMPYGFHGIF 525          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Xenopus
Match: camk2g (calcium/calmodulin dependent protein kinase (CaM kinase) II gamma [Source:Xenbase;Acc:XB-GENE-868520])

HSP 1 Score: 333.954 bits (855), Expect = 1.346e-106
Identity = 209/532 (39.29%), Postives = 288/532 (54.14%), Query Frame = 2
Query:  188 YPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNLFV--DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYGVA-----ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            +P+    IG +P WIKGS  RNGPGKFE G DK++H FDG+A++ ++ I +G VT+ S++++S SY  N + NRI VSEFGTTA PDPC+SIF R LS F     TDN S+      ++ + STET+++H+++   L T   V +   V VN ATAH H D +    +           Y    IP    E           E  L G +IV  I A+  + PSYYHSFG+TENY I +E P+ I+++ ++ + + G+SIA++  W P   T+ HV ++++GEL    +   P   FH INAYEDKG IV D C   +G     Y + NL     +L   +  +A S P R ++PL  D  +  D NLISL  T  TA    NR D   V C  E L D        +E P INY+ YN KKYRY YG        + L KVD +TK   +W  EE  Y  E +FV  P+       +ED GV+L+ ++    T   E+   L+ +DAK+  EI R E   V +P  FHG+F
Sbjct:   38 HPIPTQIIGTVPSWIKGSFLRNGPGKFEFGEDKFNHWFDGMALMHKFTIENGNVTYMSRFLESDSYKTNRSENRIAVSEFGTTAMPDPCKSIFYRFLSRFEMPNPTDNGSINFMKYQNDYYVSTETNLMHKVNSDLLVTKEKVDWSKYVAVNGATAHPHYDPDGTTYNMGNSYGKQGTHYNIIKIPATGPE----------TEGTLQGVQIVCCIPAKNTMRPSYYHSFGMTENYIIFVEQPIKINVLRILTSNLSGASIADSITWDPSCDTVFHVANKHTGELHPVTFHALPFGMFHQINAYEDKGCIVFDLCSLKDGKILSVYQLQNLHKAGQALDQVYNSAARSFPCRYVLPLNTDSNTPQDRNLISLSYTTATAT---NRADG-TVWCTPESLYDTTMEEQGGLEFPAINYSKYNTKKYRYFYGCGFQHLIGSSLIKVDIQTKKLKIW-QEEGFYPSEPVFVSSPDLK-----EEDSGVILSVVV----TPHQEKSTFLLILDAKTFAEIGRAEV-PVHMPYGFHGIF 544          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Xenopus
Match: camk2g (calcium/calmodulin dependent protein kinase (CaM kinase) II gamma [Source:Xenbase;Acc:XB-GENE-868520])

HSP 1 Score: 333.569 bits (854), Expect = 1.701e-106
Identity = 209/532 (39.29%), Postives = 288/532 (54.14%), Query Frame = 2
Query:  188 YPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNLFV--DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYGVA-----ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            +P+    IG +P WIKGS  RNGPGKFE G DK++H FDG+A++ ++ I +G VT+ S++++S SY  N + NRI VSEFGTTA PDPC+SIF R LS F     TDN S+      ++ + STET+++H+++   L T   V +   V VN ATAH H D +    +           Y    IP    E           E  L G +IV  I A+  + PSYYHSFG+TENY I +E P+ I+++ ++ + + G+SIA++  W P   T+ HV ++++GEL    +   P   FH INAYEDKG IV D C   +G     Y + NL     +L   +  +A S P R ++PL  D  +  D NLISL  T  TA    NR D   V C  E L D        +E P INY+ YN KKYRY YG        + L KVD +TK   +W  EE  Y  E +FV  P+       +ED GV+L+ ++    T   E+   L+ +DAK+  EI R E   V +P  FHG+F
Sbjct:   32 HPIPTQIIGTVPSWIKGSFLRNGPGKFEFGEDKFNHWFDGMALMHKFTIENGNVTYMSRFLESDSYKTNRSENRIAVSEFGTTAMPDPCKSIFYRFLSRFEMPNPTDNGSINFMKYQNDYYVSTETNLMHKVNSDLLVTKEKVDWSKYVAVNGATAHPHYDPDGTTYNMGNSYGKQGTHYNIIKIPATGPE----------TEGTLQGVQIVCCIPAKNTMRPSYYHSFGMTENYIIFVEQPIKINVLRILTSNLSGASIADSITWDPSCDTVFHVANKHTGELHPVTFHALPFGMFHQINAYEDKGCIVFDLCSLKDGKILSVYQLQNLHKAGQALDQVYNSAARSFPCRYVLPLNTDSNTPQDRNLISLSYTTATAT---NRADG-TVWCTPESLYDTTMEEQGGLEFPAINYSKYNTKKYRYFYGCGFQHLIGSSLIKVDIQTKKLKIW-QEEGFYPSEPVFVSSPDLK-----EEDSGVILSVVV----TPHQEKSTFLLILDAKTFAEIGRAEV-PVHMPYGFHGIF 538          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Xenopus
Match: camk2g (calcium/calmodulin dependent protein kinase (CaM kinase) II gamma [Source:Xenbase;Acc:XB-GENE-868520])

HSP 1 Score: 334.724 bits (857), Expect = 1.715e-106
Identity = 209/532 (39.29%), Postives = 288/532 (54.14%), Query Frame = 2
Query:  188 YPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNLFV--DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYGVA-----ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            +P+    IG +P WIKGS  RNGPGKFE G DK++H FDG+A++ ++ I +G VT+ S++++S SY  N + NRI VSEFGTTA PDPC+SIF R LS F     TDN S+      ++ + STET+++H+++   L T   V +   V VN ATAH H D +    +           Y    IP    E           E  L G +IV  I A+  + PSYYHSFG+TENY I +E P+ I+++ ++ + + G+SIA++  W P   T+ HV ++++GEL    +   P   FH INAYEDKG IV D C   +G     Y + NL     +L   +  +A S P R ++PL  D  +  D NLISL  T  TA    NR D   V C  E L D        +E P INY+ YN KKYRY YG        + L KVD +TK   +W  EE  Y  E +FV  P+       +ED GV+L+ ++    T   E+   L+ +DAK+  EI R E   V +P  FHG+F
Sbjct:   65 HPIPTQIIGTVPSWIKGSFLRNGPGKFEFGEDKFNHWFDGMALMHKFTIENGNVTYMSRFLESDSYKTNRSENRIAVSEFGTTAMPDPCKSIFYRFLSRFEMPNPTDNGSINFMKYQNDYYVSTETNLMHKVNSDLLVTKEKVDWSKYVAVNGATAHPHYDPDGTTYNMGNSYGKQGTHYNIIKIPATGPE----------TEGTLQGVQIVCCIPAKNTMRPSYYHSFGMTENYIIFVEQPIKINVLRILTSNLSGASIADSITWDPSCDTVFHVANKHTGELHPVTFHALPFGMFHQINAYEDKGCIVFDLCSLKDGKILSVYQLQNLHKAGQALDQVYNSAARSFPCRYVLPLNTDSNTPQDRNLISLSYTTATAT---NRADG-TVWCTPESLYDTTMEEQGGLEFPAINYSKYNTKKYRYFYGCGFQHLIGSSLIKVDIQTKKLKIW-QEEGFYPSEPVFVSSPDLK-----EEDSGVILSVVV----TPHQEKSTFLLILDAKTFAEIGRAEV-PVHMPYGFHGIF 571          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Mouse
Match: Bco2 (beta-carotene oxygenase 2 [Source:MGI Symbol;Acc:MGI:2177469])

HSP 1 Score: 334.339 bits (856), Expect = 4.630e-107
Identity = 200/524 (38.17%), Postives = 292/524 (55.73%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPS-YAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVV-HCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G +P+W+ G L R GPGKFE G D+Y+H FDG+A++ ++ +  G VT++S+++QS +Y  N A  RIV+SEFGT A PDPC+SIF R  + FE   MTDNT+V       + + STET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P  S Y    +PP KKE    ++          GA+++  I +  K+ PSYYHSFG+T+NY I +E P+ + +  ++ +KI G   A+   W PQ  T  HV+D+++G+LL  +Y + P  T+H INA+ED+G IVID C  D+G     Y + NL    + L   +   A S PRR ++PL     +A   NL  L  ++ +A    +    C   + HHE+L +   +E P INY  +NGKKY + YG     +  + L KVD   KT  VW  EE  Y  E +FV  P AD     +ED GV+L+ ++    T +      L+ +DAKS  E+ R E   V +P  FHG F PI
Sbjct:   31 GHIPEWLNGYLLRVGPGKFEFGKDRYNHWFDGMALLHQFRMERGTVTYKSKFLQSDTYKANSAGGRIVISEFGTLALPDPCKSIFERFMSRFEPPTMTDNTNVNFVQYKGDYYMSTETNFMNKVDIEMLERTEKVDWSKFIAVNGATAHPHYDPD-GTAYNMGNSYGPRGSCYNIIRVPPKKKEPGETIH----------GAQVLCSIASTEKMKPSYYHSFGMTKNYIIFVEQPVKMKLWKIITSKIRGKPFADGISWEPQYNTRFHVVDKHTGQLLPGMYYSMPFLTYHQINAFEDQGCIVIDLCCQDDGRSLDLYQLQNLRKAGEGLDQVYELKAKSFPRRFVLPLDVSVDAAEGKNLSPLSYSSASAVKQGDGEIWCSPENLHHEDLEEEGGIEFPQINYGRFNGKKYSFFYGCGFRHLVGDSLIKVDVTNKTLRVW-REEGFYPSEPVFVPVPGAD-----EEDSGVILSVVI----TPNQSESNFLLVLDAKSFTELGRAEV-PVQMPYGFHGTFVPI 532          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Mouse
Match: Bco1 (beta-carotene oxygenase 1 [Source:MGI Symbol;Acc:MGI:1926923])

HSP 1 Score: 315.079 bits (806), Expect = 3.003e-99
Identity = 192/540 (35.56%), Postives = 300/540 (55.56%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN---EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSA--PSSP--RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGV------AENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            F    K+ + PV     G +P W++G+L RNGPG   VG  KY+H FDGLA++  + I DG+V ++S+Y+QS +Y+ N+ ANRIVVSEFGT AYPDPC++IF++  ++  +   + TDN  + +   G++ + +TET+ I +IDP  L T+  V +   V VN AT+H H D E G V  +G    +     Y  F IP      ++  + K   +  +  A++   I++R  L+PSYYHSFG+TENY + LE P  + I+ M    + G S A    +  ++KT IH++D+ + + +   + TDP+  FHH+NAYE+ G ++ D   Y++  +    ++ +L   F + +   S P  RR  VPL  D+ +    NL+ + +T  TA   ++ +    V+C  E L +   +ELP INY AYNGK YRY++            + K D  TK+S+ W +EE  +  E +FV  P A      DED GV+L+ I+    + D ++   L+ +DAKS  E+ R    +  + L  HG+F P
Sbjct:    5 FGQNKKEQLEPVQAKVTGSIPAWLQGTLLRNGPGMHTVGESKYNHWFDGLALLHSFSIRDGEVFYRSKYLQSDTYIANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYD-EAGNVLNMGTSVVDKGRTKYVIFKIP------ATVPDSKKKGKSPVKHAEVFCSISSRSLLSPSYYHSFGVTENYVVFLEQPFKLDILKMATAYMRGVSWASCMSFDREDKTYIHIIDQRTRKPVPTKFYTDPMVVFHHVNAYEEDGCVLFDVIAYEDSSLYQLFYLANLNKDFEEKSRLTSVPTLRRFAVPLHVDKDAEVGSNLVKVSSTTATALKEKDGH----VYCQPEVLYEG--LELPRINY-AYNGKPYRYIFAAEVQWSPVPTKILKYDILTKSSLKW-SEESCWPAEPLFVPTPGAK-----DEDDGVILSAIV----STDPQKLPFLLILDAKSFTELARASVDA-DMHLDLHGLFIP 519          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Mouse
Match: Rpe65 (retinal pigment epithelium 65 [Source:MGI Symbol;Acc:MGI:98001])

HSP 1 Score: 298.516 bits (763), Expect = 3.182e-93
Identity = 184/532 (34.59%), Postives = 295/532 (55.45%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN-EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKT-KIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMN-LFVDSLKDKF---PKSAPSSP----RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEEL--SDNAFMELPTINYNAYNGKKYRYLYGVAENML---KKVDTETKTSIVWCNEEP-GYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P+T    G +P W+ GSL R GPG FEVGS+ + H FDG A++ ++   +G VT+  ++I++ +Y+R M   RIV++EFGT A+PDPC++IF+R  ++F+  E+TDN  V ++PVG++ +  TET+ I +I+P  L TI  V   N ++VN ATAH HI+ + G V+ +G  F      +Y    IPP+K +    +N+          +++V +     +  PSY HSFG+T NY + +E P+ I++   + +  +WG++  + F+        +HV D+   +  ++ Y T P   FHHIN YED G +++D C +     V N L++ +L++ +    ++A  +P    RR ++PL  D K     NL++LP+T  TA +   R+D+  +    E L        E P INY  + GK Y Y YG+  N     K      KT  +W  +EP  Y  E IFV  P+A      +ED GV+L+ ++V         Y  L+ ++AK + EI R E  + +IP++FHG+F+
Sbjct:   25 PLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFKGVEVTDNALVNIYPVGEDYYACTETNFITKINPETLETIKQVDLCNYISVNGATAHPHIESD-GTVYNIGNCFGKNFTVAYNIIKIPPLKADKEDPINK----------SEVVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNESMGVWLHVADKKRRKYFNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKRNAMKAPQPEVRRYVLPLTID-KVDTGRNLVTLPHTTATATL---RSDE-TIWLEPEVLFSGPRQAFEFPQINYQKFGGKPYTYAYGLGLNHFVPDKLCKMNVKTKEIWMWQEPDSYPSEPIFVSQPDAL-----EEDDGVVLS-VVVSPGAGQKPAY--LLVLNAKDLSEIARAEVET-NIPVTFHGLFK 531          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Mouse
Match: Rpe65 (retinal pigment epithelium 65 [Source:MGI Symbol;Acc:MGI:98001])

HSP 1 Score: 298.516 bits (763), Expect = 3.182e-93
Identity = 184/532 (34.59%), Postives = 295/532 (55.45%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN-EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKT-KIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMN-LFVDSLKDKF---PKSAPSSP----RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEEL--SDNAFMELPTINYNAYNGKKYRYLYGVAENML---KKVDTETKTSIVWCNEEP-GYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P+T    G +P W+ GSL R GPG FEVGS+ + H FDG A++ ++   +G VT+  ++I++ +Y+R M   RIV++EFGT A+PDPC++IF+R  ++F+  E+TDN  V ++PVG++ +  TET+ I +I+P  L TI  V   N ++VN ATAH HI+ + G V+ +G  F      +Y    IPP+K +    +N+          +++V +     +  PSY HSFG+T NY + +E P+ I++   + +  +WG++  + F+        +HV D+   +  ++ Y T P   FHHIN YED G +++D C +     V N L++ +L++ +    ++A  +P    RR ++PL  D K     NL++LP+T  TA +   R+D+  +    E L        E P INY  + GK Y Y YG+  N     K      KT  +W  +EP  Y  E IFV  P+A      +ED GV+L+ ++V         Y  L+ ++AK + EI R E  + +IP++FHG+F+
Sbjct:   25 PLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFKGVEVTDNALVNIYPVGEDYYACTETNFITKINPETLETIKQVDLCNYISVNGATAHPHIESD-GTVYNIGNCFGKNFTVAYNIIKIPPLKADKEDPINK----------SEVVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNESMGVWLHVADKKRRKYFNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKRNAMKAPQPEVRRYVLPLTID-KVDTGRNLVTLPHTTATATL---RSDE-TIWLEPEVLFSGPRQAFEFPQINYQKFGGKPYTYAYGLGLNHFVPDKLCKMNVKTKEIWMWQEPDSYPSEPIFVSQPDAL-----EEDDGVVLS-VVVSPGAGQKPAY--LLVLNAKDLSEIARAEVET-NIPVTFHGLFK 531          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Mouse
Match: Bco1 (beta-carotene oxygenase 1 [Source:MGI Symbol;Acc:MGI:1926923])

HSP 1 Score: 293.123 bits (749), Expect = 2.625e-91
Identity = 173/481 (35.97%), Postives = 270/481 (56.13%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN---EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSA--PSSP--RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGV------AENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNN 1558
            F    K+ + PV     G +P W++G+L RNGPG   VG  KY+H FDGLA++  + I DG+V ++S+Y+QS +Y+ N+ ANRIVVSEFGT AYPDPC++IF++  ++  +   + TDN  + +   G++ + +TET+ I +IDP  L T+  V +   V VN AT+H H D E G V  +G    +     Y  F IP      ++  + K   +  +  A++   I++R  L+PSYYHSFG+TENY + LE P  + I+ M    + G S A    +  ++KT IH++D+ + + +   + TDP+  FHH+NAYE+ G ++ D   Y++  +    ++ +L   F + +   S P  RR  VPL  D+ +    NL+ + +T  TA   ++ +    V+C  E L +   +ELP INY AYNGK YRY++            + K D  TK+S+ W +EE  +  E +FV  P A D +
Sbjct:    5 FGQNKKEQLEPVQAKVTGSIPAWLQGTLLRNGPGMHTVGESKYNHWFDGLALLHSFSIRDGEVFYRSKYLQSDTYIANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYD-EAGNVLNMGTSVVDKGRTKYVIFKIP------ATVPDSKKKGKSPVKHAEVFCSISSRSLLSPSYYHSFGVTENYVVFLEQPFKLDILKMATAYMRGVSWASCMSFDREDKTYIHIIDQRTRKPVPTKFYTDPMVVFHHVNAYEEDGCVLFDVIAYEDSSLYQLFYLANLNKDFEEKSRLTSVPTLRRFAVPLHVDKDAEVGSNLVKVSSTTATALKEKDGH----VYCQPEVLYEG--LELPRINY-AYNGKPYRYIFAAEVQWSPVPTKILKYDILTKSSLKW-SEESCWPAEPLFVPTPGAKDED 470          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. UniProt/SwissProt
Match: sp|Q99NF1|BCDO2_MOUSE (Beta,beta-carotene 9',10'-oxygenase OS=Mus musculus OX=10090 GN=Bco2 PE=1 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.238e-106
Identity = 200/524 (38.17%), Postives = 292/524 (55.73%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPS-YAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVV-HCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G +P+W+ G L R GPGKFE G D+Y+H FDG+A++ ++ +  G VT++S+++QS +Y  N A  RIV+SEFGT A PDPC+SIF R  + FE   MTDNT+V       + + STET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P  S Y    +PP KKE    ++          GA+++  I +  K+ PSYYHSFG+T+NY I +E P+ + +  ++ +KI G   A+   W PQ  T  HV+D+++G+LL  +Y + P  T+H INA+ED+G IVID C  D+G     Y + NL    + L   +   A S PRR ++PL     +A   NL  L  ++ +A    +    C   + HHE+L +   +E P INY  +NGKKY + YG     +  + L KVD   KT  VW  EE  Y  E +FV  P AD     +ED GV+L+ ++    T +      L+ +DAKS  E+ R E   V +P  FHG F PI
Sbjct:   31 GHIPEWLNGYLLRVGPGKFEFGKDRYNHWFDGMALLHQFRMERGTVTYKSKFLQSDTYKANSAGGRIVISEFGTLALPDPCKSIFERFMSRFEPPTMTDNTNVNFVQYKGDYYMSTETNFMNKVDIEMLERTEKVDWSKFIAVNGATAHPHYDPD-GTAYNMGNSYGPRGSCYNIIRVPPKKKEPGETIH----------GAQVLCSIASTEKMKPSYYHSFGMTKNYIIFVEQPVKMKLWKIITSKIRGKPFADGISWEPQYNTRFHVVDKHTGQLLPGMYYSMPFLTYHQINAFEDQGCIVIDLCCQDDGRSLDLYQLQNLRKAGEGLDQVYELKAKSFPRRFVLPLDVSVDAAEGKNLSPLSYSSASAVKQGDGEIWCSPENLHHEDLEEEGGIEFPQINYGRFNGKKYSFFYGCGFRHLVGDSLIKVDVTNKTLRVW-REEGFYPSEPVFVPVPGAD-----EEDSGVILSVVI----TPNQSESNFLLVLDAKSFTELGRAEV-PVQMPYGFHGTFVPI 532          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. UniProt/SwissProt
Match: sp|Q5RF16|BCDO2_PONAB (Beta,beta-carotene 9',10'-oxygenase OS=Pongo abelii OX=9601 GN=BCO2 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.627e-101
Identity = 194/529 (36.67%), Postives = 286/529 (54.06%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-----NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVP-SYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV-VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG------VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G  P W+ GSL R GPGKFE G DKY+H FDG+A++ ++ +  G VT++S+++QS +Y  N A NRIV+SEFGT A PDPC+++F R  + FE       MTDNT+V       + +  TET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P   SY    +PP          EK D+ + + GA+++  I +  K  PSYYHSFG+T NY I +E PL +++  +  +KI G + ++   W PQ  T  HV+D+ +G+LL   Y + P  TFH INA+ED+G ++ID C  DNG     Y + NL    + L   +  +A S PRR ++PL     +    NL  L  T+ +A    +    C   + H E+L     +E P I Y+ ++GKKY + YG      V  + L KVD   KT  VW  E+  Y  E +FV  P  +     +ED GV+L+ ++    T +      L+ +DAK+  E+ R E   V +P  FHG F PI
Sbjct:   51 GHFPKWLNGSLLRTGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPD-GTAYNMGNSFGPYGFSYKVIRVPP----------EKVDLGETIHGAQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTWFHVVDKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVYNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDQFSGKKYHFFYGCGFRHLVGGDSLIKVDVVNKTLKVW-REDGFYPSEPVFVPAPGTN-----EEDGGVILSVVI----TPNQNESNFLLVLDAKNFGELGRAEV-PVQMPYGFHGTFIPI 557          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. UniProt/SwissProt
Match: sp|Q8HXG8|BCDO2_MACFA (Beta,beta-carotene 9',10'-oxygenase OS=Macaca fascicularis OX=9541 GN=BCO2 PE=2 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 4.015e-100
Identity = 194/528 (36.74%), Postives = 286/528 (54.17%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-----NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVP-SYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNG-----YVVMNL--FVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV-VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPI 1738
            G  P W+ GSL R GPGKFE G DKY+H FDG+A++ ++ +  G VT++S+++QS +Y  N A NRIV+SEFGT A PDPC+++F R  + FE       MTDNT+V       + +  TET+ ++++D   L     V +   + VN ATAH H D + G  + +G +  P   SY    +PP          EK D+E+   GA+++  I    K  PSYYHSFG+T NY I +E PL +++  +  +KI G + ++   W PQ  T  HV+D+++G+LL   Y + P   FHHINA+ED+G ++ID C  DNG     Y + NL    + L   +  +  S PRR ++PL     +    NL  L  T+ +A    +    C   + H E+L     +E P I Y  ++GKKYR+ YG     +  + L KVD   KT  VW  E+  Y  E +FV  P  +     +ED GV+L+ ++    T +      L+ +DAK+ +E+ R E   V +P  FHG F PI
Sbjct:   51 GHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVMSEFGTLATPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPD-GTAYNMGNSFGPFGFSYKVIRVPP----------EKVDLEETTHGAQVICSIAPTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVDKHTGQLLPGRYYSKPFVAFHHINAFEDQGCVIIDLCCQDNGRILEVYQLQNLRKAGEELDQVYNSAGRSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYGQFSGKKYRFFYGCGFRHLVGDSLIKVDVVNKTLKVW-REDGFYPSEPVFVPVPGTN-----EEDGGVILSVVI----TPNQNESNFLLVLDAKNFEELGRAEV-PVQMPYGFHGTFIPI 556          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. UniProt/SwissProt
Match: sp|Q91XT5|BCDO1_RAT (Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 9.361e-99
Identity = 192/535 (35.89%), Postives = 299/535 (55.89%), Query Frame = 2
Query:  176 KQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN---EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSA--PSSP--RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGV------AENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            K+ + P+     G +P W++G+L RNGPG   VG  KY+H FDGLA++  + I DG+V ++S+Y+QS +Y  N+ ANRIVVSEFGT AYPDPC++IF++  ++  +   + TDN  + +   G++ + +TET+ I +IDP  L T+  V +   V VN AT+H H D E G V  +G   A+     Y  F IP      ++    K   +  L  +++   I +R  L+PSYYHSFG+TENY + LE P  + I+ M    + G S A    +  ++KT IH++D+ + + +   + TDP+  FHH+NAYE+ G ++ D   Y++  +    ++ +L   F + +   S P  RR  VPL  D+ +    NL+ + +T  TA  ++ ++D   V+C  E L +   +ELP INY A+NGK YRY++            + K D  TK+S+ W +EE  +  E +FV  P A      DED GV+L+ I+    + D ++   L+ +DAKS  E+ R     V + L  HG+F P
Sbjct:   10 KEQLEPLRATVTGSIPAWLQGTLLRNGPGMHTVGDSKYNHWFDGLALLHSFSIRDGEVFYRSKYLQSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYD-EAGNVLNMGTSIADKGGTKYVMFKIP------ATAPGSKKKGKNPLKHSEVFCSIPSRSLLSPSYYHSFGVTENYVVFLEQPFKLDILKMATAYMRGVSWASCMTFCKEDKTYIHIIDQKTRKPVPTKFYTDPMVVFHHVNAYEEDGCVLFDVIAYEDNSLYQLFYLANLNKDFEEKSRLTSVPTLRRFAVPLHVDKDAEVGSNLVKVSSTTATA--LKEKDDH--VYCQPEVLYEG--LELPRINY-AHNGKPYRYIFAAEVQWSPVPTKILKYDVLTKSSLKW-SEESCWPAEPLFVPTPGAK-----DEDDGVILSAII----STDPQKLPFLLILDAKSFTELARASV-DVDMHLDLHGLFIP 519          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. UniProt/SwissProt
Match: sp|Q9JJS6|BCDO1_MOUSE (Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus OX=10090 GN=Bco1 PE=1 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 2.100e-98
Identity = 192/540 (35.56%), Postives = 300/540 (55.56%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN---EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSA--PSSP--RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGV------AENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            F    K+ + PV     G +P W++G+L RNGPG   VG  KY+H FDGLA++  + I DG+V ++S+Y+QS +Y+ N+ ANRIVVSEFGT AYPDPC++IF++  ++  +   + TDN  + +   G++ + +TET+ I +IDP  L T+  V +   V VN AT+H H D E G V  +G    +     Y  F IP      ++  + K   +  +  A++   I++R  L+PSYYHSFG+TENY + LE P  + I+ M    + G S A    +  ++KT IH++D+ + + +   + TDP+  FHH+NAYE+ G ++ D   Y++  +    ++ +L   F + +   S P  RR  VPL  D+ +    NL+ + +T  TA   ++ +    V+C  E L +   +ELP INY AYNGK YRY++            + K D  TK+S+ W +EE  +  E +FV  P A      DED GV+L+ I+    + D ++   L+ +DAKS  E+ R    +  + L  HG+F P
Sbjct:    5 FGQNKKEQLEPVQAKVTGSIPAWLQGTLLRNGPGMHTVGESKYNHWFDGLALLHSFSIRDGEVFYRSKYLQSDTYIANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYD-EAGNVLNMGTSVVDKGRTKYVIFKIP------ATVPDSKKKGKSPVKHAEVFCSISSRSLLSPSYYHSFGVTENYVVFLEQPFKLDILKMATAYMRGVSWASCMSFDREDKTYIHIIDQRTRKPVPTKFYTDPMVVFHHVNAYEEDGCVLFDVIAYEDSSLYQLFYLANLNKDFEEKSRLTSVPTLRRFAVPLHVDKDAEVGSNLVKVSSTTATALKEKDGH----VYCQPEVLYEG--LELPRINY-AYNGKPYRYIFAAEVQWSPVPTKILKYDILTKSSLKW-SEESCWPAEPLFVPTPGAK-----DEDDGVILSAIV----STDPQKLPFLLILDAKSFTELARASVDA-DMHLDLHGLFIP 519          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. TrEMBL
Match: A0A1S3H8X4 (beta,beta-carotene 15,15'-dioxygenase OS=Lingula unguis OX=7574 GN=LOC106152511 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 4.888e-119
Identity = 210/541 (38.82%), Postives = 323/541 (59.70%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFF---ENE-MTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLS--HVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDK-----FPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENM-------LKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            FKS  K+ + PV G   G +P W+ GS YRNGPGK+EVG  KY+H FDGLA++Q++ I DG++++Q+++++S+++L+NM ANRIVVSEFGT A+PDPC+++F R  ++F   E+E MTDN SV +FP+GD+L+ STET  + +IDP  L T G V     V  N ATAH H D++ G V+ +G      P  A     P  KE   ++            A++V  + + + +  SY HSF +TEN+ + ++ PL I+++ ++  KI G+  A    W    KT+ H++++ +GE ++  + YV DPL  FHHINAYE+ GH+V+D C  ++G     +F+D L+ +       K+  + PRR ++PL  D+K++   NL++L +T  TA +    + K  + C  E LSD    E P +NY   NG+KYRY+YG++ N+       L K D + KT++ W +E   Y  E  FV  P++      +ED G++L+ +L  D T+ T     L+ +DAKS  E+ R EF  V+ P+ FH  F
Sbjct:    5 FKSLEKETLEPVEGRVTGTIPSWLSGSFYRNGPGKYEVGDTKYNHLFDGLALLQKFSIKDGRISYQNKFLKSETFLKNMKANRIVVSEFGTLAHPDPCKTLFQRFFSYFYLDEDEMMTDNCSVNIFPMGDQLYASTETKWLRKIDPETLETPGRVDITQFVATNSATAHPHHDRD-GCVYNIGNCFKGRPRLAVIRWNPPSKEAPDQIQ----------NAELVASLPSPYYVKYSYSHSFALTENFIVVIQQPLIINVLSILTAKIRGTPFANGMYWDKNCKTVFHIINKKTGEAINPGYNYVGDPLLLFHHINAYEEDGHVVVDVCSAEDGSTFDMIFLDKLQSEDFKKLMKKNGNTFPRRFVLPLNIDKKAS---NLVTLRDTRATATM----SGKNEIFCKDERLSD-ILTEFPMVNYELVNGRKYRYMYGISTNVVGDYSTGLVKTDVQNKTTVRW-DETDCYPSEPWFVPSPDSK-----EEDDGIVLSSVL-NDVTMKT----FLLVLDAKSFTELGRAEF-DVAPPMGFHVRF 514          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. TrEMBL
Match: T1K9Z3 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107362151 PE=3 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.044e-115
Identity = 209/549 (38.07%), Postives = 317/549 (57.74%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKD-------------KFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAEN-----MLKKVDTETKTSIVWCNEEPGYA-CESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVS-IPLSFHGVFQPINS 1744
             +S L++   PVT   IG +P W+KG L RNGPG  +VG D+Y H FDGLA++ ++ I++G VT+++++++S++Y RNM ANRIVVS+FGT AYPDPC+S+  R  ++F   + TDN SV ++PVGDEL+ STE+  +H+IDP  + T+GS      V VN  TAH HI+   G+V+ LG     + SY    + P         NE     K    A ++  I  R K+ PSYYHSF +TE++ + +E PL  SI  ++     G + +++ KW P+ KT  +V+D+++GE+++  YV++P   FH INAY++ GH++ D C Y++G +V  LF D L               K  +S  S  RR ++PL  D      +NL++L  +  +A  V N ++  V+H        N   E+P INY  YNGKKY+Y Y +  N      L K D  TK +++W ++  G A  E +F+  P A      DED GV+L+ +L   + ++ E +  L+ +D KS KE+ R  F++ S I   FHG+F P+ S
Sbjct:   30 LRSCLQECSEPVTAKVIGQIPSWVKGYLLRNGPGLRKVGLDEYCHLFDGLALIHQFTIDNGSVTYRNRFLRSQAYKRNMKANRIVVSDFGTRAYPDPCKSLLGRYMSYFSFKQFTDNDSVSIYPVGDELYASTESTFLHKIDPETIDTLGSTDLAQYVAVNTQTAHPHIEP-NGVVYNLGSNFCGIGSYNVIKVDP---------NES----KGFKSASLLTSIPVRNKMYPSYYHSFLVTEDFIVFIEQPLVTSIPSILLNHFIGGAYSKSLKWRPEFKTRFNVIDKSNGEVIASNYVSEPFAFFHTINAYQEDGHVICDICCYEDGSIVNALFTDKLAQISDQSDENKAESVKDFQSLRSQARRYVLPLNVDSSDESSVNLVTLKGS--SAKAVRNGDEIEVIHESLTTTGSN-MAEMPQINYRHYNGKKYQYFYSITRNEDYLAQLLKCDVITKETVLWSDQ--GCAPSEPVFIPRPGA-----VDEDDGVVLSAVLY--EKIENEGF--LLVLDGKSFKEMARAHFKTPSAITSDFHGLFCPVES 550          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. TrEMBL
Match: T1KM42 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107365606 PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.447e-111
Identity = 203/554 (36.64%), Postives = 312/554 (56.32%), Query Frame = 2
Query:  158 TFKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKD-------------KFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSD--NAFMELPTINYNAYNGKKYRYLYGVAEN-----MLKKVDTETKTSIVWCNEEPGYAC---ESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVS-IPLSFHGVFQPINS 1744
            + +S L++   PVT   +G +P W+KG L RNGPG  ++G D+Y H FDGLA++ ++ I++G VT+++++++S++Y+RNM ANRIVVS+FGT AYPDPC+S+  R  ++F   + TDN SV ++PVGDEL+ STE+  +H+IDP  + + GS      V VN  TAH H D   G+++ LG       SY    I P             +  K  T   I+  I  R  + PSYYHSF +TE++ I +E PL  SI  ++     G S + + KW P+ KT  +V+ +++GE++++ YV++P   FH INAY++ GHI+ D C Y +G +V  LF D L               K  +S  S  RR ++PL  D  +    NLI L  ++  A    N N+   +   +E L+   ++  E+P INY+ YNGK Y+Y Y +A        L K + +TK +++W +      C   E +F+  P A      DED GV+L+ +L   + ++ E +  L+ +D KS KE+ R  F++ S I   FHG+F P+ S
Sbjct:   23 SLRSCLQECSEPVTAKVVGQIPTWVKGYLLRNGPGLRKIGPDEYRHLFDGLALIHQFTIDNGYVTYRNKFLRSEAYVRNMKANRIVVSDFGTRAYPDPCKSLLGRYMSYFSFKQFTDNDSVSIYPVGDELYASTESTFLHKIDPKTINSTGSTNMAQYVAVNTQTAHPHTDP-NGVIYNLGSNFSGKGSYNVIKIDP-------------NASKGFTSTSILTSIPVRHPMYPSYYHSFLVTEDFIIFIEQPLVSSIPSILLNHFTGGSFSASLKWRPEFKTRFNVIKKSNGEIIANNYVSEPFAFFHTINAYQEDGHIICDICCYQDGSIVNVLFTDKLSQISSQAAESKAESVKEFQSLQSQARRYVLPLNVDSSNESSTNLIRLKGSSAKAK--RNGNE---IEVFYEPLTSTGSSMAEMPQINYHHYNGKNYQYFYSIARGKDLLTQLLKCNVKTKETVIWSDA----GCTPSEPVFIPKPGAI-----DEDDGVILSAVLY--EKIENEGF--LLVLDGKSFKELARAHFKTPSAITSDFHGLFYPVES 544          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. TrEMBL
Match: A0A3B4ZG78 (Beta-carotene 15, 15-dioxygenase 2, like OS=Stegastes partitus OX=144197 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 8.036e-111
Identity = 218/551 (39.56%), Postives = 308/551 (55.90%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFF----TIPP----IKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHV-YVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK----------DKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPG-YACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG 1750
            P+     G +P WI GS  RNGPGKFE G D+Y+H FDG+AM+ R++I +G VT+ S++++S SY+RN   NRIVVSEFGT A PDPC++IF R  S F   E TDN SV       + + STET+ + R+DP  L T   V +   + VN ATAH H D+E G  + +G       SY FF     +PP      KEDS+           LTGA++V  I A     PSYYHSF ++ENY + +E P+ + ++  M  +I G S  +   W PQ +TI H+++R++GE+ S V Y T P+FT H INA+ED G +V+D C  D+G V+ +  +++L+          D +     + PRR ++PLK DE++  D NL++LPN   TA + +       V+  HEEL D+       +E P INY+ +NG+ YRY Y      V  + L K+D  TK   VW    PG +  E +FV  P A      +ED GV+L+ I+    T   E+   L+ +DAK+  E+ R E   V+IP   HGVF   N +G
Sbjct:   27 PIPTTIKGTIPTWINGSFLRNGPGKFEFGEDRYTHWFDGMAMMHRFHICEGNVTYNSRFLRSDSYVRNSEKNRIVVSEFGTLAMPDPCKNIFARFFSRFTIPEATDNASVNFVKYKGDYYVSTETNYMRRVDPQSLETKEKVDWSQYIAVNAATAHPHYDRE-GATYNMG------NSYGFFYNIIRVPPPGEKAAKEDSAD----------LTGAQVVCSIQASESRKPSYYHSFVMSENYIVFVEQPIKLDLLKFMLFRIAGKSFHKIMSWDPQCETIFHLVNRHTGEVQSEVKYHTAPMFTLHQINAFEDNGFLVMDMCCGDDGEVIADFTLENLRRDAGEEMDKVDFYNSMCRNLPRRYVLPLKVDEETPLDQNLVTLPNYKATAKMTKPGE----VYMTHEELHDDELLQYGGLEFPQINYDQHNGRPYRYFYACGFGHVFSDSLLKMDVHTKELKVW--RYPGLFPSEPVFVASPKAT-----EEDDGVVLSVII----TPREEKSTFLLVLDAKTFTELGRAEV-PVNIPYGTHGVF---NQMG 541          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. TrEMBL
Match: T1KM44 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107365605 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 1.704e-110
Identity = 203/550 (36.91%), Postives = 310/550 (56.36%), Query Frame = 2
Query:  161 FKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFE-NEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKD-------------KFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSD--NAFMELPTINYNAYNGKKYRYLYGVAEN-----MLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVS-IPLSFHGVFQPINS 1744
             +S LK+   PVT   +G +P W+KG L RNGPG  ++G D+Y H FDGLA++ ++ I++G VT+++++++S++Y RNM ANRIVVS+FGT AYPDPC+S+  R  ++F   + TDN SV ++PVGDEL+ STE+  +H+IDP  + T GS+     V VN  TAH HI+   G+V+ LG       SY    + P             +  K  T   ++  I  R ++ PSYYHSF +TE++ I +E PL  SI  ++     G + + A KW P+ KT  +V+ +++GE+++  YV++P   FH INAY++ GHI+ D C Y +G +V  LF D L               K  +S  S  RR ++PL  D  +    NL  L  +  +A  + N N+   +   HE L+   ++  E+P INY  YNGK Y+Y Y +         L K + +TK +++W ++      E +F+  P A      DED GV+L+ +L  +  ++ E +  L+ +D KS KE+ R  F++ S I   FHG+F PI S
Sbjct:   57 LRSCLKECTEPVTAKVVGQIPTWVKGYLLRNGPGLRKIGPDEYRHLFDGLALIHQFTIDNGYVTYRNKFLRSEAYKRNMKANRIVVSDFGTRAYPDPCKSLLGRYMSYFSFKQFTDNDSVSIYPVGDELYASTESTFLHKIDPKTIDTTGSIDLAQYVAVNTQTAHPHIE-SNGVVYNLGSNFSGKGSYNVIKVDP-------------NASKGFTSTSLLTSIPVRNQMYPSYYHSFLVTEDFIIFIEQPLVTSIPSILLNHFTGGAYSAALKWRPEFKTRFNVIKKSNGEIIADNYVSEPFAFFHTINAYQEDGHIICDICCYQDGSIVNALFSDKLAQISNQAAESKAESVKEFQSLKSQARRYVLPLNIDSSNELLTNLNRLKGS--SAKAIRNGNE---IEVTHEPLTSTGSSMAEMPQINYRHYNGKNYQYFYSITRGKDFLTQLLKCNVKTKETVIW-SDAGCTPSEPVFIPKPGAI-----DEDDGVILSAVLYEN--IENEGF--LLALDGKSFKELARAHFKTPSAITSDFHGLFCPIES 577          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Cavefish
Match: bco2l (beta-carotene 15, 15-dioxygenase 2, like [Source:ZFIN;Acc:ZDB-GENE-010509-1])

HSP 1 Score: 338.961 bits (868), Expect = 1.288e-108
Identity = 210/536 (39.18%), Postives = 299/536 (55.78%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEM-TDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAF--FTIPPIK-KEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-------DKFPKSAPSS-PRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEEL-SDNAF----MELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPG-YACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            P+  V  G +P WI GS  RNGPGKFE G  +Y+H FDG+A++ R++I DG VT+ S+++QS SY++N+  NRIVVSEFGT A PDPC++IF R  + F+ +  TDN  V       + + STET  + +IDP  L T   V +   V +N ATAH H  ++ G  + LG  +Y    Y +    +PP + K D +           L+GA+I+  I A     PSYYHSF ++ENY I +E P+ + ++  M  ++ G S  +   W PQ  T+ HV+DR +G+L S  Y T  +FT H INAYED G++++D C  D+G V+ +  V++L+       DKF  S  ++ PRR ++PL+ + +   D NLISLPNT  TA   E       V C HE L +DN      +E P INY+ YN + YRY Y      V  + L K+D E K   VW    PG +  E +FV  P+A      DED GV+++ I+    T    +   L+ +DAK+  E+ R E   V IP   HG+F
Sbjct:   47 PIATVIKGNIPSWINGSFLRNGPGKFEFGESRYNHWFDGMALMHRFHIRDGLVTYSSRFLQSDSYVQNLEKNRIVVSEFGTLAMPDPCKNIFARFFSRFQIKYSTDNAGVSFVKYKGDFYVSTETTYMRKIDPQSLETKEKVDWSTYVAINAATAHPHYGRD-GAAYNLG-NSYGARGYFYNIIRVPPAEGKTDGAD----------LSGAEILCSIPAADPRKPSYYHSFAMSENYVIFIEQPIKLDLLKFMLYRVQGKSFHKVMSWEPQLDTVFHVIDRRTGQLSSTRYYTSAMFTLHQINAYEDNGYLIMDMCCGDDGNVIGDFTVENLRKAAGEELDKFYNSLCTNLPRRYVLPLEVNGEEPNDKNLISLPNTTATAVKTETG-----VFCTHENLYNDNLLEYGGLEFPQINYSHYNARPYRYFYACGFGHVFGDSLLKIDLEGKKLKVW--RHPGLFTSEPVFVPAPDAK-----DEDDGVVMSVII----TPRERKSSFLLVLDAKTFTELGRAEV-PVDIPSGTHGLF 553          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Cavefish
Match: bco2b (beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GENE-060421-7448])

HSP 1 Score: 316.235 bits (809), Expect = 4.662e-100
Identity = 186/529 (35.16%), Postives = 285/529 (53.88%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFV-------DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH--CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P++    G +P WI G+L RNGPGKFE G+ +++H FDG+A++ ++ I  G VT+ S+++ S  Y  N  ++RIVVSEFGT A PDPC++ F R LS F + + TDN SV       + + STET+ +HRIDP  L T   V +   + VN ATAH H D +    +           Y    +PP          EK   ++ L GA ++  I +  K  PSYYHSF ++ENY + +E P+ I ++ ++  K+ G  I++   W  +++T+ HV+++++G+     Y T PL TFH IN YE+ G I++D C  D+G  + N  +       DSL + +       PRR ++PL   + + C  NL + P++  TA I   +N     H   H ++L +   +E P INY   N   YRY Y      +  + L K+D + K  +VW  ++  Y  E +FV  PNA       ED GV+L+ ++  +K    +R   L+ +DAK+ +E+ R E   V+IP  FHG FQ
Sbjct:   30 PISTRIRGNVPSWIHGNLLRNGPGKFEFGNTQFNHWFDGMALLHQFRIEGGTVTYMSRFLNSDCYKMNAESDRIVVSEFGTLAMPDPCKNFFQRFLSRFEKPQPTDNASVSFVQYKGDYYVSTETNFMHRIDPETLETKEKVDWSKFIAVNGATAHPHTDPDGTTYNMGNSYTSKGAYYNIIKVPP----------EKVSADETLEGATVICTIPSGDKTKPSYYHSFAMSENYVVFVEQPIKIDLLKVVTGKLRGKGISDGVYWDSKQQTVFHVINKHTGKQSPIKYYTQPLSTFHQINCYEEDGFIIMDMCCSDDGKAINNFMIQNLRKTGDSLDEVYNTICRIFPRRFVLPLHVGKDTPCGQNLNTRPDSPATA-IKTGKNKVLCTHEDLHSDDLHEYGGLEFPQINYAKCNTHPYRYFYACGFRHLVGDSLIKMDIQDKQMMVW-KQQGYYPSEPVFVPSPNA-----VQEDDGVVLSVVITPNK----DRSTFLLVLDAKNFEELGRAEV-PVNIPYGFHGAFQ 536          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Cavefish
Match: bco2b (beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GENE-060421-7448])

HSP 1 Score: 315.849 bits (808), Expect = 7.900e-100
Identity = 186/529 (35.16%), Postives = 285/529 (53.88%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFV-------DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH--CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P++    G +P WI G+L RNGPGKFE G+ +++H FDG+A++ ++ I  G VT+ S+++ S  Y  N  ++RIVVSEFGT A PDPC++ F R LS F + + TDN SV       + + STET+ +HRIDP  L T   V +   + VN ATAH H D +    +           Y    +PP          EK   ++ L GA ++  I +  K  PSYYHSF ++ENY + +E P+ I ++ ++  K+ G  I++   W  +++T+ HV+++++G+     Y T PL TFH IN YE+ G I++D C  D+G  + N  +       DSL + +       PRR ++PL   + + C  NL + P++  TA I   +N     H   H ++L +   +E P INY   N   YRY Y      +  + L K+D + K  +VW  ++  Y  E +FV  PNA       ED GV+L+ ++  +K    +R   L+ +DAK+ +E+ R E   V+IP  FHG FQ
Sbjct:   34 PISTRIRGNVPSWIHGNLLRNGPGKFEFGNTQFNHWFDGMALLHQFRIEGGTVTYMSRFLNSDCYKMNAESDRIVVSEFGTLAMPDPCKNFFQRFLSRFEKPQPTDNASVSFVQYKGDYYVSTETNFMHRIDPETLETKEKVDWSKFIAVNGATAHPHTDPDGTTYNMGNSYTSKGAYYNIIKVPP----------EKVSADETLEGATVICTIPSGDKTKPSYYHSFAMSENYVVFVEQPIKIDLLKVVTGKLRGKGISDGVYWDSKQQTVFHVINKHTGKQSPIKYYTQPLSTFHQINCYEEDGFIIMDMCCSDDGKAINNFMIQNLRKTGDSLDEVYNTICRIFPRRFVLPLHVGKDTPCGQNLNTRPDSPATA-IKTGKNKVLCTHEDLHSDDLHEYGGLEFPQINYAKCNTHPYRYFYACGFRHLVGDSLIKMDIQDKQMMVW-KQQGYYPSEPVFVPSPNA-----VQEDDGVVLSVVITPNK----DRSTFLLVLDAKNFEELGRAEV-PVNIPYGFHGAFQ 540          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Cavefish
Match: bco2b (beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GENE-060421-7448])

HSP 1 Score: 315.849 bits (808), Expect = 1.499e-99
Identity = 186/529 (35.16%), Postives = 285/529 (53.88%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFV-------DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH--CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P++    G +P WI G+L RNGPGKFE G+ +++H FDG+A++ ++ I  G VT+ S+++ S  Y  N  ++RIVVSEFGT A PDPC++ F R LS F + + TDN SV       + + STET+ +HRIDP  L T   V +   + VN ATAH H D +    +           Y    +PP          EK   ++ L GA ++  I +  K  PSYYHSF ++ENY + +E P+ I ++ ++  K+ G  I++   W  +++T+ HV+++++G+     Y T PL TFH IN YE+ G I++D C  D+G  + N  +       DSL + +       PRR ++PL   + + C  NL + P++  TA I   +N     H   H ++L +   +E P INY   N   YRY Y      +  + L K+D + K  +VW  ++  Y  E +FV  PNA       ED GV+L+ ++  +K    +R   L+ +DAK+ +E+ R E   V+IP  FHG FQ
Sbjct:   56 PISTRIRGNVPSWIHGNLLRNGPGKFEFGNTQFNHWFDGMALLHQFRIEGGTVTYMSRFLNSDCYKMNAESDRIVVSEFGTLAMPDPCKNFFQRFLSRFEKPQPTDNASVSFVQYKGDYYVSTETNFMHRIDPETLETKEKVDWSKFIAVNGATAHPHTDPDGTTYNMGNSYTSKGAYYNIIKVPP----------EKVSADETLEGATVICTIPSGDKTKPSYYHSFAMSENYVVFVEQPIKIDLLKVVTGKLRGKGISDGVYWDSKQQTVFHVINKHTGKQSPIKYYTQPLSTFHQINCYEEDGFIIMDMCCSDDGKAINNFMIQNLRKTGDSLDEVYNTICRIFPRRFVLPLHVGKDTPCGQNLNTRPDSPATA-IKTGKNKVLCTHEDLHSDDLHEYGGLEFPQINYAKCNTHPYRYFYACGFRHLVGDSLIKMDIQDKQMMVW-KQQGYYPSEPVFVPSPNA-----VQEDDGVVLSVVITPNK----DRSTFLLVLDAKNFEELGRAEV-PVNIPYGFHGAFQ 562          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Cavefish
Match: bco2b (beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GENE-060421-7448])

HSP 1 Score: 314.309 bits (804), Expect = 4.776e-99
Identity = 186/529 (35.16%), Postives = 284/529 (53.69%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFV-------DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVH--CHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQ 1732
            P++    G +P WI G+L RNGPGKFE G+ +++H FDG+A++ ++ I  G VT+ S+++ S  Y  N  ++RIVVSEFGT A PDPC++ F R LS F + + TDN SV       + + STET+ +HRIDP  L T   V +   + VN ATAH H D +    +           Y    +PP          EK   ++ L GA ++  I +  K  PSYYHSF ++ENY + +E P+ I ++ ++  K+ G  I++   W  +++T+ HV+++++G+     Y T PL TFH IN YE+ G I++D C  D+G  + N  +       DSL + +       PRR ++PL   + + C  NL + P++  TA I   +N     H   H ++L +   +E P INY   N   YRY Y      +  + L K+D + K  +VW  ++  Y  E +FV  PNA       ED GV+L+ ++  +K   T     L+ +DAK+ +E+ R E   V+IP  FHG FQ
Sbjct:   49 PISTRIRGNVPSWIHGNLLRNGPGKFEFGNTQFNHWFDGMALLHQFRIEGGTVTYMSRFLNSDCYKMNAESDRIVVSEFGTLAMPDPCKNFFQRFLSRFEKPQPTDNASVSFVQYKGDYYVSTETNFMHRIDPETLETKEKVDWSKFIAVNGATAHPHTDPDGTTYNMGNSYTSKGAYYNIIKVPP----------EKVSADETLEGATVICTIPSGDKTKPSYYHSFAMSENYVVFVEQPIKIDLLKVVTGKLRGKGISDGVYWDSKQQTVFHVINKHTGKQSPIKYYTQPLSTFHQINCYEEDGFIIMDMCCSDDGKAINNFMIQNLRKTGDSLDEVYNTICRIFPRRFVLPLHVGKDTPCGQNLNTRPDSPATA-IKTGKNKVLCTHEDLHSDDLHEYGGLEFPQINYAKCNTHPYRYFYACGFRHLVGDSLIKMDIQDKQMMVW-KQQGYYPSEPVFVPSPNA-----VQEDDGVVLSVVITPNKVKST----FLLVLDAKNFEELGRAEV-PVNIPYGFHGAFQ 555          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005436.1 (pep scaffold:Pmarinus_7.0:GL479905:4246:8086:-1 gene:ENSPMAG00000004948.1 transcript:ENSPMAT00000005436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 2.160e-34
Identity = 60/139 (43.17%), Postives = 86/139 (61.87%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPV---GDELFTSTETDVIHRIDPVDLTTIGSVRF 619
            G +P W++G L RNGPG+  VG   Y H FDGLA+++++   DG+V F S+Y+QS +Y +N+AANRIVV EFGT    DP   +  +   +  N M DNT  C+  V   G +++  TET ++ R+DP  L T+  VR 
Sbjct:   22 GSVPGWLRGCLIRNGPGRHCVGPSCYQHWFDGLALLRKFRFRDGRVWFSSRYLQSDTYKKNVAANRIVVPEFGTRVELDPSLGLLEKSITYLRNIMPDNTDNCLINVVRYGQDVYACTETTIMRRLDPDTLDTLDKVRI 160          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003238.1 (pep scaffold:Pmarinus_7.0:GL480895:20195:23472:-1 gene:ENSPMAG00000002951.1 transcript:ENSPMAT00000003238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 8.350e-28
Identity = 83/253 (32.81%), Postives = 120/253 (47.43%), Query Frame = 2
Query: 1031 ELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYD-------NGYVVMNLFV--DSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCV----VHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVA-----ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            ++L   Y    + +FHHINAYED GHIV D C  D       +  ++ NL    D+L   + +   + PRR ++PL     S    NL SLP T  +A +   R+D  V       H +++ +   +E P I+Y  +N + YRY Y         N L KVD  TK +  W   +  Y  E +FV  P A+      ED GV+L+ ++  DK    E+   L+ +DA S  E+ R       IP  FHG+F P
Sbjct:    1 QILPVAYHMKAMMSFHHINAYEDDGHIVNDLCCVDHYCTADEDSLMLKNLRSSGDALDQLYNRRPMTYPRRFVMPLSVGPDSPRGTNLCSLPYTTASATL---RDDGKVWLEPEPLHGDDVDEYGGLEFPRIHYERFNARPYRYFYSCGFQHMIPNSLIKVDVTTKETKHW-QVDGYYPSEPVFVPSPGAE-----GEDEGVVLSVVISPDK----EKPSFLLVLDASSFMELGRAVVPR-DIPYGFHGIFAP 239          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003844.1 (pep scaffold:Pmarinus_7.0:GL489646:340:3314:1 gene:ENSPMAG00000003519.1 transcript:ENSPMAT00000003844.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 9.879e-16
Identity = 55/166 (33.13%), Postives = 82/166 (49.40%), Query Frame = 2
Query: 1262 NLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF--MELPTINYNAYNGKKYRYLY------GVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            NL+++  T   A +      K  + C  EEL    F  ++LP IN   Y+GKKYRYL+      G+    + K+D ET+ + +W   + G+  E +FV  P+A       ED GVLL      D     +    +V IDA+ MKE+ R    S+ +P+  HG+F P
Sbjct:   16 NLVTMSGTTAQALL----QKKGKIECIPEELFPGEFSDIDLPCINPR-YHGKKYRYLFAIQFDGGITSKRMVKLDLETRETRLW-EADNGWCGEPVFVASPDAS-----AEDDGVLLCVTASHDAAHGVD----IVVIDAREMKELGRARTPSL-LPMDMHGIFIP 165          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Nematostella
Match: EDO28841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5C2])

HSP 1 Score: 280.026 bits (715), Expect = 5.611e-87
Identity = 179/532 (33.65%), Postives = 292/532 (54.89%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFF--ENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIG----SVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHH----EELSDNAFMELPTINYNAYNGKKYRYLYGVAE------NMLKKVDTETKTSIVWCNEEPGY-ACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            P+    IG +P W+ G+L RNGPGKFE G   Y+H FDGL+++ R+ I++G+V + +++++SK+Y+ N  ANRI +SEFGT A PDPC++IF+R  +++   +++TDN  V V  + ++++  TET  + +IDP  L   G    S    +   ++ + AH H + + G  +  G        +  + +PP  KE+++        E    GAK++  I+A  K   +Y HSFG+TEN++I LE P  +S+  ++   ++G + ++   W P+ +T IHVM + +GE ++  + TDP+F FHHINA+E+K  IV+D  GY +  +V +L++  LK +      +  R   V L    +    I    +P+TN                 HH    E L  N  +ELP INY   NG+KY Y++ +        + L K++T TK +  W N  PG  A E +FV  P+A+     DED GV+L+ ++     V+   +  L+ +D K+ +E+ R E  SV +P++ HG F P
Sbjct:   19 PIQAKVIGQIPPWLNGTLLRNGPGKFEFGDTSYNHWFDGLSLLHRFTIHNGEVEYFNRFLRSKAYVENTKANRITLSEFGTNALPDPCKNIFDRYFSYYFGGDDITDNGLVNVVEIKEKMYAVTETPFLTQIDPQSLDVQGRLDASKDMKDPHPLHSSIAHPHQESD-GTFYNFGHTRGRFAKFNIYMVPPKSKENTT--------EDPFDGAKVLCSIDA--KAGETYVHSFGMTENFFILLENPYFMSVPKVLTKNVFGWAFSKCLYWDPKCQTRIHVMCKKTGEEMA-TFTTDPVFVFHHINAFENKEEIVVDVVGYKDTKLVDDLYLHELKRRLKSEDQNEGR---VSLGEFRRYRLPIPNKKIPSTNPEVQ-------------HHVPKFEVLYSN--LELPQINYERCNGRKYTYVFALTAANSPVMDTLVKINTVTKETKTWGN--PGLVASEPVFVPKPDAE-----DEDEGVVLSAVI---DVVNGNTF--LLLLDGKTFEELGRAEV-SVMMPMNIHGRFVP 507          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Nematostella
Match: EDO44354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVX8])

HSP 1 Score: 261.536 bits (667), Expect = 6.188e-80
Identity = 178/535 (33.27%), Postives = 289/535 (54.02%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFF--ENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIG----SVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDK---GHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHH----EELSDNAFMELPTINYNAYNGKKYRYLYGVAE------NMLKKVDTETKTSIVWCNEEPGY-ACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            P+    IG +P W+ G+L RNGPGKFE G   Y+H FDG +++ R+ I++G+V + +++++SK+Y+ N  ANRI  SEFGT A PDPC++IF+R  +++   +++TDN  V V  + ++++  TET  + +IDP  L   G    S    +   ++ + AH H + + G  +  G        +  + +PP  KE+++        E    GAK++  I+A  K   +Y HSFG+TEN++I LE P  +S+  ++   ++G + ++   W P+  T IHVM + +GE ++  + TDP+F FHHINA+E+K     IV+D  GY +  +V +L++  LK +      +  R   V L    +    I    +P+TN                 HH    E L  N  +ELP INY   NG+KY Y++ +        + L K++T TK +  W N  PG  A E +FV  P+A+     DED GV+L+ ++     V+   +  L+ +D K+ +E+ R E  SV +P++ HG F P
Sbjct:   19 PIQAKVIGQIPPWLNGTLLRNGPGKFEFGDTSYNHWFDGQSLLHRFTIHNGEVEYFNRFLRSKAYVENTKANRITRSEFGTNALPDPCKNIFDRYFSYYFGGDDITDNGLVNVVEIKEKMYAVTETPFLTQIDPQSLDVQGRLDASKDMKDPHPLHSSIAHPHQESD-GTFYNFGHTRGRFAKFNIYMVPPKSKENTT--------EDPFDGAKVLCSIDA--KAGETYVHSFGMTENFFILLENPYFMSVPKVLTKNVFGWAFSKCLYWDPKCPTRIHVMCKKTGEEMA-TFTTDPVFVFHHINAFENKEEIVEIVVDVVGYKDTKLVDDLYLHELKRRLKSEDQNEGR---VSLGEFRRYRLPIPNKKIPSTNPEVQ-------------HHVPKFEVLYSN--LELPQINYERCNGRKYTYVFALTAANSSVMDTLVKINTVTKETKTWGN--PGLVASEPVFVPKPDAE-----DEDEGVVLSAVI---DVVNGNTF--LLLLDGKTFEELGRAEV-SVMMPMNIHGRFVP 510          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Nematostella
Match: EDO46083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR05])

HSP 1 Score: 239.58 bits (610), Expect = 1.406e-71
Identity = 170/543 (31.31%), Postives = 271/543 (49.91%), Query Frame = 2
Query:  152 LFTFKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFF----ENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIV--TVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHH----EELSDNAFMELPTINYNAYNGKKYRYLYGVAE-------NMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            +FT  S L+    PV     G +P W+ G+L RNGPGKFE G  +Y+H FDG A++ R+ I++GKV + +++++SKS+L N  ANRI   E+GT A PDPC+SIF+R  +++    + ++TDN  V V  +    +  +E  V+ +ID   L  IG V     +   ++ + AH H ++  G V+  G        Y  + +PP  KE          +EK + GA+++  ++       +Y HSFG++E+Y+I LE P   SI   +    +G ++ + F W P + + IHV+ R +G+ L+ V+ TDP+F FHHINA+E  G I++D   Y +G ++  L +  ++D   K   +  +   +P       A       LPN        E          HH    E L D   MELP INY   N K+Y Y+YG+         + + K++T +K    W      +  E +FV  P         ED GV+L+ ++    T +   Y  L+ +DA++  E+ R     +    + HG F
Sbjct:   11 IFTSHSELE---LPVQAKITGQIPPWLSGTLIRNGPGKFEFGEFEYNHIFDGPALLYRFTIDNGKVEYFNKFLRSKSFLENTKANRITHMEYGTNAVPDPCKSIFHRYFSYYFGSDKEKITDNCLVNVIELKKRFYAVSELPVLWQIDSQSLDVIGKVDVSTDMDDPLDNSLAHPH-EEPDGTVYNYGIKRGRFTKYNIYKVPPRSKESP--------LEKTMAGAQVICSLSPTKA--EAYVHSFGMSESYFILLENPFFFSIPRFLARSFFGWTLDKCFYWDPTQLSRIHVLCRKTGKELA-VFTTDPMFVFHHINAFEKNGEIILDVVAYPDGDIMNGLLIQDMRDFCNKKGRTEHQ---IP-------AGQFRRYHLPNP------AERGRSTSSEEPHHIFNFEVLYDK--MELPRINYEHCNTKEYTYVYGLTNTSSSLLYDEIVKINTFSKEVKTWRFPN-HFPSEPVFVPKPGG-----VREDEGVVLSMVI---DTANGNTY--LLVLDAQTFDELGRATVPEIGAS-TIHGRF 508          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Nematostella
Match: EDO36712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU1])

HSP 1 Score: 219.55 bits (558), Expect = 3.439e-64
Identity = 156/529 (29.49%), Postives = 258/529 (48.77%), Query Frame = 2
Query:  212 GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFF-ENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVR----FPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKS------APSSPRRLIVPLKFDE----KSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAE-------NMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQS-LVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            G +P WIKG+L RNGPG +E+G + Y+H FDGLA++  Y I +GKVT+ S+Y++S ++    + N IV +EF T   PDPC++IF R  ++F   + TDN SV V  +  + +  +++  +   D   L  + S          + +   T H H D E G V+ +         +    IPP  K      +  + ME    G K++     + KL   YYHSF +T NY++ +E P  +++  ++  K+ G S  +  KW   + +  ++++R SG+ ++  Y  D  F+FHH+NA+E    + +D   Y +  +V   ++  L+ K P+       A  + RR  +P+  +     K         +P  +      ++R+ K + +           +ELP INY   NGK YRY+YGV         N + KVD   K +  W  E+  Y  E +F+  P A+     +ED G +++ +      V T+  +S L+F+D K+ KE+ R       I  S HG+F
Sbjct:   21 GNVPAWIKGNLLRNGPGVYEIGKEHYNHWFDGLAVLHNYKIEEGKVTYNSRYLRSHAFDEAQSKNGIVYAEFATPIPPDPCKNIFARFFSYFVPPKRTDNCSVNVVALKGKTYAVSDSPFLIGFDENSLQVLSSYNMRKDLQGPIRMFSLTPHPHED-EHGYVYNVAVTMDKGTRFNIVKIPPDPKRSLPGESTCHPME----GLKVLASFQPKNKL--CYYHSFAMTPNYFVFIENPFVVNVFALLTMKVKGRSFHDCMKWDATQPSRFYLVERKSGKCIAR-YDADCFFSFHHVNAFESDADVFVDIVCYPDARIVYQYYLHHLRTK-PEHEISKGYADPALRRYRIPIPTNHAPKSKRKKSFQQYKMPKYS------DDRDYKLLYYG----------IELPQINYQFANGKPYRYVYGVGPRRRGDFLNQIIKVDVLAKNAKFW-YEQDCYPSEPVFIAAPRAE-----EEDEGCVMSAV------VGTKGKKSFLLFLDGKTFKELARAVV-DCPIAYSLHGMF 511          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Nematostella
Match: EDO43043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZS6])

HSP 1 Score: 84.3445 bits (207), Expect = 3.773e-17
Identity = 86/329 (26.14%), Postives = 141/329 (42.86%), Query Frame = 2
Query:  176 KQYMYPVTGVNI-GVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIV-VSEFGTTAYPDPCRSIFNRLSNFFEN-----EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFL----GFANYPVPSYAFFTIPPIKKEDSSRLNEK--YDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYI-HLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYV---TDPLFTFHHINAYEDKGHI 1111
            K+Y Y V   +I G +PD + G+ +RNGPG  EV   K  H  DG  MV      +G+V F+S++++SK +       +++ V + GT +     RS  + L++F +      +  + ++   F  G +L T  ET + H +DP  L T+G       + +    AH  ID E   +  +    GF   P      F       +   RL +K  + +E L                  +Y H F +  +YY+ H+   +T S++  +K     SS  E  K++P   +   ++ R    L S   +   TDP   FH   A +D   I
Sbjct:   25 KEYSYWVPEADIVGRIPDDLFGTFFRNGPGVNEVYGIKLKHPIDGDGMVCAVTFQNGRVHFKSKFVESKHHREEREQRKLLYVGQMGTKST-SILRSSASLLTSFLQGKFPRIKFRNPSNTNSFYWGGKLITCYETGIPHCLDPYSLETLGPDDLNGALELKALAAHFRIDAEKERIVCISVRPGFRRAPCLGIYEF-------DRRWRLCQKQLHHIEGL------------------NYSHDFILLPDYYVFHMTPFVTTSMLLTVKILSGWSSPGEEMKYFPGLPSRFVIIPRTQSRLKSQGIIQVDTDPCHIFHFGTASQDGDKI 327          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Medaka
Match: bco2l (beta,beta-carotene 9',10'-oxygenase [Source:NCBI gene;Acc:101170850])

HSP 1 Score: 322.783 bits (826), Expect = 7.461e-103
Identity = 191/496 (38.51%), Postives = 274/496 (55.24%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN-EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-------DKFPKS-APSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPG-YACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTV 1618
            P+     G +P WI GS  RNGPGKFE G DKY H FDG+AM+ R++I DG VT+ S++++S SY++N+  NRIVVSEFGT A PDPC+SIF R  ++F+  + TDN +V       + + STET+ + R+DP  L T   V +   + VN ATAH H D+E    +           Y    +PP   ED S + +  D    L GA+++  I A     PSYYHSF ++ENY + +E P+ ++++  M  KI G S      W PQ  T+ H++ R +G+     Y   P+FT H INAYED G +V+D C  D+G V+    +++L+       D+F  S   + PRR ++PL  DE +  D NLI+L   +C A  ++   ++  V+  HEEL D+       +E P INY  YNG+ YRY+Y      V  + L K+D  TK   VW    PG Y  E +FV  P A      +ED GV+L+ ++   K +
Sbjct:   40 PIPTTIKGSIPTWINGSFLRNGPGKFEFGEDKYIHWFDGMAMMHRFHIRDGSVTYSSRFLRSDSYVQNLEKNRIVVSEFGTVASPDPCQSIFARFFSYFQTPQPTDNANVNFVKYKGDYYVSTETNYMRRVDPQSLETKEKVDWSQYIAVNSATAHPHYDREGATYNMGNSYGRNGFFYNIIRVPP--PEDKSAVEDSAD----LRGAEVICSIPADEPRKPSYYHSFVMSENYIVFIEQPIKLNLLKFMLYKIQGKSFHNILSWEPQYGTVFHLVHRRTGKKSPVKYRAAPMFTLHQINAYEDNGFLVMDMCCGDDGVVIGEFTLENLRRESGQAMDEFYNSLCRNLPRRYVLPLNVDENTPLDENLITL--HDCKATAMKTNPEE--VYMTHEELHDDQLLQYGGLEFPQINYAKYNGRPYRYMYACGFGHVFADSLLKMDVHTKELKVW--RYPGLYPSEPVFVASPGA-----AEEDDGVVLSVVVTPRKVI 518          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Medaka
Match: BCO2 (beta-carotene oxygenase 2 [Source:NCBI gene;Acc:101160828])

HSP 1 Score: 320.857 bits (821), Expect = 3.063e-102
Identity = 184/537 (34.26%), Postives = 295/537 (54.93%), Query Frame = 2
Query:  167 SALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-------DKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTN--CTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPG-YACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            S++++   P++    G +PDWIKG+  RNGPGKFE+G+ +++H FDG+A++ ++ I++G+VT++S+++ S SY  N   NRI VSEFGT   PDPC++ F R LS F   +++DN +V       + + STET+++H++DP  L +   V +   + VN ATAH H + + G  + +G +  P  +Y      P  K+            + L GA ++  I +  K  PSYYHSF ++ENY + +E P+ + ++ +   K+ G SI++ F W P+  T+ H++ +++G++    Y    L TFH INA+E+ G ++ID C  D+G  + N  V +L+       + +       PRR ++PL  D ++  + NL+ L N    CT   +           H EEL     +E P INY  YN + YRY YG     +  + L K+D   K+  VW  E  G Y  E IFV  P+A      +ED GV+L+ ++  +K    ++   L+ +DAKS +E+ R    SV+IP  FHG F
Sbjct:    3 SSVEETPEPISCFITGTIPDWIKGNFLRNGPGKFEIGNQRFNHWFDGMALLHQFKISNGQVTYKSRFLSSDSYQSNQEHNRIAVSEFGTVTMPDPCKNFFQRFLSRFELPKLSDNANVSFVTYKGDYYVSTETNIMHKLDPETLQSTEKVDWSKFIAVNGATAHPHTEPD-GTTYNMGNSYTPKGAYYNIIRVPASKQAEG---------ETLEGASVLCAIRSSEKTKPSYYHSFAMSENYVVFIEQPIKMDLLKIATGKLTGKSISDGFSWEPKSNTVFHLIHKDTGKVSPIKYFAKALSTFHQINAFEEGGFLIIDMCASDDGRAITNYKVQNLRKSGEALDEVYNTLCRVFPRRFVLPLNIDSQTPFNQNLVHLANITVFCTHEDL-----------HGEELHHYGGLEFPQINYGKYNTRPYRYFYGCGFRHLVGDTLIKMDLHRKSMKVW--EHAGLYPSEPIFVPSPDAT-----EEDDGVILSVVITPNK----DKSTFLLVLDAKSFEELGRAAV-SVNIPYGFHGAF 506          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Medaka
Match: bco2a (beta,beta-carotene 9',10'-oxygenase [Source:NCBI gene;Acc:101159767])

HSP 1 Score: 305.064 bits (780), Expect = 1.414e-95
Identity = 180/531 (33.90%), Postives = 287/531 (54.05%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNR-LSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK-------DKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF-----MELPTINYNAYNGKKYRYLYG-----VAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVF 1729
            P+     G +P WI G   RNGPGKFE G+  Y+H FDG+AM+ ++ I  G VT+ S+++QS +Y +N   +RIV+SEFGT A PDPC++ F R LS F   E TDN SV       + + STET+ +H+++  +L T+  V +   + VN ATAH H D +    +           Y    +PP          EK D+++ L GA+++  I+   K +PSYYHSF ++ENY + +E P+ + ++ ++   I G ++++   W   ++T+ H++D+++G++    Y T  + TFH INA+E+ G ++ID C  D G  + N  + +L+       + +  +  S PRR ++PL    ++  + NL + P +  +   +    DK  V C HE+L  +       +E P INY+  N K YRY YG     +  + L KVD + KT  VW   +  Y  E IFV  P A      +ED GV+L+ +L    T   ++   L+ +DAK+ +E+ R     ++IP  FHG+F
Sbjct:   47 PIPTTIEGTIPSWINGLFLRNGPGKFEFGNTYYNHWFDGMAMLHQFKIQKGDVTYMSRFLQSDTYKKNSERDRIVMSEFGTLAMPDPCKNFFQRFLSRFEMIEPTDNASVSFVKYKGDFYVSTETNFMHKVNLENLDTLEKVDWSKFIAVNGATAHPHYDPDGTTYNMGNSYGRKGALYNIIKVPP----------EKADIKETLQGAEVLCSISPANKSHPSYYHSFAMSENYVVFIEQPVKMDLLKIVTCNIRGKALSQGIYWDSNQETVFHLVDKHTGKVSPVKYYTKAISTFHQINAFEEDGFLMIDLCCADGGQAISNYLIQNLRKTGEALDEVYNTTERSFPRRFVLPLNLTSETPTNQNLNTRPFSKASCTKIS--PDK--VFCQHEDLHGDDLHEYGGLEFPQINYSRCNTKPYRYFYGCGFRHMVGDSLLKVDLQDKTLKVW-QLKGFYPSEPIFVPSPEA-----VEEDEGVILSVVL----TPSQDKGTFLLVLDAKTFEEVGRANV-PINIPYGFHGIF 552          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Medaka
Match: bco1l (beta,beta-carotene 15,15'-dioxygenase [Source:NCBI gene;Acc:100125487])

HSP 1 Score: 300.442 bits (768), Expect = 3.508e-94
Identity = 182/535 (34.02%), Postives = 292/535 (54.58%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN---EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFA--NYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLK---DKFPKS----APSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAF--MELPTINYNAYNGKKYRYLYGVA------ENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            PV     G LP W++G+L RNGPG F VG  +Y+H FDG +++  +  ++G+V+++S++++S +Y RN+ ANRIVVSEFGT  YPDPC++IF R +    N     TDN  + +   G++ + S+E + I++IDP  L T+G V + N + +N ATAH H D E G  + +G A      P Y  F +P       ++   K   +  L   + +  I  R  L P Y+HSFG+TENY + +E P  + IV +      G +     K+  ++ T+ H++DR +G+ +S  Y  D L  FHHINAYE+ GH+V D   Y +  +    ++ ++K   + F ++    +P   +R ++PL   ++S    NL++L +T+  A + E+ +    V+C      DN F  MELP INY  +N +KYRY YG         N + KVD  T+T + W  +E  Y  E +FV  P A      +ED GV+L+ ++  D  +       ++ ++AK+ +EI R    + ++ +  HG+F P
Sbjct:   15 PVKAQVKGSLPSWLQGTLLRNGPGLFSVGDSEYNHWFDGSSLIHSFTFSNGEVSYRSKFLKSDTYKRNIKANRIVVSEFGTMVYPDPCKNIFARTATHLSNIVPNFTDNNLINIIRYGNDYYASSEVNYINQIDPDTLETVGRVNYRNHIALNLATAHPHYDDE-GNTYNMGTAIIGLGRPKYIIFKVP-------AKATGKDQKKPALRQVQQICSIPFRSALFPGYFHSFGMTENYIVFVEQPFKLDIVKLATAYFRGVNWGSCLKFDEKDTTLFHIIDRKTGKKISAHYYADALVVFHHINAYEENGHVVFDMITYKDSNLYNMFYLHNMKKDTNAFIQTNQDFSPPVGQRFVLPLDVHKESPKGTNLVTLTDTSAEAVMQEDGS----VYCK----PDNIFVGMELPGINYK-FNARKYRYFYGSRLEWSPHPNKIAKVDIATRTHLEWY-QENCYPSEPVFVASPGA-----VEEDDGVILSSVVSSDPDITP----FMLVLNAKTFEEIARASIPT-TVHMDLHGLFIP 521          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Medaka
Match: rpe65b (retinal Mueller cells isomerohydrolase [Source:NCBI gene;Acc:101163729])

HSP 1 Score: 293.893 bits (751), Expect = 1.457e-91
Identity = 186/535 (34.77%), Postives = 298/535 (55.70%), Query Frame = 2
Query:  191 PVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFEN-EMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLG--FANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKT-KIWGSSIAEAFKWWPQEKTIIHVMDRNSGELL-SHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMN-LFVDSLKDKF---PKSAPSSP----RRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEEL--SDNAFMELPTINYNAYNGKKYRYLYGVAEN-----MLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQP 1735
            P+     GV+P W+ GSL R GPG FEVG + + H FDG A++ ++ + +G+VT+  ++I++ SY+R M  NR+V++EFGT AYPDPC++IF+R  ++F+  E+TDN  V ++P+G++ +  TET+ I ++DP  L T+  V     ++VN  TAH HI+ + G V+ +G  F      +Y    IPP +K+ S  + +          ++IV ++ +  +L PSY HSFG+T NY++ +E P+ I+++  +    I G++  + F+      T  H+  +N    + SH + T     FHHIN YED+G IV+D C +     V N L++ +L++++    K+A  +P    RR ++PL    K     NL+SL  T  TA +  +      +    E L        E P INY+   GKKY + YG+  N      + K++ +TK + VW  EE  Y  E IFV  P A       ED GVLL+ I+V+     TER   L+ +DA  + E+ R E  ++ IP++ HG+++P
Sbjct:   24 PIPAQISGVIPSWLGGSLLRMGPGLFEVGDEPFHHLFDGQALMHKFDLRNGQVTYNRKFIKTDSYVRAMTENRVVITEFGTIAYPDPCKNIFSRFFSYFKGIEVTDNCLVNIYPIGEDFYAVTETNYITKVDPDSLETLEKVDVCKYLSVNGLTAHPHIEAD-GTVYNIGNCFGKDMSLAYNIVKIPPAQKDKSDPIEK----------SQIVVQLPSSERLKPSYVHSFGMTNNYFVFVEQPVKINLLKFLSAWSIRGTTYMDCFESCESMGTWFHLTTKNPAAYMSSHKFRTSAFNLFHHINTYEDQGFIVVDLCTWKGHEFVYNYLYLANLREEWEEVKKAASRAPQPEVRRYVLPLDI-YKEEQGKNLVSLSYTTATAVLCSDGT----IWLEPEVLFSGPRQAFEFPQINYSQCCGKKYFFAYGLGLNHFIPDRIVKLNVQTKETWVW-QEEDCYPSEPIFVATPGAT-----QEDDGVLLS-IVVKP---GTERPGFLLVLDAMKLTEVARAEVNAI-IPVTLHGLYKP 531          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Planmine SMEST
Match: SMESG000051674.1 (SMESG000051674.1)

HSP 1 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 532/536 (99.25%), Postives = 534/536 (99.63%), Query Frame = 2
Query:  143 MDLLFTFKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG 1750
            MDLLFTFKSALKQYMYPVTGVNIGV+PDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIW SSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNP DEDYG+LLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG
Sbjct:    1 MDLLFTFKSALKQYMYPVTGVNIGVIPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWSSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPEDEDYGILLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG 536          
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Planmine SMEST
Match: SMESG000051674.1 (SMESG000051674.1)

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 518/522 (99.23%), Postives = 520/522 (99.62%), Query Frame = 2
Query:  185 MYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG 1750
            MYPVTGVNIGV+PDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIW SSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNP DEDYG+LLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG
Sbjct:    1 MYPVTGVNIGVIPDWIKGSLYRNGPGKFEVGSDKYSHSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAYPDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVDLTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIPPIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYYIHLECPLTISIVDMMKTKIWSSSIAEAFKWWPQEKTIIHVMDRNSGELLSHVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPKSAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCHHEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWCNEEPGYACESIFVKHPNADDNNPEDEDYGILLTPILVRDKTVDTERYQSLVFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG 522          
The following BLAST results are available for this feature:
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BCO22.363e-9835.98beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:... [more]
BCO22.363e-9835.98beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:... [more]
BCO28.862e-9835.98beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:... [more]
BCO22.012e-9735.76beta-carotene oxygenase 2 [Source:HGNC Symbol;Acc:... [more]
RPE651.021e-9535.46retinoid isomerohydrolase RPE65 [Source:HGNC Symbo... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bcmo-13.042e-8130.80Beta-Carotene 15,15'-MonoOxygenase [Source:UniPro... [more]
bcmo-22.775e-7331.30Beta-Carotene 15,15'-MonoOxygenase [Source:UniPro... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ninaB8.765e-7233.24gene:FBgn0002937 transcript:FBtr0082820[more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bco2a4.614e-10837.85beta-carotene oxygenase 2a [Source:ZFIN;Acc:ZDB-GE... [more]
bco2l3.416e-10536.57beta-carotene 15, 15-dioxygenase 2, like [Source:Z... [more]
bco2b5.815e-10135.95beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GE... [more]
bco1l7.939e-10035.61beta-carotene oxygenase 1, like [Source:ZFIN;Acc:Z... [more]
rpe65c3.728e-9534.27retinoid isomerohydrolase RPE65 c [Source:NCBI gen... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk2g1.188e-10639.29calcium/calmodulin dependent protein kinase (CaM k... [more]
camk2g1.286e-10639.29calcium/calmodulin dependent protein kinase (CaM k... [more]
camk2g1.346e-10639.29calcium/calmodulin dependent protein kinase (CaM k... [more]
camk2g1.701e-10639.29calcium/calmodulin dependent protein kinase (CaM k... [more]
camk2g1.715e-10639.29calcium/calmodulin dependent protein kinase (CaM k... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bco24.630e-10738.17beta-carotene oxygenase 2 [Source:MGI Symbol;Acc:M... [more]
Bco13.003e-9935.56beta-carotene oxygenase 1 [Source:MGI Symbol;Acc:M... [more]
Rpe653.182e-9334.59retinal pigment epithelium 65 [Source:MGI Symbol;A... [more]
Rpe653.182e-9334.59retinal pigment epithelium 65 [Source:MGI Symbol;A... [more]
Bco12.625e-9135.97beta-carotene oxygenase 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99NF1|BCDO2_MOUSE3.238e-10638.17Beta,beta-carotene 9',10'-oxygenase OS=Mus musculu... [more]
sp|Q5RF16|BCDO2_PONAB8.627e-10136.67Beta,beta-carotene 9',10'-oxygenase OS=Pongo abeli... [more]
sp|Q8HXG8|BCDO2_MACFA4.015e-10036.74Beta,beta-carotene 9',10'-oxygenase OS=Macaca fasc... [more]
sp|Q91XT5|BCDO1_RAT9.361e-9935.89Beta,beta-carotene 15,15'-dioxygenase OS=Rattus no... [more]
sp|Q9JJS6|BCDO1_MOUSE2.100e-9835.56Beta,beta-carotene 15,15'-dioxygenase OS=Mus muscu... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H8X44.888e-11938.82beta,beta-carotene 15,15'-dioxygenase OS=Lingula u... [more]
T1K9Z32.044e-11538.07Uncharacterized protein OS=Tetranychus urticae OX=... [more]
T1KM423.447e-11136.64Uncharacterized protein OS=Tetranychus urticae OX=... [more]
A0A3B4ZG788.036e-11139.56Beta-carotene 15, 15-dioxygenase 2, like OS=Stegas... [more]
T1KM441.704e-11036.91Uncharacterized protein OS=Tetranychus urticae OX=... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bco2l1.288e-10839.18beta-carotene 15, 15-dioxygenase 2, like [Source:Z... [more]
bco2b4.662e-10035.16beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GE... [more]
bco2b7.900e-10035.16beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GE... [more]
bco2b1.499e-9935.16beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GE... [more]
bco2b4.776e-9935.16beta-carotene oxygenase 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005436.12.160e-3443.17pep scaffold:Pmarinus_7.0:GL479905:4246:8086:-1 ge... [more]
ENSPMAT00000003238.18.350e-2832.81pep scaffold:Pmarinus_7.0:GL480895:20195:23472:-1 ... [more]
ENSPMAT00000003844.19.879e-1633.13pep scaffold:Pmarinus_7.0:GL489646:340:3314:1 gene... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO288415.611e-8733.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443546.188e-8033.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460831.406e-7131.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367123.439e-6429.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430433.773e-1726.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bco2l7.461e-10338.51beta,beta-carotene 9',10'-oxygenase [Source:NCBI g... [more]
BCO23.063e-10234.26beta-carotene oxygenase 2 [Source:NCBI gene;Acc:10... [more]
bco2a1.414e-9533.90beta,beta-carotene 9',10'-oxygenase [Source:NCBI g... [more]
bco1l3.508e-9434.02beta,beta-carotene 15,15'-dioxygenase [Source:NCBI... [more]
rpe65b1.457e-9134.77retinal Mueller cells isomerohydrolase [Source:NCB... [more]
back to top
BLAST of beta,beta-carotene 15,15'-dioxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000051674.10.000e+099.25SMESG000051674.1[more]
SMESG000051674.10.000e+099.23SMESG000051674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001151 ID=SMED30001151|Name=beta,beta-carotene 15,15'-dioxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1890bp
ATTCAGACTATATAACATTTTATATGTTAACCTAGTTTCTAGCATAATAC
TTAATCTGCTAATCAATAAGATGTGAGTTCAAACCTTCAGTGGCTATTTA
TCAGCCATATAAATAATTGTATCGCTAATTATCAACATTAATATGGATTT
GTTATTCACATTTAAGTCAGCTCTAAAGCAGTATATGTATCCAGTTACTG
GAGTAAATATAGGTGTCTTACCAGATTGGATTAAGGGATCATTGTATAGG
AATGGACCTGGAAAATTTGAAGTTGGCTCTGATAAGTATAGTCATTCTTT
TGACGGTCTTGCTATGGTTCAAAGGTATTACATTAATGATGGAAAAGTGA
CTTTTCAAAGTCAATATATTCAATCTAAATCGTATTTAAGAAATATGGCA
GCTAATAGAATTGTCGTTTCTGAGTTTGGAACTACAGCGTACCCTGATCC
GTGTCGTAGTATTTTTAATAGATTATCGAATTTTTTTGAAAATGAAATGA
CTGACAATACAAGCGTTTGTGTTTTCCCGGTTGGAGATGAGCTATTTACC
TCTACCGAAACCGATGTTATACACAGAATTGATCCAGTTGACCTGACAAC
GATTGGCAGTGTAAGATTTCCAAATATTGTAACAGTTAATAGAGCAACAG
CTCATAATCATATTGATAAAGAAACTGGACTTGTTCATTTTTTGGGATTT
GCTAATTACCCCGTTCCTTCATATGCTTTTTTTACAATACCTCCAATTAA
GAAAGAAGATTCTTCAAGGTTGAATGAAAAATATGATATGGAGAAATTAC
TTACAGGCGCCAAGATAGTTGGAAAGATAAATGCGCGTTGGAAACTAAAT
CCTAGCTATTATCACAGTTTTGGAATCACTGAAAATTATTACATTCACTT
GGAATGTCCCTTGACTATCAGCATTGTTGATATGATGAAAACAAAGATCT
GGGGTTCTTCAATTGCTGAAGCCTTTAAATGGTGGCCTCAAGAAAAAACA
ATAATTCATGTGATGGACAGAAACAGTGGCGAATTATTGTCACATGTTTA
TGTGACAGATCCATTGTTTACTTTTCACCACATCAATGCCTATGAAGATA
AAGGGCACATTGTTATCGACTATTGTGGATATGATAATGGATACGTAGTT
ATGAATTTGTTCGTTGACAGCTTGAAAGATAAATTTCCAAAATCGGCTCC
AAGTTCACCGCGAAGATTAATAGTTCCATTAAAATTTGATGAAAAGAGCG
CTTGTGACATAAATCTAATTAGTCTGCCCAATACAAATTGCACCGCGAAT
ATAGTTGAAAATCGTAATGATAAATGTGTAGTGCATTGCCACCATGAGGA
ATTGTCTGACAATGCCTTTATGGAGTTGCCAACTATAAATTACAATGCAT
ACAATGGCAAAAAATATAGATATCTATATGGAGTCGCCGAGAACATGTTG
AAAAAGGTAGATACAGAGACAAAAACAAGCATTGTGTGGTGCAATGAAGA
GCCTGGGTATGCTTGTGAATCCATTTTTGTTAAACATCCTAATGCGGACG
ATAATAATCCAGGGGATGAGGATTACGGGGTTTTGTTGACTCCGATATTA
GTGAGAGACAAAACCGTTGACACAGAGCGATACCAATCGCTTGTATTTAT
TGATGCCAAGTCCATGAAAGAGATCTGTAGAACTGAATTTCGATCAGTGT
CGATTCCGTTGTCTTTTCATGGAGTTTTTCAGCCAATCAATTCACTTGGT
TAATTATTTACCCGCCGCACAACATTTAAATCCTTTTCTATTTATAGTTC
AAATTTATTGATATTTTTCTAGTATTTTGATTTATTGATTATAATTTTTG
ATTAGTTTATTGATTGTAATTTTTAATAATAAAAATTTTC
back to top

protein sequence of SMED30001151-orf-1

>SMED30001151-orf-1 ID=SMED30001151-orf-1|Name=SMED30001151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=537bp
MDLLFTFKSALKQYMYPVTGVNIGVLPDWIKGSLYRNGPGKFEVGSDKYS
HSFDGLAMVQRYYINDGKVTFQSQYIQSKSYLRNMAANRIVVSEFGTTAY
PDPCRSIFNRLSNFFENEMTDNTSVCVFPVGDELFTSTETDVIHRIDPVD
LTTIGSVRFPNIVTVNRATAHNHIDKETGLVHFLGFANYPVPSYAFFTIP
PIKKEDSSRLNEKYDMEKLLTGAKIVGKINARWKLNPSYYHSFGITENYY
IHLECPLTISIVDMMKTKIWGSSIAEAFKWWPQEKTIIHVMDRNSGELLS
HVYVTDPLFTFHHINAYEDKGHIVIDYCGYDNGYVVMNLFVDSLKDKFPK
SAPSSPRRLIVPLKFDEKSACDINLISLPNTNCTANIVENRNDKCVVHCH
HEELSDNAFMELPTINYNAYNGKKYRYLYGVAENMLKKVDTETKTSIVWC
NEEPGYACESIFVKHPNADDNNPGDEDYGVLLTPILVRDKTVDTERYQSL
VFIDAKSMKEICRTEFRSVSIPLSFHGVFQPINSLG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012340NA-bd_OB-fold
IPR004294Carotenoid_Oase
Vocabulary: molecular function
TermDefinition
GO:0016702oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0003834beta-carotene 15,15'-monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
GO:0051213dioxygenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0001523retinoid metabolic process
GO:0042572retinol metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004294Carotenoid oxygenasePFAMPF03055RPE65coord: 14..530
e-value: 3.1E-101
score: 339.9
IPR004294Carotenoid oxygenasePANTHERPTHR10543BETA-CAROTENE DIOXYGENASEcoord: 7..530
NoneNo IPR availablePANTHERPTHR10543:SF24BETA,BETA-CAROTENE 9',10'-OXYGENASEcoord: 7..530