SMED30001148

Overview
NameSMED30001148
Smed IDSMED30001148
Length (bp)5815
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001148 (SMED30001148) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001148 (SMED30001148) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001148 (SMED30001148) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001148 (SMED30001148) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001148

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001148SMESG000041540.1 SMESG000041529.1 SmedASXL_016925SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001148SMESG000041540.1 SMESG000041529.1 dd_Smed_v4_13075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001148SMESG000041540.1 SMESG000041529.1 dd_Smed_v4_13075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001148SMESG000041540.1 SMESG000041529.1 dd_Smed_v4_13075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001148SMESG000041540.1 SMESG000041529.1 dd_Smed_v4_13075_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001148SMESG000041540.1 SMESG000041529.1 dd_Smed_v6_13075_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal-ventral muscle cellSMED30001148SMESG000041540.1 SMESG000041529.1 dd_Smed_v4_13075_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30001148 vs. TrEMBL
Match: A0A5K4F598 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.585e-45
Identity = 154/494 (31.17%), Postives = 231/494 (46.76%), Query Frame = 3
Query: 1695 FEDMKH-KSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNS---FYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCXXXXXXXXXXX------------------------------------XXXXTIDEN--------CCLTKCLNDKNCQIQYSSECH-YTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKG-----WSSSVIVEDVPYSDPG----------NYNIG---------NITFYWS--------SKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKI---RPINRTIDYTLQNVMPVSIVH-SDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLC 2921
            +ED++H  SDN  +++ ++ SN+ H + PL  I+K  CR+PLP  Y++ M  Y DRHT A+R+ C     P N +       Y S   FY RSIN QC+ NKA +L  +L+SFYC  N+ LVN +F+ N+ ES SY  D  CD  RR C TC K+ C K+                                           TI++N        CC  KC ++ +C   + S C  YT R     +  IC+QG T KFTLNP+FDF N  + CH++ + P  +  +    ++  +G     WSS  +  ++     G          +Y+I           I   W+        + L      I+H  ++ +     F L K  K+  T  P LQ+H ++ YI V+F   F+YSTSNW + +C++N+S I   +PI    + T  +V   SI   +    F Y LK++ +   IEI+   N SL+ +  C
Sbjct:  217 YEDVEHLASDNGIVMDPSRKSNMQHWRKPLETIIKTACRYPLPKQYYLAMHPYLDRHTTARRHVC----QPNNVNSRLCPANYPSGYIFYDRSINGQCTQNKASYLPPQLNSFYCTINSPLVNKLFQENIIESQSYLKDMHCDTQRRICQTCLKQSCLKSKTELFSEMNLKKAQHNLLSNHGEIENNHDFNEEIFYGNLLRVNTIEQNIWQANDPDCCGIKCYSNPSCLDYFGSRCETYTSRHSNATE--ICLQGKTLKFTLNPEFDFTNGTYTCHVQHRPPKIIYTIETWLTLEIQGLPKLVWSSPRLKYNIQLMSNGRPPRRKSNKVDYDIQTLEQQFLKHGILLLWNENIYLEHKTGLPIWDDAIVH--RSVDKEISLFQL-KFLKDFGTEPPPLQRHKEEKYIVVQFSRPFQYSTSNWGNQTCQINISHIHRAQPI--YAENTKVSVETTSIPQRTTSNAFLYTLKNSQKRSTIEIKSHINHSLLYTAAC 699          
BLAST of SMED30001148 vs. TrEMBL
Match: A0A5K4F6N1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 2.478e-42
Identity = 154/503 (30.62%), Postives = 231/503 (45.92%), Query Frame = 3
Query: 1695 FEDMKH-KSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNS---FYTRSINDQCSVN---------KAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCXXXXXXXXXXX------------------------------------XXXXTIDEN--------CCLTKCLNDKNCQIQYSSECH-YTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKG-----WSSSVIVEDVPYSDPG----------NYNIG---------NITFYWS--------SKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKI---RPINRTIDYTLQNVMPVSIVH-SDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLC 2921
            +ED++H  SDN  +++ ++ SN+ H + PL  I+K  CR+PLP  Y++ M  Y DRHT A+R+ C     P N +       Y S   FY RSIN QC+ N         KA +L  +L+SFYC  N+ LVN +F+ N+ ES SY  D  CD  RR C TC K+ C K+                                           TI++N        CC  KC ++ +C   + S C  YT R     +  IC+QG T KFTLNP+FDF N  + CH++ + P  +  +    ++  +G     WSS  +  ++     G          +Y+I           I   W+        + L      I+H  ++ +     F L K  K+  T  P LQ+H ++ YI V+F   F+YSTSNW + +C++N+S I   +PI    + T  +V   SI   +    F Y LK++ +   IEI+   N SL+ +  C
Sbjct:  217 YEDVEHLASDNGIVMDPSRKSNMQHWRKPLETIIKTACRYPLPKQYYLAMHPYLDRHTTARRHVC----QPNNVNSRLCPANYPSGYIFYDRSINGQCTQNLHNAILISDKASYLPPQLNSFYCTINSPLVNKLFQENIIESQSYLKDMHCDTQRRICQTCLKQSCLKSKTELFSEMNLKKAQHNLLSNHGEIENNHDFNEEIFYGNLLRVNTIEQNIWQANDPDCCGIKCYSNPSCLDYFGSRCETYTSRHSNATE--ICLQGKTLKFTLNPEFDFTNGTYTCHVQHRPPKIIYTIETWLTLEIQGLPKLVWSSPRLKYNIQLMSNGRPPRRKSNKVDYDIQTLEQQFLKHGILLLWNENIYLEHKTGLPIWDDAIVH--RSVDKEISLFQL-KFLKDFGTEPPPLQRHKEEKYIVVQFSRPFQYSTSNWGNQTCQINISHIHRAQPI--YAENTKVSVETTSIPQRTTSNAFLYTLKNSQKRSTIEIKSHINHSLLYTAAC 708          
BLAST of SMED30001148 vs. TrEMBL
Match: A0A2R2ML22 (uncharacterized protein LOC106172251 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106172251 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.153e-42
Identity = 180/723 (24.90%), Postives = 303/723 (41.91%), Query Frame = 3
Query: 1197 GCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSC-------------------------SRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPV------KKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILG-ASGXXXXXXXXXXXXXXXFEDMKHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEEL-----HSFYCVENNKLVNDIFKHNLK-ESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYS---------DPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYI---EVEFENIFEYSTSNWNSL-SCKVNVSKIRPINR-------TIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKV 3191
            GCN  T+KC+CQRG+ LL+G C D +EC   +    C  +S+C NT G + C C                         S  S TQ++ C++C  C    Y+   C       C+  + P+       +V    +N  D     P  N+F +++L T  L+S + +  +N + S+ +    SGL INI + N+ + P F D  H SDN ++  S Q       K     I+  +CRHP+PD Y +++  Y  R +      C+   +P    C Q      +FY RS+N  C   + + L ++L     +S  C     L+  +F   LK +++   P   C      C  C       + ++     ++++CC T CLN K C+  Y   C            VIC  GDT +FTL+P F+  +++F CH+R  +P  +    +++ +    + +    E   Y+         + G+ +IG +    ++K     +M++ G  N        SL +          K Q       I    +  E  F+ S+ +WN+   C  N+S +    +       T++YT  N             + YIL   I  PEI + +  N S++   +    +  R  I  D   DSF   L L     +WN+ + G+++    +V I + D+     L + + +V  P +  + +F+F     N  KV
Sbjct:  576 GCNAATQKCVCQRGYSLLQGTCQDLDECSTGI--HRCGRNSRCINTQGGYRCMCGEGFYSLGGTCRACSGSCPPGFYQSSPCSDTQDRKCAVCVHCTKTGYEVRPCGRGMNRKCVSVSNPLGTPPSDGRVFVEANNTGDFSYQTP-RNMFVEDLLKTHSLQSTV-YATYNNQYSDFLWQRESGLKINIYVDNIQILPTFTDTSHLSDNAYMYKSPQPGE----KEKFANIVTKFCRHPVPDFYNLSLEIYRSRTSAVTAVVCDS-SNPDKIRCPQQFKNGETFYYRSVNKDCQ-RRGIALKDKLAETNSNSILCTVETPLLTKLFSKTLKDDTLETFPHWQCSPKEMTCQAC------LSSRACVSSGLNQSCCATDCLNTKECKFVYQPLC--------ANKSVICSTGDTVQFTLHPMFNNISSQFMCHLR-YVPPPMYLYRVRYRMHIDNFDTPFSTEQEIYNITASNIHEHNNGSNHIGFLDVSHNTKFQLKDEMMMVGDMNAAARDYQLSLHQFKDVGEFDKGKFQVFSFSDSIFTTSLTPERPFQVSSVSWNNQEGCWRNISTLHKKQKMYKKHGVTVNYTKMNT---------DGTYKYILSPKIYGPEISVSIPGNRSVLYHYM----KHVRAGIRFD---DSFKTHLELNTTTKKWNMSISGYLTGCPAYVAIIVNDLTEMVQLFNLDTLVVCPPR-FNFAFQFSFGDINREKV 1256          
BLAST of SMED30001148 vs. TrEMBL
Match: A0A2R2ML12 (uncharacterized protein LOC106172251 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172251 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.704e-41
Identity = 180/723 (24.90%), Postives = 303/723 (41.91%), Query Frame = 3
Query: 1197 GCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSC-------------------------SRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPV------KKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILG-ASGXXXXXXXXXXXXXXXFEDMKHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEEL-----HSFYCVENNKLVNDIFKHNLK-ESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYS---------DPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYI---EVEFENIFEYSTSNWNSL-SCKVNVSKIRPINR-------TIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKV 3191
            GCN  T+KC+CQRG+ LL+G C D +EC   +    C  +S+C NT G + C C                         S  S TQ++ C++C  C    Y+   C       C+  + P+       +V    +N  D     P  N+F +++L T  L+S + +  +N + S+ +    SGL INI + N+ + P F D  H SDN ++  S Q       K     I+  +CRHP+PD Y +++  Y  R +      C+   +P    C Q      +FY RS+N  C   + + L ++L     +S  C     L+  +F   LK +++   P   C      C  C       + ++     ++++CC T CLN K C+  Y   C            VIC  GDT +FTL+P F+  +++F CH+R  +P  +    +++ +    + +    E   Y+         + G+ +IG +    ++K     +M++ G  N        SL +          K Q       I    +  E  F+ S+ +WN+   C  N+S +    +       T++YT  N             + YIL   I  PEI + +  N S++   +    +  R  I  D   DSF   L L     +WN+ + G+++    +V I + D+     L + + +V  P +  + +F+F     N  KV
Sbjct:  998 GCNAATQKCVCQRGYSLLQGTCQDLDECSTGI--HRCGRNSRCINTQGGYRCMCGEGFYSLGGTCRACSGSCPPGFYQSSPCSDTQDRKCAVCVHCTKTGYEVRPCGRGMNRKCVSVSNPLGTPPSDGRVFVEANNTGDFSYQTP-RNMFVEDLLKTHSLQSTV-YATYNNQYSDFLWQRESGLKINIYVDNIQILPTFTDTSHLSDNAYMYKSPQPGE----KEKFANIVTKFCRHPVPDFYNLSLEIYRSRTSAVTAVVCDS-SNPDKIRCPQQFKNGETFYYRSVNKDCQ-RRGIALKDKLAETNSNSILCTVETPLLTKLFSKTLKDDTLETFPHWQCSPKEMTCQAC------LSSRACVSSGLNQSCCATDCLNTKECKFVYQPLC--------ANKSVICSTGDTVQFTLHPMFNNISSQFMCHLR-YVPPPMYLYRVRYRMHIDNFDTPFSTEQEIYNITASNIHEHNNGSNHIGFLDVSHNTKFQLKDEMMMVGDMNAAARDYQLSLHQFKDVGEFDKGKFQVFSFSDSIFTTSLTPERPFQVSSVSWNNQEGCWRNISTLHKKQKMYKKHGVTVNYTKMNT---------DGTYKYILSPKIYGPEISVSIPGNRSVLYHYM----KHVRAGIRFD---DSFKTHLELNTTTKKWNMSISGYLTGCPAYVAIIVNDLTEMVQLFNLDTLVVCPPR-FNFAFQFSFGDINREKV 1678          
BLAST of SMED30001148 vs. TrEMBL
Match: A0A2R2MLG8 (uncharacterized protein LOC106172251 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106172251 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.933e-41
Identity = 180/723 (24.90%), Postives = 303/723 (41.91%), Query Frame = 3
Query: 1197 GCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSC-------------------------SRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPV------KKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILG-ASGXXXXXXXXXXXXXXXFEDMKHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEEL-----HSFYCVENNKLVNDIFKHNLK-ESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYS---------DPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYI---EVEFENIFEYSTSNWNSL-SCKVNVSKIRPINR-------TIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKV 3191
            GCN  T+KC+CQRG+ LL+G C D +EC   +    C  +S+C NT G + C C                         S  S TQ++ C++C  C    Y+   C       C+  + P+       +V    +N  D     P  N+F +++L T  L+S + +  +N + S+ +    SGL INI + N+ + P F D  H SDN ++  S Q       K     I+  +CRHP+PD Y +++  Y  R +      C+   +P    C Q      +FY RS+N  C   + + L ++L     +S  C     L+  +F   LK +++   P   C      C  C       + ++     ++++CC T CLN K C+  Y   C            VIC  GDT +FTL+P F+  +++F CH+R  +P  +    +++ +    + +    E   Y+         + G+ +IG +    ++K     +M++ G  N        SL +          K Q       I    +  E  F+ S+ +WN+   C  N+S +    +       T++YT  N             + YIL   I  PEI + +  N S++   +    +  R  I  D   DSF   L L     +WN+ + G+++    +V I + D+     L + + +V  P +  + +F+F     N  KV
Sbjct:  998 GCNAATQKCVCQRGYSLLQGTCQDLDECSTGI--HRCGRNSRCINTQGGYRCMCGEGFYSLGGTCRACSGSCPPGFYQSSPCSDTQDRKCAVCVHCTKTGYEVRPCGRGMNRKCVSVSNPLGTPPSDGRVFVEANNTGDFSYQTP-RNMFVEDLLKTHSLQSTV-YATYNNQYSDFLWQRESGLKINIYVDNIQILPTFTDTSHLSDNAYMYKSPQPGE----KEKFANIVTKFCRHPVPDFYNLSLEIYRSRTSAVTAVVCDS-SNPDKIRCPQQFKNGETFYYRSVNKDCQ-RRGIALKDKLAETNSNSILCTVETPLLTKLFSKTLKDDTLETFPHWQCSPKEMTCQAC------LSSRACVSSGLNQSCCATDCLNTKECKFVYQPLC--------ANKSVICSTGDTVQFTLHPMFNNISSQFMCHLR-YVPPPMYLYRVRYRMHIDNFDTPFSTEQEIYNITASNIHEHNNGSNHIGFLDVSHNTKFQLKDEMMMVGDMNAAARDYQLSLHQFKDVGEFDKGKFQVFSFSDSIFTTSLTPERPFQVSSVSWNNQEGCWRNISTLHKKQKMYKKHGVTVNYTKMNT---------DGTYKYILSPKIYGPEISVSIPGNRSVLYHYM----KHVRAGIRFD---DSFKTHLELNTTTKKWNMSISGYLTGCPAYVAIIVNDLTEMVQLFNLDTLVVCPPR-FNFAFQFSFGDINREKV 1678          
BLAST of SMED30001148 vs. Planmine SMEST
Match: SMESG000041540.1 (SMESG000041540.1)

HSP 1 Score: 1991.85 bits (5159), Expect = 0.000e+0
Identity = 1030/1040 (99.04%), Postives = 1034/1040 (99.42%), Query Frame = 3
Query:   93 MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQGNGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNLSQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFXXXXXXXXXXXXXXXCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPXXXXXXXXNTMIYLPPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILLFVITVFTDISVFTVKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKYTISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDFLPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGXXXXXXXXXXXXXXXFEDMKHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKIRPINRTIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKVPIEFSTY 3212
            MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQGNGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNLSQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFYKRKYKQHKNKKDKYCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPSSSKSSSKNTMIYLPPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILLFVITVFTD+SVF+VKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKYTISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDFLPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGLIINITLLNVNLPPIFEDM+HKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCKKKMCSKAGKSKSKKTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKIRPINRTIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNT + P   S Y
Sbjct:    1 MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQGNGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNLSQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFYKRKYKQHKNKKDKYCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPSSSKSSSKNTMIYLPPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILLFVITVFTDMSVFSVKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKYTISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDFLPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGLIINITLLNVNLPPIFEDMEHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCKKKMCSKAGKSKSKKTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKIRPINRTIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTIQKPTFKSLY 1040          
BLAST of SMED30001148 vs. Planmine SMEST
Match: SMESG000041540.1 (SMESG000041540.1)

HSP 1 Score: 1910.96 bits (4949), Expect = 0.000e+0
Identity = 999/1040 (96.06%), Postives = 1004/1040 (96.54%), Query Frame = 3
Query:   93 MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQGNGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNLSQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFXXXXXXXXXXXXXXXCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPXXXXXXXXNTMIYLPPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILLFVITVFTDISVFTVKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKYTISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDFLPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGXXXXXXXXXXXXXXXFEDMKHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKIRPINRTIDYTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKVPIEFSTY 3212
            MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQGNGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNLSQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFYKRKYKQHKNKKDKYCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPSSSKSSSKNTMIYLPPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILLFVITVFTD+SVF+VKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKYTISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDFLPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGLIINITLLNVNLPPIFEDM+HKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCKKKMCSKAGKSKSKKTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVE   +      N                     YTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNT + P   S Y
Sbjct:    1 MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQGNGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNLSQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFYKRKYKQHKNKKDKYCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPSSSKSSSKNTMIYLPPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILLFVITVFTDMSVFSVKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKYTISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDFLPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPLVSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCILPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGLIINITLLNVNLPPIFEDMEHKSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCKKKMCSKAGKSKSKKTIDENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGNYNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEHVKLEFIVMQN---------------------YTLQNVMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTIQKPTFKSLY 1019          
BLAST of SMED30001148 vs. Planmine SMEST
Match: SMESG000041529.1 (SMESG000041529.1)

HSP 1 Score: 1348.18 bits (3488), Expect = 0.000e+0
Identity = 700/703 (99.57%), Postives = 701/703 (99.72%), Query Frame = 3
Query: 3564 MQKIHSTYRKSLNQECSQHVQTISTKRRMVLFLFVAFKVFYNFVFTXXXXXXXXXXXXXXXTPFEITPSRFLFSVEQEVRKLDNYGSDEFRRQNEFVNTMNKACQEKRKNCEISLKNHIKSKYDTFIDPWTVSNKKPIYKSIGKIFNTHLQKEFEAFYNYSRQLIHRQINNRIDRYQSYINQFTNSVYIKTAIQFGRNATQKSNHSLKYYSILGSEIKSYNLQSIPDLYEPRAIFSLYVSFSNEYFKLHNITKTPDSIFKPSQVDFKETIQSKTKRYFQSTLKFSSNKKQMKFSPLDSEINKYYKTRMKIISKNNRFQLKISLWQMRLXXXXXXXXXXTYRFYHTLTTIKIIWFGSHIYLSVNNCGKPSNREKLENDATFQAFRFVKFKHYIRNNPTIEIAEFGLSINKLFPCFDCCKRLYYVCIIISFTILIGVASIFVLSFYCMGRSQTNLPSSVADMTLQYMNYRINWLTSRHAARINTEKLNVSIFSDKNNRKRLTRLQRFFQHEETQIQKNLQYHVCEFLPANHFFRSLKTYCNNNYVNTVDCSQQSCYFINIKSLNYTENQFLKEMYSVGXXXXXXXXXXXXRFIAVAMLVVSAILIMLGIIYHSSKLLARIFLKFSQPINATILNRNFPLLSKSIMKQHFSHSTLRSMSERTNTTFNTPNRSLQTNPIFLKDISNNYSSPVITRSTNSNNHSESRV 5672
            MQKIHSTYRKSLNQECSQHVQTISTKRRMVLFLFVAFKVFYNFVFTLSVGLSLVLSLESNLTPFEITPSRFLFSVEQEVRKLDNYGSDEFRRQNEFVNTMNKACQEKRKNCEISLKNHIKSKYDTFIDPWTVSNKKPIYKSIGKIFNTHLQKEFEAFYNYSRQLIHRQINNRIDRYQSYINQFTNSVYIKTAIQFGRNATQKSNHSLKYYSILGSEIKSYNLQSIPDLYEPRAIFSLYVSFSNEYFKLHNITKTPDSIFKPSQVDFKETIQSKTKRYFQSTLKFSSNKKQMKFSPLDSEINKYYKTRMKIISKNNRFQLKISLWQMRLIIVFIDIIIITYRFYHTLTTIKIIWFGSHIYLSVNNCGKPSNREKLENDATFQAFRFVKFKHYIRNNPTIEIAEFGLSINKLFPCFDCCKRLYYVCIIISFTILIGVASIFVLSFYCMGRSQTNLPSSVADMTLQYMNYRINWLTSRHAARINTEKLNVSIFSDKNNRKRLTRLQRFFQHEETQIQKNLQYHVC+ LPANHFFRSLKTYCNNNYVNTVDCSQQSCYFINIKSLNYTENQFLKEMYS GPLTTSLILIPLLRFIAVAMLVVSAILIMLGIIYHSSKLLARIFLKFSQPINATILNRNFPLLSKSIMKQHFSHSTLRSMSERTNTTFNTPNRSLQTNPIFLKDISNNYSSPVITRSTNSNNHSESRV
Sbjct:    1 MQKIHSTYRKSLNQECSQHVQTISTKRRMVLFLFVAFKVFYNFVFTLSVGLSLVLSLESNLTPFEITPSRFLFSVEQEVRKLDNYGSDEFRRQNEFVNTMNKACQEKRKNCEISLKNHIKSKYDTFIDPWTVSNKKPIYKSIGKIFNTHLQKEFEAFYNYSRQLIHRQINNRIDRYQSYINQFTNSVYIKTAIQFGRNATQKSNHSLKYYSILGSEIKSYNLQSIPDLYEPRAIFSLYVSFSNEYFKLHNITKTPDSIFKPSQVDFKETIQSKTKRYFQSTLKFSSNKKQMKFSPLDSEINKYYKTRMKIISKNNRFQLKISLWQMRLIIVFIDIIIITYRFYHTLTTIKIIWFGSHIYLSVNNCGKPSNREKLENDATFQAFRFVKFKHYIRNNPTIEIAEFGLSINKLFPCFDCCKRLYYVCIIISFTILIGVASIFVLSFYCMGRSQTNLPSSVADMTLQYMNYRINWLTSRHAARINTEKLNVSIFSDKNNRKRLTRLQRFFQHEETQIQKNLQYHVCDILPANHFFRSLKTYCNNNYVNTVDCSQQSCYFINIKSLNYTENQFLKEMYSAGPLTTSLILIPLLRFIAVAMLVVSAILIMLGIIYHSSKLLARIFLKFSQPINATILNRNFPLLSKSIMKQHFSHSTLRSMSERTNTTFNTPNRSLQTNPIFLKDISNNYSSPVITRSTNSNNHSESRV 703          
BLAST of SMED30001148 vs. Planmine SMEST
Match: SMESG000016698.1 (SMESG000016698.1)

HSP 1 Score: 187.578 bits (475), Expect = 2.224e-47
Identity = 249/1065 (23.38%), Postives = 482/1065 (45.26%), Query Frame = 3
Query: 1530 IKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGXXXXXXXXXXXXXXXFEDMKH-KSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNN-HCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTID----ENCC--LTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSD-PGNYNIGNITFYWSS--------KLNSHSQ-MILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKIRPINRTIDYTLQN--VMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHRGRIVKDIQ-NDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATESLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKVPIEFSTYFHIDLHRLILSSKANIQIALLILVQDCFSTYRKQIYLHPRSPTQRSSINRQTSSKLLLPFERQIE-IRSNQIAFQKEMYHYLLQYLXXXXXXXXXXXXXXXXXXXXXRLCSKTDQKSLMQKIHSTYRKS-LNQECSQHVQTIST--KRRMVLFLFVAFKVFYNFVFTXXXXXXXXXXXXXXXTPFEITPSRFLFSVEQEVRKLDNYGSDEFRRQNEFVNTMNKACQEKRKNCEISLKNHIKSKYDTFIDPWTVSNKKPIYKSIGKIFNTHLQKEFEAFYNYSRQLIHRQINNRIDRYQSYINQFTNSVYIKTAIQFG-RNATQKSNHSLKYYSILGSEIK---SYNLQSIPDLYEPRAIFSLYVSFSNEYFKLHNITKTPDSIFKPSQVDFKET--IQSKTKRYFQSTLKFSSNKKQMKFSPLDSEINKYYKTRMKIISKNNRFQLKISLWQMRLXXXXXXXXXXTYRFYHTLTTIKIIWFGS 4631
            I    NVF +++L        +   + N  +S  I+  SG+ + I L+N+ L   ++D++H +SDN+FIL++   S    L+ PLL I++N+CR PLPD YF+T+T + +R+T+  +  CNQ++    +  C +       +  R++NDQC+ NKA +L ++   FYC +N+ ++N IF   + E +       C   R+ C  C      +   +   K+ID    ENCC  + +CL   +C   YS  C+Y D  +   +  +C++G T +FTLNPQF F N  F CH+  +    + +V I+ SIP        + E+V   +  G      +  Y S+        ++N + Q  ILH   N       F L K+ +  S   P ++KH    Y +++    F  ++ NW+  SC  N+  +   N+ +    +N  +  + +  ++ + F Y + +  +  +I I   E +S++KS +C  +  +    + +++ N +  +Q +     + W L ++G V +   ++N+++ + +   ++ + + ++     S  N F   S   N    P     YF               ++ L++++ DC  +   ++Y+  +     +S ++  +      FER  E + +N+  F      +LL                    ++I  +        ++  I+  Y K  L  +C      + +  KR+ ++ ++V  ++ Y F+FT +  +S++L++  N     IT S+ +  +   +   DN    E  + +E  + + K   +K       L + I+++ DT I  W  SN   I K+  ++F  +L K     Y Y ++ I + +  R+                  A Q G           LK+ SI+ S  K   ++N   +P ++    + S+ +S  N   K  + +K    IFK +Q++  +   ++ + KRY      F+ N+++ +       +N+     +K I  N  F    S+ ++R+ ++ +D+++I +R Y+     +IIWFGS
Sbjct:   69 IDKTSNVFMEDLLLETSFNHIITVNKVNQNASIEIIRRSGIKMTIDLVNIKLHFKYQDVEHPESDNDFILHAKSPSVAADLQKPLLNIIQNFCREPLPDHYFLTVTPFKNRYTRGNKIICNQIQMTTGSVRCPEHYYNGQIYAYRTVNDQCTHNKATYLPQDTDKFYCTQNSPILNSIFHEKITEKIELQSFGECQLHRKNCEKC-----FRPRCASHFKSIDSYDYENCCQFIAQCLLQPSCIDYYSPTCYYVDLAEHQHN--LCIKGSTYQFTLNPQFSFNNKSFMCHMSLEKEKIIYQVKIKVSIPHWMKLEFHLSENVTRPNIKGKLTTTPVYTYESTLMKMQHRFRINEYFQDAILHFKSNK------FHLYKLKERFSETKPIIKKHHQIKYTKIQASYPFAVNSRNWHKRSCYTNIEDLYE-NQLLYNESENISIKLLKLEKNNFQAFNYYVNNIDQSHDINIAFPEKSSILKSAICSLHHLNSRSNLSELKINFALKSQFN-----WTWFLEIKGEVESSYEYLNVKLLEKSKSKIVFNKDILIVELPVSEKNVF---SVNHNLQFFPDSID-YFS--------------KLELILILSDCHQSISYRMYIEQKFNQTFTSFSKNNTK-----FERLYETMFTNRYLFSILRMLFLL-------------------FIMISIIILVIVSMKVLLHINKFYNKGCLRVKCQSWSWIVRSDKKRKFIIIVYVTLRIMYTFIFTSTCIISIILTININ----SITQSKSISLISLPMSTKDNLLKIEIEKNHEKCDLITKLQLKK------FLNDLIENRNDT-IQFWYQSN-VSIPKTSAELFQMNLTKINSKIYKYIQKKIMKNLKLRL------------------ADQIGPMKEIVDETVKLKWLSIISSGTKDKENFNFNILP-IFGVSQMQSIILSKLNGTTKGLSKSKNFQRIFK-NQINLIKINLVRGRFKRY------FNLNEREKQILSKAHRVNR-NANNLKFIVGNEMF----SIIKIRISLLVLDLMLILFRCYNIYRDFQIIWFGS 1029          
BLAST of SMED30001148 vs. Planmine SMEST
Match: SMESG000016698.1 (SMESG000016698.1)

HSP 1 Score: 169.859 bits (429), Expect = 5.423e-44
Identity = 126/426 (29.58%), Postives = 212/426 (49.77%), Query Frame = 3
Query: 1530 IKPAENVFGKNILDTLKLKSNLQFQEFNGRSSETILGASGXXXXXXXXXXXXXXXFEDMKH-KSDNEFILNSTQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQMEHPFNN-HCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNKLVNDIFKHNLKESVSYHPDPGCDYARRKCNTCXXXXXXXXXXXXXXXTID----ENCC--LTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQFDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSD-PGNYNIGNITFYWSS--------KLNSHSQ-MILHGYQNPNHGQQFFSLSKINKNPSTILPKLQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKI 2753
            I    NVF +++L        +   + N  +S  I+  SG+ + I L+N+ L   ++D++H +SDN+FIL++   S    L+ PLL I++N+CR PLPD YF+T+T + +R+T+  +  CNQ++    +  C +       +  R++NDQC+ NKA +L ++   FYC +N+ ++N IF   + E +       C   R+ C  C      +   +   K+ID    ENCC  + +CL   +C   YS  C+Y D  +   +  +C++G T +FTLNPQF F N  F CH+  +    + +V I+ SIP        + E+V   +  G      +  Y S+        ++N + Q  ILH   N       F L K+ +  S   P ++KH    Y +++    F  ++ NW+  SC  N+  +
Sbjct:   69 IDKTSNVFMEDLLLETSFNHIITVNKVNQNASIEIIRRSGIKMTIDLVNIKLHFKYQDVEHPESDNDFILHAKSPSVAADLQKPLLNIIQNFCREPLPDHYFLTVTPFKNRYTRGNKIICNQIQMTTGSVRCPEHYYNGQIYAYRTVNDQCTHNKATYLPQDTDKFYCTQNSPILNSIFHEKITEKIELQSFGECQLHRKNCEKC-----FRPRCASHFKSIDSYDYENCCQFIAQCLLQPSCIDYYSPTCYYVDLAEHQHN--LCIKGSTYQFTLNPQFSFNNKSFMCHMSLEKEKIIYQVKIKVSIPHWMKLEFHLSENVTRPNIKGKLTTTPVYTYESTLMKMQHRFRINEYFQDAILHFKSNK------FHLYKLKERFSETKPIIKKHHQIKYTKIQASYPFAVNSRNWHKRSCYTNIEDL 481          
The following BLAST results are available for this feature:
BLAST of SMED30001148 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F5986.585e-4531.17Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F6N12.478e-4230.62Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A2R2ML224.153e-4224.90uncharacterized protein LOC106172251 isoform X3 OS... [more]
A0A2R2ML121.704e-4124.90uncharacterized protein LOC106172251 isoform X1 OS... [more]
A0A2R2MLG81.933e-4124.90uncharacterized protein LOC106172251 isoform X2 OS... [more]
back to top
BLAST of SMED30001148 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001148 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041540.10.000e+099.04SMESG000041540.1[more]
SMESG000041540.10.000e+096.06SMESG000041540.1[more]
SMESG000041529.10.000e+099.57SMESG000041529.1[more]
SMESG000016698.12.224e-4723.38SMESG000016698.1[more]
SMESG000016698.15.423e-4429.58SMESG000016698.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001148 ID=SMED30001148|Name=SMED30001148|organism=Schmidtea mediterranea sexual|type=transcript|length=5815bp
CAATGAAGCAGGCTAATACTTTGACCTTGATTTGTTTAAGTTTATGTAGA
AAATGTTCTAATAAATTTCATAAAATTTAAAACAATTAGAAGATGTTGCA
AATTACTTGCAGATCTTTTTCACAAGGATTAATAATCATTTTATGTTTTG
GAATAATTTCATCATACATAGAAAAAGATTCCTTAGACTACATACCAGCT
TTCAGTGAGTCAGTGGAAAATATATTCATCAATTTTCAGGGAAATGGAAA
AATTATTCTGAAACAAAGTCAACAAATAGATCAGATATTTCAAGCAGAAA
TTGAAACATTTCATATTCAAAGCAATTCAAAAAGTGTCTTAGTAAAAAGC
AACTGGAAAAAAGTTTCTAAAACCGATTTAGTATTAAACCTGAGCCAGAC
CATTACAAGCTCAAACTTTACTCAATTTCTTCCTGAAATATGCATTGGAG
TATTATTTCTGATTATTGCAGGAGTTATTCTGATAAGAGTAGTTATTCAT
TTCTACAAAAGAAAATACAAACAACATAAAAACAAAAAAGACAAATATTG
TTTTAAGAAAATGAAATTGTTCAATCGCAAGTTAAATAATCAGAAAAATT
CCATTGAAGTAGCAGATCAACTTACAAGTGACAGAGAAGACGATTGTCCA
AGCAGTAGCAAGAGCAGTTCTAAAAACACAATGATTTACCTTCCTCCAAC
TCCAGAAAAGGATGAAATCAAAAGGTCTACCGAAAAGGTTATCGAATACA
TTCTAAATCATTTTCCAAGTTCAAATAGAAAAATTAAAAAATTAAGCGGT
TTTGAAATATTTTCAATTTGTCTGACTTCCATAATACTCCTCTTTGTAAT
AACGGTTTTCACTGATATATCGGTATTTACTGTAAAGGATGTTTCCGCAC
CAGAAGATGATTTTTCTTTTATTGTTTTAACGTTATTTATTCCCCAAGAA
AACTATCTAGAGAAAATAAGGATTTTTGCTCAACAAAAATATACGATATC
AAGTTATATTAATAACTCAGCAAAAGCTTTTCAAAGTAAAATTGACAATT
ATGTTAAATGCCACGTTATAAATGAAATAAAAATCCACAAATTCATTTTA
CAAATTTTCGATATACCGATCGTGGAAAATAATGATGATTTCTTGCCTTG
CGATGAAAAACACAAATGCCTAATTGCATGGCAGCAAGGAAGATATGGAT
GTAATCCAAATACAAAAAAATGTATATGTCAAAGAGGTTTTAGACTTTTA
AAAGGCTTATGTCTAGATGAAAACGAATGTCAAATACCTTTAGTAAGTTC
TTTCTGTGAATCACATTCGAAATGTTTCAACACTGCGGGGACTCACATTT
GTTCATGCTCTCGATTTTCTGGTACTCAGAACAAACATTGTTCAATTTGT
CAAAAGTGTGCAGTTGGAAGCTACGATTCAAATCAATGTATTCTCCCGGC
AGAGACCAATTGCATAGATGCTACTCAGCCGGTGAAGAAAGTCAGTAAAA
GAATTGATAACATCAAAGATATAATCACCATTAAACCAGCTGAAAATGTT
TTCGGGAAAAATATTTTAGACACTCTCAAGTTGAAATCAAATCTACAATT
TCAAGAGTTCAATGGCCGATCATCAGAGACTATTTTAGGCGCTTCCGGTT
TAATTATCAATATTACATTGCTCAATGTGAATTTACCGCCTATCTTTGAA
GATATGAAACATAAAAGTGATAATGAATTCATTCTTAATTCAACTCAAGG
CAGCAATCTCTACCATTTAAAAACGCCATTATTGCAAATTATGAAAAATT
ATTGCAGACATCCACTTCCAGATTCCTATTTTATTACAATGACAACCTAC
ACTGATCGCCACACAAAAGCTCAAAGATATAATTGTAATCAAATGGAACA
TCCTTTCAACAATCATTGTCATCAAGATTCAACTGAATACAACTCTTTCT
ATACCAGGTCTATTAATGATCAGTGTTCAGTAAATAAAGCGATGTTTCTT
TCCGAAGAGTTGCATAGTTTCTACTGTGTTGAAAACAACAAACTCGTCAA
TGATATATTCAAGCATAATTTAAAAGAGTCAGTATCATACCATCCAGACC
CAGGTTGTGATTATGCACGAAGAAAATGTAACACATGCAAAAAGAAAATG
TGCTCAAAAGCAGGAAAATCAAAGTCTAAGAAAACAATTGATGAAAACTG
CTGCCTAACTAAATGCCTCAACGATAAAAATTGTCAAATTCAATATAGCT
CAGAATGTCATTATACTGACCGATTAAAGAAAGGACTTGACCAAGTTATA
TGTATGCAAGGTGATACTGCAAAATTTACACTAAATCCGCAGTTCGATTT
TAAGAATAACAAATTCAAGTGCCATATTCGTAAACAAATTCCAAACAGTC
TCATGAGAGTCATGATACAATTTTCTATTCCCGGAAAAGGTTGGAGCAGT
AGTGTAATCGTTGAAGACGTTCCTTACTCTGATCCGGGAAACTACAACAT
TGGAAATATTACATTTTACTGGTCATCGAAACTTAACAGTCATTCTCAGA
TGATACTTCACGGTTATCAAAATCCAAATCACGGACAGCAATTTTTTTCA
CTCTCAAAAATAAATAAAAATCCTTCTACGATTCTACCAAAATTGCAAAA
ACATGGGGATAAAAGTTATATTGAAGTTGAATTTGAAAATATTTTTGAAT
ATAGCACGTCAAATTGGAATTCATTGTCATGCAAAGTCAATGTCAGTAAA
ATCAGACCGATAAATAGGACTATAGATTATACGCTTCAAAACGTCATGCC
GGTCTCAATTGTCCACAGTGACCGGAAACCGTTTACATATATTTTGAAAT
CTGCCATCGAAGATCCCGAAATTGAGATCGAAGTAAAAGAAAACACTTCT
TTAATTAAATCGCTTTTGTGTGAGGGAAATCAATTTCACCGTGGAAGAAT
TGTGAAAGACATTCAAAACGATTCATTTACTGCTCAATTATCATTACAGA
AATGGCCTTATCAATGGAATTTACTGGTTGAAGGATTTGTATCAAATGAT
GCGACATTTGTCAATATTCAAATCACCGACATTGCCACTGAAAGTTTGCT
TGCGGACTATGAGCAAATAGTTTTCAATCCGGTCAAGAGTTTGTCGAATT
CATTTAGATTTGACAGCCGAAAACGAAACACAAGTAAAGTTCCAATTGAG
TTCTCGACATATTTTCACATTGACCTCCATCGACTTATTTTAAGTTCAAA
AGCCAACATTCAAATCGCTTTATTGATATTAGTGCAAGACTGTTTCTCGA
CATATCGAAAACAAATTTATCTTCATCCCCGTTCTCCAACACAACGCAGT
TCAATTAACAGACAGACCTCTTCGAAGCTTTTATTGCCGTTTGAAAGACA
AATCGAGATACGTTCAAATCAGATAGCATTTCAGAAAGAGATGTATCATT
ATCTTTTACAATATTTAGCCATAATCACTTTTGCGTTTTCAATCATTTAC
TTTTTTATTATAAGTGCTTTGATTATCATTCGGTTATGTTCAAAAACCGA
TCAGAAATCACTGATGCAGAAAATTCATTCAACCTATCGAAAATCTCTCA
ACCAAGAATGCAGCCAGCATGTTCAAACGATTTCCACGAAACGGAGAATG
GTTTTGTTTCTTTTTGTCGCATTTAAAGTGTTTTACAATTTTGTTTTCAC
ACTGAGCGTCGGTTTGTCGTTGGTGTTGAGTTTGGAATCGAACTTGACCC
CATTTGAAATCACTCCGAGTCGGTTTTTGTTTTCCGTCGAACAGGAGGTT
CGCAAGTTAGATAATTACGGTTCGGATGAGTTTCGTCGACAGAATGAATT
CGTGAATACGATGAATAAGGCTTGTCAAGAAAAACGAAAGAACTGTGAGA
TCTCATTGAAAAATCATATCAAATCAAAATACGACACGTTCATTGATCCG
TGGACGGTTAGCAATAAAAAACCAATTTACAAGTCGATTGGGAAGATTTT
CAATACTCATTTGCAGAAGGAATTCGAGGCATTCTATAATTATTCCAGGC
AATTGATTCATAGACAAATCAATAATCGAATAGATCGATATCAGTCATAC
ATAAACCAATTTACTAATTCTGTATATATAAAAACCGCCATTCAATTTGG
GAGAAATGCCACTCAAAAATCTAATCATAGTTTAAAGTATTACTCGATTC
TTGGGAGTGAAATCAAATCATATAACTTGCAATCAATCCCGGATCTCTAT
GAGCCCCGGGCAATTTTCAGTTTATACGTTTCGTTTTCTAACGAATATTT
CAAATTACATAACATCACTAAAACACCTGATTCAATATTCAAACCATCTC
AAGTCGACTTTAAAGAAACAATTCAATCGAAAACAAAACGATATTTTCAA
TCAACTTTAAAATTCAGTTCCAATAAAAAACAAATGAAATTTTCCCCGTT
GGATTCAGAAATAAATAAATATTATAAAACTCGAATGAAAATCATTTCGA
AAAACAATCGATTTCAATTGAAAATTTCTTTGTGGCAAATGCGATTAATT
ATTGTTTTTATTGATATAATTATTATTACTTATCGATTTTATCATACATT
AACCACGATCAAAATAATCTGGTTTGGATCACATATTTATTTGTCAGTTA
ATAATTGTGGAAAGCCATCAAATAGAGAAAAATTGGAAAACGATGCAACT
TTTCAAGCATTTCGGTTTGTGAAATTCAAACATTATATTCGAAACAATCC
AACAATTGAAATTGCCGAATTTGGGCTGTCAATTAACAAGCTTTTCCCTT
GTTTTGATTGTTGCAAGCGACTTTATTACGTGTGCATTATAATTTCATTT
ACAATTCTTATTGGGGTTGCCAGTATTTTTGTCTTATCCTTTTATTGTAT
GGGTCGGTCACAAACAAATTTGCCTTCATCAGTAGCAGACATGACTTTGC
AATATATGAACTACCGGATCAACTGGCTAACATCTAGACATGCTGCACGA
ATCAACACAGAAAAGCTCAATGTTTCAATTTTCAGTGATAAAAATAACAG
AAAACGATTAACAAGATTACAAAGGTTTTTTCAACATGAGGAGACTCAAA
TACAAAAAAATCTGCAATATCACGTATGCGAATTCTTACCGGCTAATCAC
TTTTTTCGTTCATTGAAAACGTATTGTAACAATAATTACGTCAACACAGT
CGACTGCTCCCAGCAATCTTGCTATTTTATTAATATAAAATCGCTAAATT
ATACCGAAAATCAATTTTTAAAAGAAATGTATTCTGTAGGTCCATTGACG
ACCTCTCTAATATTAATTCCTCTGCTTAGATTTATAGCAGTGGCAATGCT
GGTTGTCAGTGCAATCCTAATTATGTTGGGAATCATATATCATTCAAGTA
AATTACTTGCTAGAATATTTCTCAAATTTTCTCAACCTATCAATGCAACA
ATTTTGAACCGAAATTTTCCTTTGCTTTCAAAGTCCATCATGAAACAACA
TTTTTCACATTCCACACTTAGATCAATGTCTGAAAGAACTAACACCACCT
TCAATACTCCTAATCGAAGCTTGCAAACTAATCCAATCTTTTTGAAGGAT
ATATCAAATAATTATTCATCACCTGTAATAACGCGTTCCACAAACTCGAA
TAATCATTCTGAATCTAGAGTTTAATTTATCTTTTTTATGTAAAATTACT
TGTGATGTTTATTTATTATTTTATAATGACAAATATGAGAGTCAGATTGA
AAATTTAGGAAAAATTAAATCCTATTTATTGTTTTTTTCAATAAACATTC
ATGATTAAAAAAAAA
back to top

protein sequence of SMED30001148-orf-1

>SMED30001148-orf-1 ID=SMED30001148-orf-1|Name=SMED30001148-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1861bp
MLQITCRSFSQGLIIILCFGIISSYIEKDSLDYIPAFSESVENIFINFQG
NGKIILKQSQQIDQIFQAEIETFHIQSNSKSVLVKSNWKKVSKTDLVLNL
SQTITSSNFTQFLPEICIGVLFLIIAGVILIRVVIHFYKRKYKQHKNKKD
KYCFKKMKLFNRKLNNQKNSIEVADQLTSDREDDCPSSSKSSSKNTMIYL
PPTPEKDEIKRSTEKVIEYILNHFPSSNRKIKKLSGFEIFSICLTSIILL
FVITVFTDISVFTVKDVSAPEDDFSFIVLTLFIPQENYLEKIRIFAQQKY
TISSYINNSAKAFQSKIDNYVKCHVINEIKIHKFILQIFDIPIVENNDDF
LPCDEKHKCLIAWQQGRYGCNPNTKKCICQRGFRLLKGLCLDENECQIPL
VSSFCESHSKCFNTAGTHICSCSRFSGTQNKHCSICQKCAVGSYDSNQCI
LPAETNCIDATQPVKKVSKRIDNIKDIITIKPAENVFGKNILDTLKLKSN
LQFQEFNGRSSETILGASGLIINITLLNVNLPPIFEDMKHKSDNEFILNS
TQGSNLYHLKTPLLQIMKNYCRHPLPDSYFITMTTYTDRHTKAQRYNCNQ
MEHPFNNHCHQDSTEYNSFYTRSINDQCSVNKAMFLSEELHSFYCVENNK
LVNDIFKHNLKESVSYHPDPGCDYARRKCNTCKKKMCSKAGKSKSKKTID
ENCCLTKCLNDKNCQIQYSSECHYTDRLKKGLDQVICMQGDTAKFTLNPQ
FDFKNNKFKCHIRKQIPNSLMRVMIQFSIPGKGWSSSVIVEDVPYSDPGN
YNIGNITFYWSSKLNSHSQMILHGYQNPNHGQQFFSLSKINKNPSTILPK
LQKHGDKSYIEVEFENIFEYSTSNWNSLSCKVNVSKIRPINRTIDYTLQN
VMPVSIVHSDRKPFTYILKSAIEDPEIEIEVKENTSLIKSLLCEGNQFHR
GRIVKDIQNDSFTAQLSLQKWPYQWNLLVEGFVSNDATFVNIQITDIATE
SLLADYEQIVFNPVKSLSNSFRFDSRKRNTSKVPIEFSTYFHIDLHRLIL
SSKANIQIALLILVQDCFSTYRKQIYLHPRSPTQRSSINRQTSSKLLLPF
ERQIEIRSNQIAFQKEMYHYLLQYLAIITFAFSIIYFFIISALIIIRLCS
KTDQKSLMQKIHSTYRKSLNQECSQHVQTISTKRRMVLFLFVAFKVFYNF
VFTLSVGLSLVLSLESNLTPFEITPSRFLFSVEQEVRKLDNYGSDEFRRQ
NEFVNTMNKACQEKRKNCEISLKNHIKSKYDTFIDPWTVSNKKPIYKSIG
KIFNTHLQKEFEAFYNYSRQLIHRQINNRIDRYQSYINQFTNSVYIKTAI
QFGRNATQKSNHSLKYYSILGSEIKSYNLQSIPDLYEPRAIFSLYVSFSN
EYFKLHNITKTPDSIFKPSQVDFKETIQSKTKRYFQSTLKFSSNKKQMKF
SPLDSEINKYYKTRMKIISKNNRFQLKISLWQMRLIIVFIDIIIITYRFY
HTLTTIKIIWFGSHIYLSVNNCGKPSNREKLENDATFQAFRFVKFKHYIR
NNPTIEIAEFGLSINKLFPCFDCCKRLYYVCIIISFTILIGVASIFVLSF
YCMGRSQTNLPSSVADMTLQYMNYRINWLTSRHAARINTEKLNVSIFSDK
NNRKRLTRLQRFFQHEETQIQKNLQYHVCEFLPANHFFRSLKTYCNNNYV
NTVDCSQQSCYFINIKSLNYTENQFLKEMYSVGPLTTSLILIPLLRFIAV
AMLVVSAILIMLGIIYHSSKLLARIFLKFSQPINATILNRNFPLLSKSIM
KQHFSHSTLRSMSERTNTTFNTPNRSLQTNPIFLKDISNNYSSPVITRST
NSNNHSESRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001881EGF-like_Ca-bd_dom
IPR001368TNFR/NGFR_Cys_rich_reg
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0004871signal transducer activity
GO:0004888transmembrane signaling receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0002250adaptive immune response
GO:0002376immune system process
GO:0007165signal transduction
GO:0007166cell surface receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0009897external side of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0071944cell periphery
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 341..383
e-value: 0.0031
score: 22.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 125..146
NoneNo IPR availableCDDcd00054EGF_CAcoord: 341..382
e-value: 0.00255816
score: 35.305
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 1427..1449
NoneNo IPR availableTMHMMTMhelixcoord: 1073..1095
NoneNo IPR availableTMHMMTMhelixcoord: 1526..1548
NoneNo IPR availableTMHMMTMhelixcoord: 1136..1158
NoneNo IPR availableTMHMMTMhelixcoord: 1693..1715
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
IPR001368TNFR/NGFR cysteine-rich regionPROSITEPS00652TNFR_NGFR_1coord: 369..406
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 341..383
score: 10.173