Cadherin

Overview
NameCadherin
Smed IDSMED30001142
Length (bp)4528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cadherin (SMED30001142) t-SNE clustered cells

Violin plots show distribution of expression levels for Cadherin (SMED30001142) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cadherin (SMED30001142) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cadherin (SMED30001142) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001142

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001142SMESG000020071.1 SMESG000020082.1 SmedASXL_015569SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30001142SMESG000020082.1 SMESG000020071.1 SmedASXL_009563SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000020071.1 Contig4969uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000020071.1 Contig4969newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000020071.1 Contig50022uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000020071.1 Contig50022newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000005704.1 SMESG000005698.1 Contig4969uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000005704.1 SMESG000005698.1 Contig4969newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30001142SMESG000020082.1 SMESG000020071.1 dd_Smed_v4_2107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001142SMESG000020082.1 SMESG000020071.1 dd_Smed_v4_2107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001142SMESG000020082.1 SMESG000020071.1 dd_Smed_v4_2107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001142SMESG000020082.1 SMESG000020071.1 dd_Smed_v4_2107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001142SMESG000020082.1 SMESG000020071.1 dd_Smed_v4_2107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001142SMESG000020082.1 SMESG000020071.1 dd_Smed_v4_2107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001142SMESG000020071.1 dd_Smed_v4_11814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001142SMESG000020071.1 dd_Smed_v4_11814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30001142SMESG000020071.1 dd_Smed_v4_11814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30001142SMESG000020071.1 dd_Smed_v4_11814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001142SMESG000020071.1 dd_Smed_v4_11814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001142SMESG000020071.1 dd_Smed_v4_11814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000044971.1 SMESG000042620.1 SMESG000033763.1 SMESG000020071.1 SMESG000017256.1 SMESG000013089.1 Contig29023uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001142SMESG000044971.1 SMESG000042620.1 SMESG000033763.1 SMESG000020071.1 SMESG000017256.1 SMESG000013089.1 Contig29023newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30001142SMESG000020071.1 dd_Smed_v6_11814_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cadherin vs. TrEMBL
Match: A0A068WGR9 (Cadherin OS=Echinococcus granulosus OX=6210 GN=EgrG_001041800 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.624e-72
Identity = 273/1102 (24.77%), Postives = 470/1102 (42.65%), Query Frame = 1
Query:  628 RSKGVAVVWQIGCGSVEYRHLKTLQWLE----KSCLIGEFSQLIGGIPVEM----WLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQ---------EGYSPKLLVKAXXXXXXXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTN-ILSDLFQVRLRWTGE-NLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTP-DDIFAFQIVYKP-----------------------SKNAS-----------------CEKAALVDAVPYIQ-TKQQLANFYIDSISTIPLKGICNPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFNPS-LLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTV----------TAHILKASFSINVKP--NNWMSR-TINHIIRLTLRINDKSEENSKI------------KSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVL-----DTDGDLKEIGF-----QCPWNNLKKLYKNI---------------------NGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGAC-----AGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQTDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSG-QKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLE--FISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREK 3555
            + K +  +W+IGCG ++   L+ L  +E    +S  I ++  L   I  E     W+V + YD     R KR+A           Q  + +  ++ +G + E SGM   +     +  F+ SN                   PPI  +P+V      + +T+ QI+N +IP  TF+ P          E   P +     +      +  EI  N + WIS+D+  + +R  P P H G+HK +LCA++  +   C  + + V+PPTPI KS+++ +S GV W + +P  W   L  +  +++  ++ G+  F +D ++  + ++TE    +I+   F  TN    +T++ EF +AV  V PV   I S   ++RLRWT   N Y ++      S  A AL++ ++   V  +++ IY V+H R F+   +D  P   I   + VY P                        K+ S                 CE A L+ +V  +Q   +    F ++S++ + + G          A +  S   +              +   S  +I+NF VEAG AF + +N    +    VR   +IDE    + D  WI ++ + T +FGLPL+ H RK  Y+FW+ +  V          T  ++K    + +      W  R T+ H  R+ +R+  K      I             SLS+R  L+  +DK LRP+C   C + I+L D++   +S+I IEW+ LP+L     D   +L          +CP  +++ L + +                        S  ++ Q A    PA  L E L+ A++G+   V ++ +G C      G+          ++ N+T   G  FR P+    T      LS   L+ ++   V  T WL+  A++  ++G+ M   I++G  ++R+   P  G  I    +     NP      NH+V M+ E  +   A    +M+  L  +W+  + ++ Y+RP+C      V    CA   D++L ++    +  VL  + W+ +SL+   +    R + + S Y     PR +
Sbjct:   51 QQKSLFFIWKIGCGYLDDNSLQILSKVENRLKESPDISDWMGL-SSIQAEAIMLDWMVGE-YDHVSKVRSKRQAF----------QGYQPIYPSRTAGAVTEASGM---SPSDLRETHFSSSN-----------------ANPPILVQPMV-----PIEITVQQISNIRIPPNTFHSPDGSKLQLRLFEHIYP-MQFGLDFKDPSAARGREIGGNGASWISFDETNEILRLRPYPEHEGTHKFVLCAYNVANGQTCTNINVRVKPPTPIRKSSIIHVSPGVYWCYSIPVFWFSELRVDAITNIDISVTGD-YFSWDKTRGEICIVTELQSDQIMPFFFRGTNRASAETVEVEFRVAVK-VPPVEKMITSPRLRIRLRWTNTYNSYEMSEFSRLNSSLAQALRV-RVNPSVKSQNIFIYDVVHMRKFQ--EKDSLPMSKILEVEFVYLPLGLPEADYMRNLSVLEDMTSSPWGKSGSSFGLTRESKQFSRLKNICENARLIGSVGAVQAAAESFLPFQLESVTELEVAGSA-------CARILQSVDGSADVNKVYPGPLTTTNIPYSDQVIENFTVEAGLAFKKRINPTKVVPINRVRTIEIIDENYNRLNDSAWITVAEDKTNLFGLPLQNHARKDAYRFWLSIVAVDQRTPINIHFTVDVVKWPLEMTLTSIKYGWFPRPTVVHNHRVRMRMKLKGTVGRGIFPTYSWPPTSPETSLSYRWNLVTNLDKYLRPECSPHCGVGIILMDIQRQDQSVIQIEWAQLPLLQEGIRDVTRNLSHTSLAPATNKCPQRSIQDLQRKLLKAPLYHRYSSPSSSVSSPHQEYFSENDLRQ-ASWSSPAPQLIEHLEWARLGTTAVVAVDLIGNCFSPYWKGESSSRSATVLSVV-NVTTYVGETFRYPLSTDSTCFQSRSLSAC-LFDKDLIEVNETSWLSLDATDCAIFGIAMKSAISAGIHEFRIMTSPV-GTLISRVIIHVGDRNPRLPEVPNHRVLMRFEPGYAVRADPRTHMLQTLRRKWEFLATIDEYLRPECRKIGRYV----CANDMDLLLINV--APDGDVL-NVIWAKKSLVYVPTPSSNRSV-ADSPYSSRHAPRPR 1090          
BLAST of Cadherin vs. TrEMBL
Match: A0A068YD53 (Cadherin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001041800 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 5.096e-72
Identity = 268/1101 (24.34%), Postives = 467/1101 (42.42%), Query Frame = 1
Query:  628 RSKGVAVVWQIGCGSVEYRHLKTLQWLE----KSCLIGEFSQLIGGIPVEM----WLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQ---------EGYSPKLLVKAXXXXXXXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGE-NLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTP-DDIFAFQIVYKP--------SKNAS--------------------------------CEKAALVDAVPYIQ-TKQQLANFYIDSISTIPLKG-ICNPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTV----------TAHILKASFSINVKP--NNWMSRTI---NHIIRLTLRINDKSEEN----------SKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVL-----DTDGDLKEIGF-----QCPWNNLKKLYKNI---------------------NGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGAC-----AGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQTDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSG-QKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLE--FISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREK 3555
            + K +  +W+IGCG ++   L+ L  +E    +S  I ++  L   I  E     W+V + YD     R KR A           Q  + +  ++ +G + E SGM   +     +  F+ SN I                 PPI  +P+V      + +T+ QI+N ++P  TF+ P          E   P +     +      +  EI  N + WIS+D+  + +R  P P H G+HK +LCA++  +   C  + + V+PPTPI KS+++ +S GV W + +P  W   L  +  +++  ++ G+  F +D ++  + ++TE    +I+   F  TN    +T++ EF +AV        I S   ++RLRWT   N Y ++      S  A AL++ ++   V  +++ IY V+H R F+   +D  P   I   + VY P         KN S                                CE A L+ +V  +Q   +    F ++S++ + + G  C+   +        + +       T              +I+NF VEAG AF + +N    +    VR   +IDE    + D  WI ++ + T +FGLPL+ H RK  Y+FW+ +  V          T  ++K    + +      W  R     NH +R+ +++                 S   SLS+R  L+  +DK LRP+C   C + I+L D++   +S+I IEW+ LP+L     D   +L          +CP  +++ L + +                        S  ++ Q A    PA  LSE L+ A++G+   V ++ +G+C      G+          ++ N+T   G  FR P+ A  T      LS   L+ ++   V  T WL+  A +  ++G+ M   ++ G  ++R+   P  G  I    +     NP      NH+V M+ E  +   A    +M+  L  +W+  + ++ Y+RP+C      V    CA   D++L ++    +  VL  + W+ +SL+   +    R + + + Y     PR +
Sbjct:   51 QQKSLFFIWKIGCGYLDDNSLQILSKVENRLKESPDISDWMGL-SSIQAEAIMLDWMVGE-YDHVSKVRSKRRAF----------QGYQPIYPSRTAGAVTEASGM---SPSDLRETHFSSSNAI-----------------PPILVQPMV-----PIEITVQQISNIRVPPNTFHSPDGSKLQLRLFEHIYP-MQFGLDFKDPSAARGREIGGNGASWISFDETNEILRLRPYPEHEGTHKFVLCAYNVANGQTCTNINVRVKPPTPIRKSSIIHVSPGVYWCYSVPVFWFSELRVDAITNIDISVTGD-YFSWDKTRGEICIVTELQSDQIMPFFFRGTNRASAETVEVEFRVAVKAPPVEKMITSPRLRIRLRWTNTYNSYEMSEFSRLNSSLAQALRV-RVNPSVKSQNIFIYDVVHMRKFQ--EKDRLPMSKILEVEFVYLPLGLPEADYMKNLSVLEDMTSTPWGKSGSSFGLTRESKQFSRLKNICENARLIGSVSAVQAAAESFLPFQLESVTELEVAGSACDRILQSVDGSADVNKIYPGPLTTTNIPYSDQ-------VIENFTVEAGLAFKKRINPTKVVPMNRVRTIEIIDENYNRLNDSAWITVAEDKTNLFGLPLQNHARKDAYRFWLSIVAVDQRTPINIHFTVDVVKWPLEMTLTSIKYGWFPRPTVVHNHRVRMRMKLGGTVGRGISPTYSWPPTSPETSLSYRWNLVTNLDKYLRPECSPHCGVGIILMDIQRQDQSVIQIEWAQLPLLQEGIRDVTRNLSYTALAPATNRCPQRSIQDLQRKLLKAPLYHRYSSPSSSVSSPHQEYFSENDLRQ-ASWSSPAPQLSEHLEWARLGTTAVVAVDLIGSCFSPYWKGESSSRSATILSVV-NVTTYVGETFRYPLSADSTCFQSRSLSAC-LFDKDLIEVNETSWLSLDAGDCAIFGIAMKSAVSVGIHEFRIMANPV-GTLISRVIIHVGDRNPRLPEVPNHRVLMRFEPGYAVRADPRTHMLQTLRRKWEFLATIDEYLRPECRKLGRYV----CANDMDLLLINV--APDGDVL-NVIWAKKSLVYVPTPSSNRSV-ADNPYSSRHAPRPR 1090          
BLAST of Cadherin vs. TrEMBL
Match: A0A5K3EJ30 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.260e-71
Identity = 307/1290 (23.80%), Postives = 540/1290 (41.86%), Query Frame = 1
Query:  250 KVFS-FPDWLMYTGKGN--H-NLQGLPVNKDI---GTYRVSLTLSS----CLIINVNRLNNTDPQQFKCNLRWPTLAAIILD--------------VDLSNLTISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVLANGLG--NSDGRIRSKG---VAVVWQIGCGSVEYRHLKTLQWLE-----KSCLIGEFSQLIGGIPVEM--WLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAXXXXX-----------XXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSD-LFQVRLRWTGE-NLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTP-DDIFAFQIVYKP----------------------------------------SKNASCEKAALVDAVPYIQ-TKQQLANFYIDSISTIPLKG-ICNPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFNPSL--LIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTV----------TAHILKASFSINVKP--NNWMSR---TINHIIRLTLRINDKSEEN----------SKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLD--------TDGDLKEIGFQ-----CPWNNLKKLYKN-INGISNYEIE-------------------QRAVQKIPAQALSEELQKAKIGSVVDVKIERMGAC-------AGQVPDLGVINKDLLP--NITAICGLGFRVPIKAIQT-DKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLP-NPFQGSKLNHKVTMQLE--FISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKL 3621
            KV S  P WL  +  G+  H  L GLP+ +D+    T+ V++  S+    CL ++V  L   DP  F C +  P LAAI+                ++L +   +  +                 +L+       S+ +LA      N    I  +G   +  +W+IGCG ++   L  L  +E     K  +         G  V +  W+V +   + ++R  +              Q+ +R+  ++ +G + E SG+      S D  S N                LP    P     P+V + ++ + +T++QI+N +IP  TF  P      KL +K +                T    EI    + W+S+D   + +R  P   H G+HK +LCA++      C  + ++V+PPTPI KS +L +  G+ W + +P  W   L   + SD+  ++ G  +F +D +K  + V+TE    +I+   F  T+    Q ++ EF ++V  V P+  I+S    ++RLRW    N Y +  +    S  A  L++ ++   V  +++ IY VL  R+F+   +D +    +   + VY P                                        S    CE A L  +V  +Q   + L  F+++S++ + L G  C+   + ++   +    + +         +      P L  +IDNF VEAG AF + +N    +    +R   +IDE    + D  WI ++ + T +FGLPL+  VRK  Y+FW+ + TV          T  ++K    +   P  + W  R     NH +R+ +++++ +             S  KSLS+R  L+  +D+  RPDC   C + I+L D++   +S+I ++W+ LP+L         T G+  +         CP ++++ L +  +    N+                      ++A    PA  L E L  A++G+ + + ++ +G C              G      +P  N T   G  FR PI A  T  +S+SQ    +L+ ++   V  T W++   S   +YG+ M    T+G  +   I   +   + S   + V+  NP      NH+V M+ E  +   A    +++  L+ +W+    L+ Y+RP+C   T  VD   CA   D++L +I   T+  VL  + W+ +SL+   S  K    ++ S+  Q     EK L  + +   ++  + EP  +L
Sbjct:   46 KVISPLPTWLTASKSGDLGHVTLLGLPLYRDVFNSSTFTVTICNSTVTCCCLHLSVMSLPK-DPPIFTCLVDHPILAAIVTGLENPERIMQSPIGRINLWSTMHAHLVGFNLQPASRNVTRHSFAVLDKKPKILSSLQILAQATNHQNCTSAINKEGFLRLYFLWKIGCGYLDDTSLHLLTKIETRFQSKPVISEWLGATTNGSQVVLLDWMVGEYSPKLKVRSKRHSP-----------QVYQRVYPSRTAGAISEASGV-----VSSDVESLN----------------LP----PSSSTSPIVVQAIAPIEITVNQISNIRIPATTFDAPD---GTKLQLKLFDHMYPMQFGFDFKDPSTVTGKEIDSKGTNWVSFDAANEILRLRPYSEHEGTHKFVLCAYNIAGTRACTNIHVHVKPPTPIKKSFILHVYPGIFWCYPVPVYWFSELKVVSMSDIDISVTGE-LFSWDRNKGEICVVTELQSEQIMAFFFRGTHKASTQAVEVEFRISVK-VPPIEKIISSPRLRIRLRWMNAFNSYEMRELSRLNSSLAQVLRV-RVNPSVTSQNIFIYDVLKIRNFQ--EKDNSQLSKLLEVEFVYLPLGLPDASYSEYWSLLDELNSRSWRTSTSEISHASKDKHFISLKGICESARLSGSVSALQAAAESLHPFHLESVTELELSGSACSRILQSSSIGARGDGATQSTDVSKIYPHQITTTNLPFLDQVIDNFTVEAGLAFKKRINPNKVVPMSRIRAIEIIDEYYNRLGDSAWINVAEDKTNLFGLPLQNQVRKDAYRFWLSILTVDHREPINIHFTVDVVKWPLKVTSLPTRHGWFPRLKTVHNHRVRMRMKLDEMAGRGISLTHNWPPKSPEKSLSYRWSLLSNLDRYFRPDCGLHCGVGIMLIDIQRQDQSVIQVDWALLPLLQEGLREMFTTMGNFSDTVAATSSSICPQSSIQDLQRRLLRAPLNHRYSSPSSAVASAHQDYFPLNDLRQASWSAPAPQLVEHLDWARLGTTMVIAVDLIGTCFAPYWKGGSHASVDGGRPSTFMPIVNFTTYIGETFRHPISADNTCVRSLSQ--NARLFDKDLLEVNETSWVSLEGSKCRIYGIAMKSAATTG-IHEFQIMASSASSVLSRVTINVVERNPLLPEVPNHRVLMRFEPGYAVRADPRTHVLQTLNRKWQFLLTLDKYLRPECQ-KTEKVD---CANNIDLLLINI--ATDGDVL-NVIWAKKSLVYLPSLSK----WTKSSTAQ-PAASEKYLDGRKLNAPQRLTQREPFGEL 1275          
BLAST of Cadherin vs. TrEMBL
Match: A0A5K4F164 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.976e-52
Identity = 268/1159 (23.12%), Postives = 473/1159 (40.81%), Query Frame = 1
Query:  556 EDVSSFERSIFVLANGLGNS---DGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIG-----------EFSQL--IGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNER-LMDAKYSGTLLEGSGM------PRITGGSGDKPSFNESNTIRNV-SKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVK--------------AXXXXXXXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIF---------CYDSSKAILQVLT-----------EAVE------SRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNI---LSDLFQVRL--RWTGENLYPLNSIKSFLSEFALALKMGKIANY-VDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIV--------------YKPSKN--------ASCEKAALVDAVPYIQTKQQL-ANFYIDSISTIPLKGICNPSQKPTTAHLXXXXXXXXXXXXXXXXXX-----------XXXDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHI-LKASFSINVKP-----NNWMSRTINHIIRLTL--RINDKSEENSKI------KSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGF------QCPWNNLKKL-------------YKN---INGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACA-------GQ----------VPDLGVINKDLLPNITAICGLGFRVPIKAIQTDKSISQLSY--VQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHIT-SGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPL--GDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLL---QQTSYKKKREIYSTSNYRQY 3537
            E  + +ER + +LA+   ++   + +     +  +  IGCG +    LK L  LEK   +G            F++      I +  W+V DL     I     +A  Q  +  +   LN+R  + ++ +G L EGSGM      P+I     D  SF E ++   + S IP+                 V+  ++ +  T++QI+N +IP+ TFYD Q+GY+  L +                   +       EI  +   W+S+D   Q IR  P P H+G+H  ++CA D+  N VCE   I V+ P+P  K+ +L+I  G+ W +++P  W   L   +   L   ++G++ F         C  S+  I Q++T           ++VE      +++  +   +TN K     ++   L   +++ +  I   L+++ Q R+    + E LY    I     +F +      IA++ +D   L + L     +  ++S D    +I +FQ++              Y  S N          C+ + L  A   +Q  ++L   F ++S+  + L+       K  T  L+    ST+       T                 F P++L  NF V AG  F + +N       K ++Y  L D     + D +WI L+ + + + GLPL EH+RK  Y F + +++V     +   F++ V+       N  S  +NH +RL +   I   + + ++I       SL++R +L   IDK L P+C   C  D+ ++ +     + + + W+ L +L   G   + G        CPW     L              KN   + G++N      +    P+      ++ +++G V    ++RMG+CA       GQ                ++ D++ N T   G GFR   + I  D  ++ +S   V LY      V  +HW+        ++G+ +   +  S  K+ +   P+  V +Q    V    NP      NH+V M        P   G +++     RW + SAL+ Y+RP C  S        C    D+IL ++    +    F + W+ +S+L   +  +  K  EI  +   ++Y
Sbjct:  195 ESPTIYERKLSILASAKAHNYIRNSKSNFSQLVSIQHIGCGIIPDYILKILTILEKRFQMGLIPIWTLLNNTNFTRFEKFKHITLAEWIVGDL-----IHNSLHDAA-QTKQNNVKRSLNKRSALSSREAGYLEEGSGMASFQQFPKI-----DYRSFLEHSSTDLIHSNIPR-----------------VKNYITPIKTTVYQISNIQIPQNTFYDLQDGYTQNLKLTLYASNLENISYIELKSMENLNQAIGEEITRDIKKWVSFDTKNQIIRLKPLPDHVGNHTFIVCATDRDQNRVCEPFQIIVKRPSPFRKNFILRIPPGIFWCYQIPIYWFKELKTLSFDKLDLEVKGDSPFSWNVQTGEVCVISNLKISQIITLFFHATNAKLAQSVEIEFRLSAKVPSVQLLVTNSKLRMKFQWPEKLTNYELNTLNKINLTLAEILQNRINPEVSSEKLYVYEII-----QFKMPQNESDIASFELDWIFLPLGLPNDGEEIFLLSNDSAITNINSFQMIQNTNLHNVNQPINLYVQSNNIPKLSKLLTDCQLSNLDKAEITLQNNKKLFIPFKLESVKLLNLENSACFLAKKITKQLEEQAYSTSQRSSEIGTNLSRWSDSHLYMPANVQFMPNVL-PNFTVIAGLRFKKSINPDNVTPSKRIQYMELRDAYGLILDDSSWISLTLDNSHLIGLPLNEHIRKQPYLFRLYIHSVDQKTPITIGFTVEVQDWFETMKNDKSFQLNHRVRLRILPSIQTSTSQPTEIWPVKPSSSLNYRWKLSNAIDKFLHPNCSPPCNPDVGIWQITQQNVNSLSVTWAQLSLLQEQGK-SQTGISDGNTPNCPWEKFDHLQNLLIFAPTLVSAQKNLGLVTGLANDGQLYLSPWSAPSNHFRAHMESSELGIVEAAVVDRMGSCARHTNKFEGQELTGKSMQNRFSSFSSLDNDVIMNFTVFTGEGFR---RKIVNDDILATMSRSNVHLYDIGGRQVGSSHWIGLEKDKSTIFGIIIGNSVQPSSHKFHITDNPEKNVGVQFSIYVAG-SNPQLPINFNHRVVMHFSADHSRPWTGGHSLVD----RWLLISALDDYLRPHCMGSMI------CRNDMDIILLTLNYQASG---FSVIWAQKSILILTENINLNKTTEILDSYTQQEY 1301          
BLAST of Cadherin vs. TrEMBL
Match: A0A158QU58 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5788 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.669e-51
Identity = 219/920 (23.80%), Postives = 377/920 (40.98%), Query Frame = 1
Query:  262 FPDWLMYTGKGN--H-NLQGLPVNKDI---GTYRVSLTLSS----CLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVL----------------ANGLGNSDGRIRSKG---VAVVWQIGCGSVEYRHLKTLQWLE-----KSCLIGEFSQLIGGIPVEM--WLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAXXXXX-----------XXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSD-LFQVRLRWTGE-NLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKP----------------------------------------SKNASCEKAALVDAVPYIQ-TKQQLANFYIDSISTIPLKG-ICNPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFN-------PSL--LIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTV----------TAHILKASFSINVKP--NNWMSR---TINHIIRLTLRINDKSEEN----------SKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILI 2646
             P WL  +  G+  H  L GLP+ +D+    T+ V++  S+    CL ++V  L   DP  F C +  P LAAI+  ++     +   +   N          G  L     +  R  F +                A    N    I  +G   +  +W+IGCG ++   L  L  +E     K  +         G  V +  W+V +   + ++R  +              Q+ +R+  ++ +G + E SG+      S D  S N                LP    P     P+V + ++ + +T++QI+N +IP  TF  P      KL +K +                T    EI    + W+S+D   + +R  P   H G+HK +LCA++      C  + ++V+PPTPI KS +L +  G+ W + +P  W   L   + SD+  ++ G  +F +D +K  + V+TE    +I+   F  T+    Q ++ EF ++V  V P+  I+S    ++RLRW    N Y +  +    S  A  L++ ++   V  +++ IY VL  R+F+          +   + VY P                                        S    CE A L  +V  +Q   + L  F+++S++ + L G  C+   + ++   +    + +              F        P L  +IDNF VEAG AF + +N    +    +R   +IDE    + D  WI ++ + T +FGLPL+  VRK  Y+FW+ + TV          T  ++K    +   P  + W  R     NH +R+ +++++ +             S  KSLS+R  L+  +D+  RPDC   C + I+L D++    S+I +
Sbjct:   14 LPTWLTASKSGDLGHVTLLGLPLYRDVFNSSTFTVTICNSTVTCCCLHLSVMSLPK-DPPIFTCLVDHPILAAIVTGLENPERIMQSPIGRINLWSTMHAHLVGFNLQPASRNVTRHSFAVLDKKPKILSSLQILAQATNHQNCTSAINKEGFLRLYFLWKIGCGYLDDTSLHLLTKIETRFQSKPVISEWLGATTNGSQVVLLDWMVGEYSPKLKVRSKRHSP-----------QVYQRVYPSRTAGAISEASGV-----VSSDVESLN----------------LP----PSSSTSPIVVQAIAPIEITVNQISNIRIPATTFDAPD---GTKLQLKLFDHMYPMQFGFDFKDPSTVTGKEIDSKGTNWVSFDAANEILRLRPYSEHEGTHKFVLCAYNIAGTRACTNIHVHVKPPTPIKKSFILHVYPGIFWCYPVPVYWFSELKVVSMSDIDISVTGE-LFSWDRNKGEICVVTELQSEQIMAFFFRGTHKASTQAVEVEFRISVK-VPPIEKIISSPRLRIRLRWMNAFNSYEMRELSRLNSSLAQVLRV-RVNPSVTSQNIFIYDVLKIRNFQEKDNSQL-SKLLEVEFVYLPLGLPDASYSEYWSLLDELNSRSWRTSTSEISHASKDKHFISLKGICESARLSGSVSALQAAAESLHPFHLESVTELELSGSACSRILQSSSIGARGDGATQSTDILCSIFFTFIQCFMHVRIANLPFLDQVIDNFTVEAGLAFKKRINPNKVVPMSRIRAIEIIDEYYNRLGDSAWINVAEDKTNLFGLPLQNQVRKDAYRFWLSILTVDHREPINIHFTVDVVKWPLKVTSLPTRHGWFPRLKTVHNHRVRMRMKLDEMAGRGISLTHNWPPKSPEKSLSYRWSLLSNLDRYFRPDCGLHCGVGIMLIDIQRQDTSIIFL 889          
BLAST of Cadherin vs. Ensembl Nematostella
Match: EDO37873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEJ5])

HSP 1 Score: 55.0694 bits (131), Expect = 2.510e-7
Identity = 77/327 (23.55%), Postives = 120/327 (36.70%), Query Frame = 1
Query:  259 SFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSL-----------------TLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIIL------DVDLSNLTISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVK 1170
            + P WL      N  L+G+P  +D GTY + L                   S   + N N     D +   C+   P  AA I+       VD        +     A +        L    + +   + + +L  G GN     R  G+ + WQIGCG ++    +    L+ S   G F + +   PV  W VA  + +    R +R+ +     T    Q    +       T       P  T      PS  +++T+     IP +    TV   P    PVV   LS+V +   Q+  F IP  TF D ++G + +L +K
Sbjct:   62 TLPHWLALDESTN-TLEGVPSWRDKGTYHLELHGHETQHFKILVKDLNDIRSDLSLRNSNDTKVPDTKHIVCHSGLPVEAATIIFDLHAEKVDGKGRCALMKRVAEFADEAVESLHFSLGKGHNTALGLKDVQMLTAGPGNVQ-DARQPGLVISWQIGCG-IDLAGTRVASLLKSSAETGAFHEALSA-PVTGWHVATGFPKGPRHRARRQVILNLAPTPTPAQKKPYIPTKILQAT-------PTPTATIAPPPSRVDASTV----SIPTVRPTVTV---PSNNAPVVISRLSRVTVYSGQLIRFLIPENTFSDREDGGTRRLNLK 370          
BLAST of Cadherin vs. Planmine SMEST
Match: SMESG000020071.1 (SMESG000020071.1)

HSP 1 Score: 2676.74 bits (6937), Expect = 0.000e+0
Identity = 1371/1374 (99.78%), Postives = 1371/1374 (99.78%), Query Frame = 1
Query:   73 MISYWKSFGVILDLCSFLVLFVDSNVESTNYCEFSAFVGQSFTMSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAXXXXXXXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPLKGICNPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQTDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKXXXXXXXXXXXXXXDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSFGRQQTPSIRSSPHSHDRFPHGVFG 4194
            MISYWKSFGVILDLCSFLVLFVDSNVESTNYCEFSAFVGQ FTMSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQRLNLWNALKLNLKGAAGLRLLEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPP PFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAYYTSSKTKKKYEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPLKGICNPSQKPTTAHLKTSTVSTTIPKPTPKTQRKPPDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQ DKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKPLILPHEKPPLPPPDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSFGRQQTPSIRSSPHSHDRFPHGVFG
Sbjct:    1 MISYWKSFGVILDLCSFLVLFVDSNVESTNYCEFSAFVGQIFTMSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQRLNLWNALKLNLKGAAGLRLLEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPTPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAYYTSSKTKKKYEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPLKGICNPSQKPTTAHLKTSTVSTTIPKPTPKTQRKPPDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQMDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKPLILPHEKPPLPPPDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSFGRQQTPSIRSSPHSHDRFPHGVFG 1374          
BLAST of Cadherin vs. Planmine SMEST
Match: SMESG000020071.1 (SMESG000020071.1)

HSP 1 Score: 2591.22 bits (6715), Expect = 0.000e+0
Identity = 1329/1331 (99.85%), Postives = 1329/1331 (99.85%), Query Frame = 1
Query:  202 MSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAXXXXXXXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPLKGICNPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQTDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKXXXXXXXXXXXXXXDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSFGRQQTPSIRSSPHSHDRFPHGVFG 4194
            MSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQRLNLWNALKLNLKGAAGLRLLEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPP PFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAYYTSSKTKKKYEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPLKGICNPSQKPTTAHLKTSTVSTTIPKPTPKTQRKPPDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQ DKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKPLILPHEKPPLPPPDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSFGRQQTPSIRSSPHSHDRFPHGVFG
Sbjct:    1 MSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQRLNLWNALKLNLKGAAGLRLLEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNVSKIPKIATLPTVVGPPTPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAYYTSSKTKKKYEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPLKGICNPSQKPTTAHLKTSTVSTTIPKPTPKTQRKPPDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLLPNITAICGLGFRVPIKAIQMDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKPLILPHEKPPLPPPDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSFGRQQTPSIRSSPHSHDRFPHGVFG 1331          
BLAST of Cadherin vs. Planmine SMEST
Match: SMESG000017193.1 (SMESG000017193.1)

HSP 1 Score: 206.068 bits (523), Expect = 3.259e-53
Identity = 290/1243 (23.33%), Postives = 522/1243 (42.00%), Query Frame = 1
Query:  112 LCSFLVLFVDSNVESTNYCEFSAFVGQSFTMSKTKIRHCVCENYNNKVFSFPDWLMYT-GKGNHNLQGLPVNKDIGTYRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNL-TISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVAD-LYDRD-RIRRMKREAL--WQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESNTIRNV--SKIP-------KIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAXXXXXXXXXXXEIFHNDSYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVLWVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENLYP---LNSIKSFLSEFALALKMGKIANY-----VDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKP--SKNASCEKAA----LVDAVPYIQTKQQLANFYIDSISTIPLKGIC------NPSQKPTTAHLXXXXXXXXXXXXXXXXXXXXXDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRLTLRINDKSE----------ENSKIK---------SLSFRVQLMKEIDKVLRPD-CEYKCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNI--------NGISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKD---LLPNITAICGLGFRVPIKA---IQTDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIF-PQNGVKIQSHFLVTVLPNPFQGSKLNHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAV---------------DIQECALRFDVILFSI-ERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTSNYRQYECPREKLLKLKSMLF 3582
            L   L+L +  +  S +    +A VG+ F ++++ I             + P+WL  + GK     QG+P+  +IG YR++  LS    I+V + +  +  + +C  RWPT+  II+D  +S L +  +        K   K  + L   ED+ S  +S+ VL+        R      A+V+QIGCGS+    +   ++ EK   I   S+++  +P+  WL+AD +Y    R RR +R +   +    +    Q  +R  D K +  ++EGSG             F+E+ T+ NV  S++P       K  T+P V  P    +P++R++L+   + I     F+IP +TF+D ++GY+ +L +KA+  S +++   +I  N + WI + +  Q I   P+   +GS+ + +CA+D   N VC+   ++++ P  I + + +    GV+W + + + W D + ++    +   ++ +++  +  + + L ++TEA  S+  +I     +    QTL ++  +    ++   +  S    ++L     N  P   +N IK  L        +G I+ Y         ++ +Y ++  ++   +        I +F  VY P  S   +C + +    LVD++ Y   +    N+ I+ I  I + G C      NP    TT+     +    I              N S+   N +V  G  F + + +        V    L+D     + +  W+ L  +   I+GLPL E+VR   YKF + +   +  + +   +I V          +H   L + I++K              S +K         +LS+R Q+++ I + L  D C   C   I +      +   + I WS L   D+          C    LKKL + +        + IS +          P Q L   LQK  +G+   + ++ +G+C+    D   IN        NI+   G  F V +     I   K+I Q S +Q    +N +V    WL  S   + +YGLP+L  +     + L IF     V+    + +++   P + S  +  + + L  + +     N+   LD + K+A  +  Y+ P C++    V                +Q C    DVI+ SI +R  + +V  +I WS  S            ++ST N     C    L  L   LF
Sbjct:    3 LHVLLILRIILSHSSLSAATLNAVVGKLFHINQSLIVQSGARP------NIPNWLCGSPGK----YQGIPLKGNIGEYRINERLS----ISVYQESTFNSTKSRCTQRWPTVMVIIMDNRISQLPSCERVKFWHLLNKYLPKHDSHLTFEEDIPSLLKSLSVLSQWSLKGSKRPSPSQSAIVYQIGCGSIPESVINKFKYFEKEDNINHLSKVLS-LPIRGWLIADQIYPATIRKRRHRRNSYLKFTEYSSIFYQQEKQRKEDWKEAQIVVEGSGQ------------FDENWTVPNVDLSRLPIAVSNKTKNETIPYVRKPE-KSQPIIRKSLTNFTVLIGSRKYFQIPPKTFFDAEDGYNQQLKIKAFIRSKESQIDRQISFNPTQWIYFLEKQQAIGLQPRKTDVGSYYITICAYDTDRNRVCDGARLFIKKPKTINRKSYIAAPPGVVWKYPIQATWPDEVKYSNNDSIVIKVQSSSLIEWQGNISRLSLVTEAYTSKEHQIKMVAESQTTGQTLIWKMIVTSVGLNSYVDATSPELVIKLSSFHTNRIPFELINLIKEKL--------IGSISRYWTILKSSSREIFLYKIVKGKE-SFLENSKEAMSILSF--VYSPLQSNPVNCSEVSFSSELVDSMKY-DLRIASNNWNIELIDIIEIPGKCSNYEAFNPIPYQTTSKPNLISQDHQINAVPDL-------VNKSI---NLEVRNGLTFKKIILLPFQNGYAEVLMMELLDINNLVIDESPWVSLLISPYAIYGLPLAENVRSQPYKFKLKVTLRSGSVQEVIVNIVVVR---FELQTDHRFGLIISISEKDTLEFDRARQRFNGSPLKTMNQLLVSQTLSYRWQVVETIARYLHTDQCLLDCGTHIYIHSFSEPKSWQVNISWSML--FDSPDSSDYSTTACSHEKLKKLIRLLIKSDQYTESIISMFLSSIYTFDAYPHQTLVRSLQKNSLGTPTWLTVDPLGSCSNSA-DKTEINSSEAVFWSNISLNQGNIFAVLLDKKLRINKPKAIYQ-SKIQF---SNGSVWDLGWLKLSHDGRIIYGLPLLSDLVLQSYFSLRIFLDSEEVRENLKYYLSMTLKPSRHSTASTHI-VNLTILPLQNYAKNVFE-LDSKIKLARTINAYLHPSCSLGNRTVYNGFRMFKLEPHKRKHLQFCEKAEDVIIHSIRKRSHDKKVFVDIIWSQVS------------VWSTENGSDSVCNTNSLNDLSGNLF 1171          
BLAST of Cadherin vs. Planmine SMEST
Match: SMESG000045996.1 (SMESG000045996.1)

HSP 1 Score: 125.946 bits (315), Expect = 1.272e-28
Identity = 154/649 (23.73%), Postives = 280/649 (43.14%), Query Frame = 1
Query: 2140 PSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHI-LKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEY--KCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLY-KNIN-GISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAG---QVPDLGVIN-KDLLPNITAICGLGFRVPIKAIQTDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGV-KIQSHFLVTVLPNPFQGSKL-------NHKVTMQLEFIS-IAPLGDNMITGLDLRWKVASALETYIRPQCT---ISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIY--STSNYRQYECPREKLLKLKSMLFSEKDN--RLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNE-------PETPLFQTKPSGQ---EDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRN------YSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSK 3963
            P     +F V AG  F   +  + +++   ++   L  E    + ++ WI LS++  F++GLPLK+HVR+  YKF  ++    +    K +F + V   +  + ++NH I+L+++      EN  I  + +R +L+ ++DK +R +CE    C  D+ L+D+   Q +      S    +     L +    CP  +L + + K IN  I+N E         P  AL +    + +G ++  +I   G C G   Q PDLG I    ++P   ++    FRV   +       S   Y      N        W++ +  +  L GL M +H  S       +   N + KI S  +   +    +           NH++ + +   S I P  D     L  +   +S ++ Y R  C     +   +    C      IL+   R+ NS+ +  I +   +L+++ +Y K  +    +  N  +  CP ++L+K++  L  E  +  +L  LP +  + +      +     + LG C    N+         E     T P+ +   +D ++MFL+ T++P C+F I  L V LM+A C+++RN       + +  +++ +  G  SP+IL  E   S  PPS+
Sbjct:  656 PKFQYTHFTVTAGIPFKSYVLRRTSLDHNNIKEMRL--ETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVK-----TENLNI-DVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPSSSSVSIEISYISLLSKNNKICPKLSLIRFHEKYINTAINNKETT-------PNFALKQVFTVSGLGEIIGCQIILTGICQGMKLQPPDLGQITVYTMIPFYESL--QKFRVFYNSTVWFSIDSGNPYKNKLMYN-------EWISVNNDSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKND----FLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGAN---ILY--RRIFNSENMETITFKF-NLIRELTYIKPVDSSPNNAGNGLKSSCPVDQLIKIERSLIGESGSPTKLGILPSVNEYFQKSKLGKIVDINFEYLGACFQQQNHRFSKIEVLDEINRKNTHPTLKKVNDDSRQMFLMATIVPTCSFIIISLCVGLMVACCLQKRNQKFIRSMNSHFSSAEFAMRGGTSPIILAGEYQHSYMPPSR 1270          

HSP 2 Score: 75.8702 bits (185), Expect = 2.149e-13
Identity = 114/497 (22.94%), Postives = 207/497 (41.65%), Query Frame = 1
Query:  142 SNVESTNYCEFSAFVGQSFTMSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGT-----------YRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQXXXXXXXXXXXXXXXXXXXXXEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNE--SNTIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAXXXXXXXXXXXEIFHND-SYWISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKST-VLQISAGVLWVHEMPSQWLDGLTFNTTSD-LTFAIEGNAIFCYDSSKAILQVLTEAVESRILKI 1584
            S+VE  N    SA+VG  F   + KI         +K  S P+W+ +    N  L GLP+  ++G            Y +++ LS+     + R +  D + ++  +    LAA+    + + L++S    +   + +         ++       RS+ +L      +   + +K + ++W IG   +   +LK+LQ  E     G   + I  I ++ W V  L+ + +  R+    +++RG            ++   +   +EGSG+  +          NE    T  N++K  +I  L   V   I  KP V   L  + +   QI N+ IP  TF D +         K+         + +I  ND + WISY+++ QNIR  PK   IG   L +CA++     +C+ + I V PP P      V + +   +  H +P  W +        D L     GN+ F ++ +  +  +   ++E R+++I
Sbjct:   22 SSVEVHN---LSAYVGYVF---EAKI-------IMDKKVSLPNWMYW---DNETLIGLPLENNLGERLLLSSTPGQEYIITVKLSNPWWRKLARPDKIDIENYQSEM---FLAALTFSSE-AFLSLSIENKIQLIIDIKNIMYIKCPIVITSERISRSVTILTKS---NTTILHNKSLVLLWSIGKDYIYNPYLKSLQNFESRFNNGPPLK-INHIQIQQWFVGFLHRQRKFSRI----IYRRG------------INNAETVAFIEGSGLLSVKKA-------NELIKRTKENINKT-EINHLNKTV---IKSKPSVNIQLPPIKMHALQIMNYVIPENTFIDKE--------FKSLLRIKVFSIEDKIVSNDPTKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEI 459          
The following BLAST results are available for this feature:
BLAST of Cadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WGR93.624e-7224.77Cadherin OS=Echinococcus granulosus OX=6210 GN=Egr... [more]
A0A068YD535.096e-7224.34Cadherin OS=Echinococcus multilocularis OX=6211 GN... [more]
A0A5K3EJ302.260e-7123.80Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K4F1641.976e-5223.12Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A158QU581.669e-5123.80Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Cadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO378732.510e-723.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000020071.10.000e+099.78SMESG000020071.1[more]
SMESG000020071.10.000e+099.85SMESG000020071.1[more]
SMESG000017193.13.259e-5323.33SMESG000017193.1[more]
SMESG000045996.11.272e-2823.73SMESG000045996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001142 ID=SMED30001142|Name=Cadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=4528bp
TTCGACGTTTCGGAATAAATTATATTTAGAAATTATTTTATCAATTAAAA
TTAATAAACCGGATCACACGATATGATTTCTTATTGGAAATCTTTTGGTG
TAATTCTTGATCTTTGTAGTTTTCTGGTTTTATTTGTGGATTCGAATGTT
GAATCGACAAATTACTGTGAGTTTAGCGCATTTGTTGGACAAAGTTTTAC
CATGTCCAAAACCAAAATAAGGCACTGCGTGTGTGAAAATTATAACAACA
AGGTTTTTTCCTTTCCTGATTGGTTAATGTATACCGGGAAAGGAAATCAC
AATTTACAAGGTCTTCCAGTGAACAAGGATATTGGTACTTATCGAGTTTC
TTTAACTTTATCGTCATGTTTAATTATTAACGTCAACCGTCTTAATAATA
CTGATCCTCAACAGTTTAAATGTAATCTGAGATGGCCAACTTTAGCAGCA
ATTATTCTGGATGTTGATCTATCTAATTTAACAATATCACAACGCTTGAA
TCTTTGGAATGCATTAAAATTAAATCTCAAGGGCGCAGCAGGACTCAGAC
TTTTAGAAGATGTTTCTTCTTTCGAAAGATCAATATTTGTGCTTGCAAAT
GGATTGGGAAATTCTGATGGTAGAATAAGAAGTAAAGGAGTAGCCGTTGT
TTGGCAGATTGGCTGCGGTTCAGTAGAATATCGTCATTTGAAAACCTTAC
AATGGCTGGAAAAGTCATGTTTGATCGGTGAATTTAGTCAATTAATTGGT
GGAATTCCTGTAGAGATGTGGCTTGTAGCTGATCTTTACGATCGAGATCG
TATACGTAGAATGAAACGTGAGGCTTTGTGGCAGAGAGGTAAAACCGGAC
TTGGGTTACAGTTGAATGAGCGTTTGATGGACGCTAAATATTCTGGTACT
CTTTTGGAAGGATCTGGAATGCCTCGTATTACTGGAGGATCCGGAGATAA
GCCTAGTTTTAATGAATCTAATACAATTCGTAATGTATCAAAAATACCCA
AAATTGCAACTCTGCCAACTGTTGTAGGTCCACCTATACCATTTAAACCG
GTCGTTCGAAGGAATCTAAGCCAAGTCGTTCTTACAATTCATCAAATTAA
TAATTTTAAAATTCCAAGAGAAACTTTTTATGATCCTCAAGAAGGATACT
CACCAAAATTACTAGTTAAAGCCTATTACACTTCTTCTAAAACAAAGAAA
AAATATGAAATATTCCATAATGATTCGTACTGGATTTCTTACGATAAAGA
TTTACAAAACATTCGATTTCTTCCGAAACCTCCGCACATCGGATCACATA
AATTGTTACTTTGTGCATTTGACAAGCAAGATAACAACGTTTGCGAGCGT
TTGTGGATTTATGTTCGGCCACCTACACCAATAACGAAATCGACAGTGTT
ACAAATTTCAGCAGGAGTACTCTGGGTTCATGAAATGCCAAGTCAGTGGC
TTGATGGGCTCACTTTTAACACGACCTCGGATTTGACCTTTGCAATCGAA
GGAAACGCCATATTTTGTTACGATTCATCCAAAGCAATTTTGCAAGTTTT
AACTGAAGCTGTTGAATCTCGAATTTTAAAAATAACATTCAATATAACAA
ATCCAAAGGAATACCAAACATTGAAATATGAATTTACTCTTGCTGTATCA
GATGTTAGTCCGGTTACAAATATATTAAGTGATCTATTTCAAGTGAGACT
TAGGTGGACTGGTGAAAATCTTTATCCCTTGAATTCCATTAAATCATTTC
TCAGTGAATTTGCCTTGGCCCTAAAAATGGGGAAAATAGCCAATTATGTC
GACCCAGAAGATTTATTGATTTATCTCGTATTGCACAGCAGAGATTTCCG
AGTCATTTCTCGTGACATGACGCCTGATGATATATTTGCTTTTCAAATTG
TCTATAAACCTTCTAAAAATGCATCCTGTGAAAAGGCGGCATTGGTTGAT
GCGGTACCTTATATCCAAACCAAACAACAACTAGCCAATTTCTACATTGA
TTCAATATCAACGATTCCTCTCAAAGGTATTTGTAACCCATCTCAGAAAC
CAACAACAGCTCATCTAAAGACTTCTACAGTGTCTACAACCATTCCAAAA
CCGACTCCAAAAACCCAACGAAAACCTCCGGATTTCAATCCATCGCTTCT
CATAGATAATTTCGATGTCGAGGCGGGATTTGCTTTTATGCGAGAATTGA
ATATCAAAGCTGCAATCAACGAAAAACTCGTTCGATATTTCAATCTAATA
GATGAAGAAGAAAAGAATGTGACGGATAAAAATTGGATAGGTCTGTCATC
GAATGGAACCTTTATATTTGGACTACCTCTCAAGGAGCATGTTCGCAAAT
TAATTTATAAATTTTGGATCGTTTTATACACGGTAACTGCTCATATTCTA
AAAGCTTCATTTAGCATAAATGTGAAGCCCAACAACTGGATGAGCCGGAC
AATAAATCACATCATTAGACTGACACTGAGAATTAATGATAAATCCGAAG
AAAATTCTAAAATAAAATCTCTGAGCTTTAGAGTCCAACTCATGAAAGAA
ATCGACAAAGTTTTGAGACCAGATTGCGAATACAAATGTGCAATGGACAT
TTTGTTATTCGATTTAAAGATTTATCAAAAATCTTTGATTCTTATCGAAT
GGAGCCATTTGCCCGTCTTGGATACAGACGGTGACCTAAAAGAGATTGGG
TTTCAGTGTCCATGGAATAATTTAAAGAAATTGTACAAGAACATAAATGG
CATATCCAATTATGAGATAGAGCAACGAGCCGTTCAGAAAATTCCAGCTC
AAGCATTATCAGAAGAATTGCAGAAAGCTAAAATTGGTTCAGTAGTCGAT
GTTAAGATAGAAAGAATGGGAGCATGTGCAGGTCAAGTACCAGATTTAGG
AGTGATCAACAAGGATCTATTACCGAACATTACGGCAATTTGCGGACTGG
GATTTCGGGTACCAATAAAAGCAATTCAGACGGACAAATCAATTTCCCAG
CTGTCCTATGTCCAATTATACTTTGAAAATAATTTTGCTGTGCCAAGAAC
ACATTGGTTGACAGCTTCTGCAAGTAATCAGTTTTTATATGGGTTGCCGA
TGCTCATACATATAACAAGTGGTCAAAAATATAGATTACACATTTTCCCA
CAAAATGGTGTCAAAATACAGAGCCATTTTCTTGTTACAGTTTTACCAAA
TCCTTTCCAAGGTTCAAAATTGAATCATAAAGTAACAATGCAACTAGAAT
TCATCAGCATCGCTCCTCTGGGAGACAACATGATAACCGGTTTAGATTTA
CGTTGGAAAGTGGCCTCAGCATTGGAAACATATATCAGACCGCAATGTAC
GATTTCCACGACGGCAGTTGATATTCAAGAATGTGCACTCAGATTTGATG
TTATTCTGTTCTCCATAGAAAGAGTTACCAATTCTCAAGTTTTGTTTGAA
ATCAAATGGTCCTTAAGGTCGTTATTGCAGCAAACATCCTACAAAAAGAA
AAGAGAAATTTATTCAACTTCTAATTATCGACAATATGAATGTCCTAGGG
AAAAACTGCTGAAGTTGAAATCCATGTTATTTTCAGAAAAAGACAATCGC
CTAGAACCTCTGCCGAAACTTAAAATACATTTGAAGACATACGCTGGAGT
TAATTTGAAGTCAGCCCAATTAAAACAACTCGGACCCTGCATCAATATAA
ATAATAATGAACCGGAAACGCCTCTGTTTCAAACTAAACCATCGGGCCAA
GAAGACGGTCAAAAAATGTTTTTAATTACAACAGTTATTCCGGTTTGTGC
ATTCACAATATGTATACTTTTCGTTGCACTTATGATTGCACTTTGCATGA
AAAGGCGGAATTATTCTGGATATATGAAAGCCAGTCAAAATAGTCAATTG
GGGCCAGGTTCTCCAGTCATTCTTCCAGATGAAATTGATCGATCATCATA
TCCACCATCAAAGCCACTGATTCTCCCCCACGAGAAACCTCCATTGCCTC
CACCAGATTACAATCATGAATCAACACCAAATTTTGTAACAATGACTACT
TGTTCTTACAGAGGACCTATACAAACTATGTCAAAAATGACTACAGGATT
AGAAATGACTACCTCGTCGTTTGGTCGTCAACAAACTCCATCGATACGGA
GTTCACCGCATTCACATGACAGATTTCCTCATGGTGTTTTCGGATGACAG
AAGTAGCCGAGTTCTATTAAATTGACAAAAATGTCTATCAGCATGTCGAT
CATTTCATATGCTGACTAATGCCAACTGCTGGTAAACATTACTAATCCTA
TTGAATAGTGGTTACATCAAACTCATACCAGTTGACTGCCGAAAAACTAG
ACAATTAATTAACAATTTACAACTTACTGTAGTTCTATAAAATTCAGTTG
TTTCTACTAAGCTTCTTTTTCTATTGGAATTTGTAAATAGTTTGGTAATT
GAAATGGATTTTTTCCAATAACAATATTTGTACTATTGTTTATTTATTAT
TAATAATAAACATTAATTTAATTGAAAA
back to top

protein sequence of SMED30001142-orf-1

>SMED30001142-orf-1 ID=SMED30001142-orf-1|Name=SMED30001142-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1375bp
MISYWKSFGVILDLCSFLVLFVDSNVESTNYCEFSAFVGQSFTMSKTKIR
HCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGTYRVSLTLSSCL
IINVNRLNNTDPQQFKCNLRWPTLAAIILDVDLSNLTISQRLNLWNALKL
NLKGAAGLRLLEDVSSFERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGS
VEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKRE
ALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNESN
TIRNVSKIPKIATLPTVVGPPIPFKPVVRRNLSQVVLTIHQINNFKIPRE
TFYDPQEGYSPKLLVKAYYTSSKTKKKYEIFHNDSYWISYDKDLQNIRFL
PKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKSTVLQISAGVL
WVHEMPSQWLDGLTFNTTSDLTFAIEGNAIFCYDSSKAILQVLTEAVESR
ILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDLFQVRLRWTGENL
YPLNSIKSFLSEFALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMT
PDDIFAFQIVYKPSKNASCEKAALVDAVPYIQTKQQLANFYIDSISTIPL
KGICNPSQKPTTAHLKTSTVSTTIPKPTPKTQRKPPDFNPSLLIDNFDVE
AGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFG
LPLKEHVRKLIYKFWIVLYTVTAHILKASFSINVKPNNWMSRTINHIIRL
TLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEYKCAMDILLFDLKI
YQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLYKNINGISNYEIE
QRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQVPDLGVINKDLL
PNITAICGLGFRVPIKAIQTDKSISQLSYVQLYFENNFAVPRTHWLTASA
SNQFLYGLPMLIHITSGQKYRLHIFPQNGVKIQSHFLVTVLPNPFQGSKL
NHKVTMQLEFISIAPLGDNMITGLDLRWKVASALETYIRPQCTISTTAVD
IQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIYSTS
NYRQYECPREKLLKLKSMLFSEKDNRLEPLPKLKIHLKTYAGVNLKSAQL
KQLGPCININNNEPETPLFQTKPSGQEDGQKMFLITTVIPVCAFTICILF
VALMIALCMKRRNYSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKPLI
LPHEKPPLPPPDYNHESTPNFVTMTTCSYRGPIQTMSKMTTGLEMTTSSF
GRQQTPSIRSSPHSHDRFPHGVFG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016010dystrophin-associated glycoprotein complex
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027468Alpha-dystroglycan_domain_2
IPR013783Ig-like_fold
IPR008465DAG1_C
Vocabulary: biological process
TermDefinition
GO:0007016cytoskeletal anchoring at plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008465Dystroglycan, C-terminalPFAMPF05454DAG1coord: 1220..1324
e-value: 3.6E-15
score: 56.1
IPR027468Alpha-dystroglycan domain 2GENE3DG3DSA:3.30.70.1040coord: 118..251
e-value: 9.2E-12
score: 47.4
IPR027468Alpha-dystroglycan domain 2SUPERFAMILYSSF111006Dystroglycan, domain 2coord: 122..236
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1349..1374
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..685
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..678
NoneNo IPR availablePANTHERPTHR21559DYSTROGLYCAN-RELATEDcoord: 29..237
coord: 1147..1334
coord: 291..432
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.688
NoneNo IPR availableTMHMMTMhelixcoord: 1237..1259