SMED30001139

Overview
NameSMED30001139
Smed IDSMED30001139
Length (bp)1727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001139 (SMED30001139) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001139 (SMED30001139) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30001139SMESG000058905.1 dd_Smed_v4_19192_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30001139SMESG000058905.1 dd_Smed_v4_19192_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001139SMESG000058905.1 dd_Smed_v4_19192_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001139 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002222:7858..9584 -8536
Homology
BLAST of SMED30001139 vs. Planmine SMEST
Match: SMESG000058905.1 (SMESG000058905.1)

HSP 1 Score: 976.852 bits (2524), Expect = 0.000e+0
Identity = 501/505 (99.21%), Postives = 503/505 (99.60%), Query Frame = 3
Query:   33 MMEFHQTXXXXXXXXXXXDISIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSLLEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPINESICDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKNFQSYKKVWIGLSXXXXXXXXXXXXXXYKLPWIKQCHFARIGYKRANEVVLLSTEVSM 1547
            MMEFHQTFLFFFIVFFLLDISIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSL EFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKP NESICDGSYSV+HPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCK+FQSYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLSTEVSM
Sbjct:    1 MMEFHQTFLFFFIVFFLLDISIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSLFEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPTNESICDGSYSVEHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKSFQSYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLSTEVSM 505          
BLAST of SMED30001139 vs. Planmine SMEST
Match: SMESG000058905.1 (SMESG000058905.1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 500/504 (99.21%), Postives = 502/504 (99.60%), Query Frame = 3
Query:   36 MEFHQTXXXXXXXXXXXDISIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSLLEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPINESICDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKNFQSYKKVWIGLSXXXXXXXXXXXXXXYKLPWIKQCHFARIGYKRANEVVLLSTEVSM 1547
            MEFHQTFLFFFIVFFLLDISIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSL EFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKP NESICDGSYSV+HPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCK+FQSYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLSTEVSM
Sbjct:    1 MEFHQTFLFFFIVFFLLDISIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSLFEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPTNESICDGSYSVEHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKSFQSYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLSTEVSM 504          
BLAST of SMED30001139 vs. Planmine SMEST
Match: SMESG000058905.1 (SMESG000058905.1)

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 479/485 (98.76%), Postives = 483/485 (99.59%), Query Frame = 3
Query:   93 SIQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSLLEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPINESICDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKNFQSYKKVWIGLSXXXXXXXXXXXXXXYKLPWIKQCHFARIGYKRANEVVLLSTEVSM 1547
            +I+IWDPNLTLISANCSNVNIEATCPKLVKERNIEFSL EFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKP NESICDGSYSV+HPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCK+FQSYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLSTEVSM
Sbjct:   17 NIKIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSLFEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPTNESICDGSYSVEHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKSFQSYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLSTEVSM 501          
BLAST of SMED30001139 vs. Planmine SMEST
Match: SMESG000058883.1 (SMESG000058883.1)

HSP 1 Score: 211.46 bits (537), Expect = 3.582e-60
Identity = 145/454 (31.94%), Postives = 229/454 (50.44%), Query Frame = 3
Query:   96 IQIWDPNLTLISANCSNVNIEATCPKLVKERNIEFSL--LEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLF-GDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSE-IMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPINESICDGSYSVKHPIQ-----MWLLGGQHCFEEFENDCQY-EQYKSNRNKCDISSRRCREMQSF------TQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCK---NFQSYKKVW 1400
            + IW+P++ L +  C+ V + A CP L   R+IEF L  L  PT++V  ++T +C  + ++ L  +  + C NLY+VNISLSPIF   +C EYC + H+S IWL  G+ C     ++ + + N ++  +N C  S+ +CS D   +S       +       +L +A C+N   +  CP       + FI    N  Q H E I K C+ N + ++ V+F +SCK+ Y + +S    +        + K P++      W+LG   C  + +  C++ +Q+K   NKC  S+  C +          +QWSPNIK++ A+C N+TV   CP +N  R +E +L++  D       T+IC   S   L++SF  +C  +Y+ N+ M P      CD +CS   SS+ +LLG +LC     D CK   Y+   N CP     C    N  S  K+W
Sbjct:   46 VPIWNPDIRLTNGVCNEVTLTAKCPTLSTRRSIEFELYPLYDPTKSV--IQTLQCRINQSQPLTTTFSIQCKNLYRVNISLSPIF---SCTEYCSDIHTSRIWLLGGNTCGE---IALDCAFNVHLPRENSCINSSIQCSLDSTVQSATR----VSPMSLNPRLVNAYCKNVTVEASCPQSPEDQYIEFILSLSN--QKHLESISKLCQSNATKLVQVTFKISCKNFYYVEVSLLSSSLK------NSKVPLRNQRSATWILGDVICSNDIKEKCRFIDQFKVPENKCYTSTVNCTDSSQMSLTTPSSQWSPNIKIVKAFCDNVTVSVDCPRVNKQREIEINLIK--DFRNEEFSTRICKLNSSETLEISFNLKCMNIYHFNVSMKPTFSPFECDLYCSNPLSSQKYLLGSRLCRNSSFDDCKYDAYKTKNNLCPKSSKKCPEIINGSSSHKIW 477          

HSP 2 Score: 147.902 bits (372), Expect = 1.407e-37
Identity = 112/419 (26.73%), Postives = 194/419 (46.30%), Query Frame = 3
Query:  114 NLTLISANCSNVNIEATCPKLVKERNIEFSLLEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPINESI-CDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRCREM----QSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLRMGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHS--SEMWLLGRKLCPKVGLDYCKVRKYEINENHC 1349
            N  L++A C NV +EA+CP+  +++ IEF L     ++++S+    C ++  K + V+ K+ C N Y V +SL      +   +  L    S  W+ GD+  +         ++++  P+N C  ST  C+      SQ S      +     K+  A C+N    ++CP  N   ++     +   F+N     + CK N+S  + +SF+L C ++Y  ++S KP      CD   S     Q +LLG + C     +DC+Y+ YK+  N C  SS++C E+     S   W   +K++  +C+N+TV+A+CP  ++   + F L   G+       +  CN      +   F   CR +Y    I + I  +   + +  K  S  S+ W+ G + CP+   + C+  KY  N   C
Sbjct:  194 NPRLVNAYCKNVTVEASCPQSPEDQYIEFILSLSNQKHLESISKL-CQSNATKLVQVTFKISCKNFYYVEVSLLSS--SLKNSKVPLRNQRSATWILGDVICSNDIKEKCRFIDQFKVPENKCYTSTVNCT----DSSQMSLTTPSSQWSPNIKIVKAFCDNVTVSVDCPRVNKQREIEINLIKD--FRNEEFSTRICKLNSSETLEISFNLKCMNIYHFNVSMKPTFSPFECDLYCSNPLSSQKYLLGSRLCRNSSFDDCKYDAYKTKNNLCPKSSKKCPEIINGSSSHKIWESQLKIVQDFCSNVTVKASCP--DLKDRINFLLFEKGNSQPIKGRSVPCNSSRGYTVAAHFRIRCRNLY--QFIANLIRNTNKTEPYKKKNESILSQFWVFGTENCPENKFNICQSAKYRFNSTKC 599          

HSP 3 Score: 113.62 bits (283), Expect = 3.724e-26
Identity = 77/293 (26.28%), Postives = 130/293 (44.37%), Query Frame = 3
Query:  105 WDPNLTLISANCSNVNIEATCPKLVKERNIEFSLLEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGD-ICQNKQFLSNNGSLNKYMTPKNICPASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHIS----------FKPINESICDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRRC 950
            W PN+ ++ A C NV +   CP++ K+R IE +L++      +   T  C  ++++ L +S  L C+N+Y  N+S+ P F    C  YC    SS  +L G  +C+N  F  ++   + Y T  N+CP S++KC   +   S     +      S+ K+    C N   +  CP  +   ++ F+ + + + Q        C  +    +   F + C++LY    +          +K  NESI           Q W+ G ++C E   N CQ  +Y+ N  KC     RC
Sbjct:  335 WSPNIKIVKAFCDNVTVSVDCPRVNKQREIEINLIK--DFRNEEFSTRICKLNSSETLEISFNLKCMNIYHFNVSMKPTFSPFECDLYCSNPLSSQKYLLGSRLCRNSSF--DDCKYDAYKTKNNLCPKSSKKCPEIINGSSSHKIWE------SQLKIVQDFCSNVTVKASCP--DLKDRINFLLFEKGNSQPIKGRSVPCNSSRGYTVAAHFRIRCRNLYQFIANLIRNTNKTEPYKKKNESILS---------QFWVFGTENCPENKFNICQSAKYRFNSTKCADGYYRC 606          
BLAST of SMED30001139 vs. Planmine SMEST
Match: SMESG000062659.1 (SMESG000062659.1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.433e-14
Identity = 46/139 (33.09%), Postives = 72/139 (51.80%), Query Frame = 3
Query:  105 WDPNLTLISANCSNVNIEATCPKLVKERNIEFSLLEFP-TQNVQSVKTYK-CPASNAKKLHVSMKLPCINLYQVNISLSPIFPMINCREYCLEAHSSPIWLFGDI-CQNKQFLSNNGSLNKYMTPKNICPASTQKCSAD 512
            W P++ L SANC    IE +CP   ++  ++ SL+ F   Q +Q     + C  S +K +     + C  LYQV ++L P   + NC + C +   S +W  G++ C   Q  SN+    KY T KNICPAS+ + + +
Sbjct:   22 WSPDMKLHSANCQTATIETSCPNNTEDYMLDISLITFVNNQELQLENVMRTCRLSKSKLIQTHFSVKCKGLYQVKVNLVPK-NLSNCNKDCSKTLKSSVWYLGELACDEAQ--SNDYQYEKYKTTKNICPASSIRLTVN 157          

HSP 2 Score: 70.4774 bits (171), Expect = 1.964e-13
Identity = 41/127 (32.28%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  573 KLTDADCENAIFQMECP--LFNFGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHISFKPINESICDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCDISSRR 947
            KL  A+C+ A  +  CP    ++   ++ I +  N       +M+ C+ + S +I   FS+ CK LY + ++  P N S C+   S      +W LG   C E   ND QYE+YK+ +N C  SS R
Sbjct:   27 KLHSANCQTATIETSCPNNTEDYMLDISLITFVNNQELQLENVMRTCRLSKSKLIQTHFSVKCKGLYQVKVNLVPKNLSNCNKDCSKTLKSSVWYLGELACDEAQSNDYQYEKYKTTKNICPASSIR 153          

HSP 3 Score: 57.7658 bits (138), Expect = 4.672e-9
Identity = 36/132 (27.27%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  963 SFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLR-MGDRSIS-ATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICDEFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCP 1352
            +F  WSP++KL +A C   T++ +CP       L+ SL+  + ++ +    V + C       ++  F  +C+ +Y V + + P   S  C++ CSK   S +W LG   C +   +  +  KY+  +N CP
Sbjct:   18 AFATWSPDMKLHSANCQTATIETSCPNNTEDYMLDISLITFVNNQELQLENVMRTCRLSKSKLIQTHFSVKCKGLYQVKVNLVPKNLSN-CNKDCSKTLKSSVWYLGELACDEAQSNDYQYEKYKTTKNICP 148          
The following BLAST results are available for this feature:
BLAST of SMED30001139 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001139 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058905.10.000e+099.21SMESG000058905.1[more]
SMESG000058905.10.000e+099.21SMESG000058905.1[more]
SMESG000058905.10.000e+098.76SMESG000058905.1[more]
SMESG000058883.13.582e-6031.94SMESG000058883.1[more]
SMESG000062659.12.433e-1433.09SMESG000062659.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001139 ID=SMED30001139|Name=SMED30001139|organism=Schmidtea mediterranea sexual|type=transcript|length=1727bp
TTTCTGTCTAAATTAATTATAAGAGATTCTCTATGATGGAATTTCACCAA
ACATTTTTATTCTTTTTTATAGTTTTCTTTTTATTGGATATTTCTATTCA
GATATGGGATCCAAACCTTACTCTCATATCGGCAAATTGTTCGAATGTGA
ATATTGAAGCAACATGCCCGAAATTGGTAAAAGAACGAAATATTGAATTC
TCTCTGTTAGAATTCCCGACCCAAAATGTACAATCTGTAAAAACTTATAA
ATGTCCGGCTTCAAATGCAAAAAAACTTCATGTTTCAATGAAGCTACCAT
GCATAAATTTATATCAAGTCAACATCAGTTTATCACCGATATTTCCAATG
ATTAATTGTAGAGAATATTGTTTGGAGGCCCACTCAAGTCCAATTTGGTT
GTTTGGAGATATTTGTCAAAATAAGCAGTTTCTTTCAAACAATGGTTCTT
TAAACAAATACATGACCCCAAAAAATATTTGTCCAGCCTCGACACAAAAA
TGCTCAGCAGATCTAAAAACAGAATCACAGAAATCTTTTATGCAAACTAT
CAAAAAAACATTATCAAAGGCCAAATTGACTGATGCTGATTGTGAAAATG
CCATCTTTCAGATGGAATGTCCACTGTTCAATTTTGGCAGTCAGTTGACC
TTCATTTTTTACAGACAAAACCACTTTCAAAATCACTCGGAAATTATGAA
ACATTGCAAACCAAACAATTCAAATGTTATTAACGTTTCATTTTCTCTTT
CATGTAAAAGTCTTTACCTTTTACATATCAGTTTCAAACCGATTAATGAA
TCAATCTGTGATGGATCGTACTCAGTAAAGCATCCTATTCAAATGTGGCT
ATTGGGAGGTCAACACTGCTTCGAAGAGTTTGAAAATGACTGTCAATACG
AGCAATATAAATCGAATAGAAACAAATGTGACATTTCATCAAGACGCTGC
AGAGAGATGCAATCATTTACCCAGTGGTCACCAAACATTAAATTGATAAC
CGCTTATTGTACTAATATTACTGTGCAAGCAACGTGTCCCTTCTTGAATG
TGTCCCGCAATCTGGAATTTTCTTTACTTAGAATGGGAGACAGAAGTATT
TCTGCCACTGTAACGAAAATATGTAACCCATTAAGTAAAACCTATTTGAA
AGTTAGTTTTGAGTTCGAATGTAGAGCTGTGTACTATGTGAATATCATTA
TGAGTCCTATTACCCCATCAATGATTTGTGATGAATTTTGCTCAAAGCAG
CACTCCAGTGAAATGTGGCTTTTAGGAAGGAAACTTTGCCCGAAGGTGGG
ACTTGATTATTGTAAGGTCAGGAAATACGAAATAAACGAAAATCATTGTC
CTATACATCTAGACACTTGCAAAAACTTTCAGTCCTATAAAAAAGTTTGG
ATTGGATTGTCAATAACTTTATTCGTTGTAGTTCTAATTATAGTAATAAC
AATATATAAACTTCCTTGGATCAAACAATGTCATTTTGCTAGAATTGGTT
ATAAGAGAGCAAACGAGGTTGTACTACTTTCTACTGAAGTTAGTATGTAA
ACTTCATACATTCTATAAAGATCTTCCATTGTGAAACAAGTGTCAATTTG
CGAATCTCAAAAAACATTTTTGAAATGTCCATTCTTAAATATTTTTACAC
TTTGATTTGTTTTAAAATGTTATATGGAGATTGCCACCTTCACTATCACT
TGCATAGAATGGCTAGAGAATTGCAAC
back to top

protein sequence of SMED30001139-orf-1

>SMED30001139-orf-1 ID=SMED30001139-orf-1|Name=SMED30001139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=506bp
MMEFHQTFLFFFIVFFLLDISIQIWDPNLTLISANCSNVNIEATCPKLVK
ERNIEFSLLEFPTQNVQSVKTYKCPASNAKKLHVSMKLPCINLYQVNISL
SPIFPMINCREYCLEAHSSPIWLFGDICQNKQFLSNNGSLNKYMTPKNIC
PASTQKCSADLKTESQKSFMQTIKKTLSKAKLTDADCENAIFQMECPLFN
FGSQLTFIFYRQNHFQNHSEIMKHCKPNNSNVINVSFSLSCKSLYLLHIS
FKPINESICDGSYSVKHPIQMWLLGGQHCFEEFENDCQYEQYKSNRNKCD
ISSRRCREMQSFTQWSPNIKLITAYCTNITVQATCPFLNVSRNLEFSLLR
MGDRSISATVTKICNPLSKTYLKVSFEFECRAVYYVNIIMSPITPSMICD
EFCSKQHSSEMWLLGRKLCPKVGLDYCKVRKYEINENHCPIHLDTCKNFQ
SYKKVWIGLSITLFVVVLIIVITIYKLPWIKQCHFARIGYKRANEVVLLS
TEVSM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.737
NoneNo IPR availableTMHMMTMhelixcoord: 455..477
NoneNo IPR availableTMHMMTMhelixcoord: 7..25