Histone chaperone ASF1

Overview
NameHistone chaperone ASF1
Smed IDSMED30001127
Length (bp)779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone chaperone ASF1 (SMED30001127) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone chaperone ASF1 (SMED30001127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone chaperone ASF1 (SMED30001127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone chaperone ASF1 (SMED30001127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30001127h1SMcG0017461 SmedASXL_006575SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30001127h1SMcG0017461 SmedASXL_006575SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30001127h1SMcG0017461 Contig41662uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001127h1SMcG0017461 Contig41662newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30001127h1SMcG0017461 dd_Smed_v4_5120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001127h1SMcG0017461 dd_Smed_v4_5120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001127h1SMcG0017461 dd_Smed_v4_5120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001127h1SMcG0017461 dd_Smed_v4_5120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001127h1SMcG0017461 dd_Smed_v4_5120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001127h1SMcG0017461 dd_Smed_v4_5120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone chaperone ASF1 vs. Ensembl Human
Match: ASF1B (anti-silencing function 1B histone chaperone [Source:HGNC Symbol;Acc:HGNC:20996])

HSP 1 Score: 188.734 bits (478), Expect = 1.507e-59
Identity = 90/153 (58.82%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Human
Match: ASF1B (anti-silencing function 1B histone chaperone [Source:HGNC Symbol;Acc:HGNC:20996])

HSP 1 Score: 188.734 bits (478), Expect = 1.507e-59
Identity = 90/153 (58.82%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Human
Match: ASF1A (anti-silencing function 1A histone chaperone [Source:HGNC Symbol;Acc:HGNC:20995])

HSP 1 Score: 187.963 bits (476), Expect = 3.323e-59
Identity = 88/153 (57.52%), Postives = 120/153 (78.43%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ ++NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+P  IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Human
Match: ASF1B (anti-silencing function 1B histone chaperone [Source:HGNC Symbol;Acc:HGNC:20996])

HSP 1 Score: 159.844 bits (403), Expect = 1.160e-48
Identity = 78/135 (57.78%), Postives = 103/135 (76.30%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISEL 482
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S++
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQV 135          
BLAST of Histone chaperone ASF1 vs. Ensembl Human
Match: ASF1B (anti-silencing function 1B histone chaperone [Source:HGNC Symbol;Acc:HGNC:20996])

HSP 1 Score: 159.844 bits (403), Expect = 1.160e-48
Identity = 78/135 (57.78%), Postives = 103/135 (76.30%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISEL 482
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S++
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQV 135          
BLAST of Histone chaperone ASF1 vs. Ensembl Celegans
Match: unc-85 (Probable histone chaperone asf-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19326])

HSP 1 Score: 173.326 bits (438), Expect = 6.238e-53
Identity = 85/155 (54.84%), Postives = 114/155 (73.55%), Query Frame = 3
Query:   81 AKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGYE 545
            ++++I  V++L+NPA F  KFK ++TFE  E L  DLEW+L+YV S  + D DQVLDS LVGPIP GRH+FV D D PD +KIPVDDIVGV+V+LL   Y DQEF+ +G+FV+NEY +EE+++ PP++P+I +L R +   D RIT F I W  E
Sbjct:    3 SRVNIVQVQILDNPAMFVDKFKLEITFEVFEHLPHDLEWELVYVGSGTSRDFDQVLDSALVGPIPEGRHKFVFDADHPDISKIPVDDIVGVSVLLLRCKYNDQEFINMGWFVANEYTEEELKENPPSQPLIEKLSRKVETEDLRITTFPIRWTDE 157          
BLAST of Histone chaperone ASF1 vs. Ensembl Celegans
Match: asfl-1 (Probable histone chaperone asf-1-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q17603])

HSP 1 Score: 169.859 bits (429), Expect = 4.891e-52
Identity = 83/152 (54.61%), Postives = 112/152 (73.68%), Query Frame = 3
Query:   81 AKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            ++++I  V++L+NPA F  KFK ++TFE  E L  DLEW+L+YV S  + D DQVLDS LVGPIP GRH+FV D + PD +KIPV+DIVGV+V+LL   Y DQEF+ +G+FV+NEY  EE+++ PPA+P+I +L R I   D R+T F I W
Sbjct:    3 SRVNIVQVQILDNPAMFVDKFKMEITFEVFEHLPHDLEWELVYVGSGTSRDFDQVLDSALVGPIPEGRHKFVFDAEHPDISKIPVEDIVGVSVLLLRCKYNDQEFINMGWFVANEYTDEELKENPPAKPLIEKLSRKIETEDLRVTTFPIRW 154          
BLAST of Histone chaperone ASF1 vs. Ensembl Fly
Match: asf1 (gene:FBgn0029094 transcript:FBtr0302381)

HSP 1 Score: 183.341 bits (464), Expect = 1.868e-57
Identity = 87/155 (56.13%), Postives = 118/155 (76.13%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGY 542
            MAK+ I+NV VL+NP+ F + F+F++TFEC+E L++DLEWK+IYV SA + + DQVLD++ VGP+P GRH FV   D PD +KIP  D VGVT+VLL   Y+ QEFVR+GY+V+N+Y   EMR+ PP +P+  +L R+I+ S PR+TRF INW Y
Sbjct:    1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPVPEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKPLFEKLTRNILASKPRVTRFKINWDY 155          
BLAST of Histone chaperone ASF1 vs. Ensembl Fly
Match: asf1 (gene:FBgn0029094 transcript:FBtr0074947)

HSP 1 Score: 183.341 bits (464), Expect = 1.868e-57
Identity = 87/155 (56.13%), Postives = 118/155 (76.13%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGY 542
            MAK+ I+NV VL+NP+ F + F+F++TFEC+E L++DLEWK+IYV SA + + DQVLD++ VGP+P GRH FV   D PD +KIP  D VGVT+VLL   Y+ QEFVR+GY+V+N+Y   EMR+ PP +P+  +L R+I+ S PR+TRF INW Y
Sbjct:    1 MAKVHITNVVVLDNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPVPEGRHIFVFQADPPDVSKIPEPDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPTKPLFEKLTRNILASKPRVTRFKINWDY 155          
BLAST of Histone chaperone ASF1 vs. Ensembl Zebrafish
Match: asf1bb (anti-silencing function 1Bb histone chaperone [Source:NCBI gene;Acc:792029])

HSP 1 Score: 182.57 bits (462), Expect = 2.430e-57
Identity = 86/153 (56.21%), Postives = 117/153 (76.47%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ + NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+   IP  D VGVTVVL+   Y+ QEF+RIGY+V+NEY   E+R+ PP +P  ++L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVLNVAVLDNPSPFGNPFQFEITFECMEDLPEDLEWKIIYVGSAESEEYDQILDSVLVGPVPAGRHMFVFQADAPNTGLIPESDAVGVTVVLITCTYRGQEFIRIGYYVNNEYTDPELRENPPVKPDYTQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Zebrafish
Match: asf1ba (anti-silencing function 1Ba histone chaperone [Source:NCBI gene;Acc:386897])

HSP 1 Score: 181.415 bits (459), Expect = 7.516e-57
Identity = 86/153 (56.21%), Postives = 116/153 (75.82%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ + NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQ LDSVLVGP+P GRH FV   DAP+ + IP  D VGVTVVL+   Y+ QEF+RIGY+V+NEY   E+R+ PP +P   +L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVLNVAVLDNPSPFGNPFQFEITFECMEDLPEDLEWKIIYVGSAESEEYDQTLDSVLVGPVPAGRHMFVFQADAPNCSLIPETDAVGVTVVLITCTYRGQEFIRIGYYVNNEYTDTELRENPPLKPNYGQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Xenopus
Match: asf1b (anti-silencing function 1B histone chaperone [Source:NCBI gene;Acc:448404])

HSP 1 Score: 183.726 bits (465), Expect = 1.447e-57
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGYEGEIVTE 563
            MAK+ I N+ VL+NP  F + F+F++TFEC+E L DDLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+ + IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY   E+R+ PP +P   +L+R+I+ S+PR+TRF INW    E   E
Sbjct:    1 MAKVQILNMVVLDNPCPFHNPFQFEITFECIEDLPDDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNSSLIPESDAVGVTVVLITCTYRGQEFIRVGYYVNNEYSDPELRENPPLKPHFGQLQRNILASNPRVTRFHINWECASEAKME 162          
BLAST of Histone chaperone ASF1 vs. Ensembl Xenopus
Match: pten (phosphatase and tensin homolog [Source:Xenbase;Acc:XB-GENE-491433])

HSP 1 Score: 90.8929 bits (224), Expect = 4.305e-23
Identity = 45/74 (60.81%), Postives = 60/74 (81.08%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVL 299
            MAK+ ++NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV 
Sbjct:    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVF 74          
BLAST of Histone chaperone ASF1 vs. Ensembl Mouse
Match: Asf1b (anti-silencing function 1B histone chaperone [Source:MGI Symbol;Acc:MGI:1914179])

HSP 1 Score: 188.734 bits (478), Expect = 1.069e-59
Identity = 90/153 (58.82%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPPKPDFSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Mouse
Match: Asf1a (anti-silencing function 1A histone chaperone [Source:MGI Symbol;Acc:MGI:1913653])

HSP 1 Score: 185.267 bits (469), Expect = 2.993e-58
Identity = 87/153 (56.86%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ ++NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+   IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNAGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Mouse
Match: Asf1a (anti-silencing function 1A histone chaperone [Source:MGI Symbol;Acc:MGI:1913653])

HSP 1 Score: 123.635 bits (309), Expect = 2.204e-35
Identity = 59/109 (54.13%), Postives = 76/109 (69.72%), Query Frame = 3
Query:  189 LEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELK-RHIIESDPR 512
            LEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+   IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S++  R      PR
Sbjct:    2 LEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNAGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKMHYRQRQRDGPR 110          
BLAST of Histone chaperone ASF1 vs. Ensembl Mouse
Match: Asf1a (anti-silencing function 1A histone chaperone [Source:MGI Symbol;Acc:MGI:1913653])

HSP 1 Score: 103.99 bits (258), Expect = 1.718e-27
Identity = 44/82 (53.66%), Postives = 61/82 (74.39%), Query Frame = 3
Query:  291 FVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            FV   DAP+   IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    2 FVFQADAPNAGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW 83          
BLAST of Histone chaperone ASF1 vs. Ensembl Mouse
Match: Asf1a (anti-silencing function 1A histone chaperone [Source:MGI Symbol;Acc:MGI:1913653])

HSP 1 Score: 103.99 bits (258), Expect = 1.718e-27
Identity = 44/82 (53.66%), Postives = 61/82 (74.39%), Query Frame = 3
Query:  291 FVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            FV   DAP+   IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    2 FVFQADAPNAGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW 83          
BLAST of Histone chaperone ASF1 vs. UniProt/SwissProt
Match: sp|Q9NVP2|ASF1B_HUMAN (Histone chaperone ASF1B OS=Homo sapiens OX=9606 GN=ASF1B PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 7.239e-59
Identity = 90/153 (58.82%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. UniProt/SwissProt
Match: sp|Q9DAP7|ASF1B_MOUSE (Histone chaperone ASF1B OS=Mus musculus OX=10090 GN=Asf1b PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 7.479e-59
Identity = 90/153 (58.82%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPPKPDFSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. UniProt/SwissProt
Match: sp|Q17QJ0|ASF1B_BOVIN (Histone chaperone ASF1B OS=Bos taurus OX=9913 GN=ASF1B PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.435e-58
Identity = 90/153 (58.82%), Postives = 119/153 (77.78%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+S+ NV VLENP+ F S F+F+++FEC E+L DDLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+P+ IP  D VGVTVVL+   Y  QEF+R+GY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVSVLNVAVLENPSPFHSPFRFEISFECNEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLSPELRENPPLKPDFSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. UniProt/SwissProt
Match: sp|Q3C1E9|ASF1_CHICK (Histone chaperone ASF1 OS=Gallus gallus OX=9031 GN=ASF1 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.596e-58
Identity = 88/153 (57.52%), Postives = 120/153 (78.43%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ ++NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+P  IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. UniProt/SwissProt
Match: sp|Q9Y294|ASF1A_HUMAN (Histone chaperone ASF1A OS=Homo sapiens OX=9606 GN=ASF1A PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.596e-58
Identity = 88/153 (57.52%), Postives = 120/153 (78.43%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ ++NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+P  IP  D VGVTVVL+   Y+ QEF+R+GY+V+NEY + E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. TrEMBL
Match: A0A4E0R3I4 (Nucleosome assembly factor involved in chromatin assembly and disassembly OS=Fasciola hepatica OX=6192 GN=D915_008031 PE=4 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.317e-72
Identity = 107/154 (69.48%), Postives = 136/154 (88.31%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWG 539
            MAK++I NVEVL+NPA F   FKF++TFEC E LEDDLEWKL+YVSSAYNA LDQ LDS+LVGP+PVGRH+F+ + DAPDP KIP +D+VGVTVVL++A Y+++EF+R+GY+V+NEY+KEE+R EPP+EPI+ EL+RHII SDPR+TRF I+WG
Sbjct:    1 MAKVNICNVEVLDNPASFFDPFKFQITFECHEPLEDDLEWKLVYVSSAYNASLDQTLDSILVGPVPVGRHQFLFEADAPDPKKIPAEDVVGVTVVLIQALYRNKEFIRVGYYVNNEYKKEELRLEPPSEPILEELERHIIASDPRVTRFPIDWG 154          
BLAST of Histone chaperone ASF1 vs. TrEMBL
Match: A0A4S2MDI3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000847 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 8.539e-72
Identity = 106/154 (68.83%), Postives = 134/154 (87.01%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWG 539
            MAK++I NVEVL NP+ F   F+F++TFEC E LEDDLEWKL+YVSSAYNA LDQ LDS+LVGP+PVGRH+F+ + D PDP KIP +DIVGVTVVL++A Y++QEF+R+GY+V+NEY+KEE+R EPP+EPI+ EL+RHII SDPR+TRF I+WG
Sbjct:    1 MAKVNICNVEVLGNPSSFFDPFRFQITFECHEPLEDDLEWKLVYVSSAYNASLDQTLDSILVGPVPVGRHQFLFEADPPDPKKIPTEDIVGVTVVLIQALYRNQEFIRVGYYVNNEYKKEELRLEPPSEPILDELERHIIASDPRVTRFPIDWG 154          
BLAST of Histone chaperone ASF1 vs. TrEMBL
Match: Q5DHP4 (Histone chaperone ASF1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008538 PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.208e-70
Identity = 108/154 (70.13%), Postives = 132/154 (85.71%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWG 539
            MAK++I NVEVL NPA F   FKF++TFEC E L+DDLEWKL+YVSSAYN  LDQ LDSVLVGPIPVGRH+F  + +APDP  IP +DIVGVTVVL++A Y+D+EF+R+GY+V+NEY+KEE+R EPPAEPI+ EL+RHII SDPR+TRF I+WG
Sbjct:    1 MAKVNICNVEVLNNPASFFDPFKFRITFECHEPLDDDLEWKLVYVSSAYNPSLDQTLDSVLVGPIPVGRHQFFFEANAPDPKIIPNEDIVGVTVVLIQALYRDKEFIRVGYYVNNEYKKEELRLEPPAEPILDELERHIIASDPRVTRFPIDWG 154          
BLAST of Histone chaperone ASF1 vs. TrEMBL
Match: G4VR92 (Putative anti-silencing protein OS=Schistosoma mansoni OX=6183 GN=Smp_033020 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 3.705e-69
Identity = 105/154 (68.18%), Postives = 133/154 (86.36%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWG 539
            MAK++I NVEVL+NPA F   FKF++TFEC E L+DDLEWKL+YVSSAYN  LDQ LDS+LVGPIPVGRH+F  + +APDP  IP +DIVGVTVVL++A Y+D+EF+R+GY+V+NEY+ EE+R EPPAEP+++EL+RHII SDPR+TRF I+WG
Sbjct:    1 MAKVNICNVEVLDNPASFFDPFKFRITFECHEPLDDDLEWKLVYVSSAYNPSLDQTLDSILVGPIPVGRHQFSFEANAPDPKIIPNEDIVGVTVVLIQALYRDKEFIRVGYYVNNEYKTEELRLEPPAEPLLNELERHIIASDPRVTRFPIDWG 154          
BLAST of Histone chaperone ASF1 vs. TrEMBL
Match: A0A094ZWI3 (Histone chaperone ASF1 OS=Schistosoma haematobium OX=6185 GN=MS3_05872 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 5.080e-69
Identity = 105/154 (68.18%), Postives = 133/154 (86.36%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWG 539
            MAK++I NVEVL+NPA F   FKF++TFEC E L+DDLEWKL+YVSSAYN  LDQ LDS+LVGPIPVGRH+F  + +APDP  IP +DIVGVTVVL++A Y+D+EF+R+GY+V+NEY+ EE+R EPPAEP+++EL+RHII SDPR+TRF I+WG
Sbjct:    1 MAKVNICNVEVLDNPASFFDPFKFRITFECHEPLDDDLEWKLVYVSSAYNPALDQTLDSILVGPIPVGRHQFSFEANAPDPKIIPNEDIVGVTVVLIQALYRDKEFIRVGYYVNNEYKTEELRLEPPAEPLLNELERHIIASDPRVTRFPIDWG 154          
BLAST of Histone chaperone ASF1 vs. Ensembl Cavefish
Match: asf1ba (histone chaperone asf1b-A [Source:NCBI gene;Acc:103026007])

HSP 1 Score: 181.03 bits (458), Expect = 7.023e-57
Identity = 86/153 (56.21%), Postives = 115/153 (75.16%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ + NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQ LDSVLVGP+P GRH FV   DAP+   IP  D VGVTVVL+   Y+ QEF+RIGY+V+NEY   E+R+ PP +P   +L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVLNVAVLDNPSPFGNPFQFEITFECMEDLPEDLEWKIIYVGSAESEEYDQTLDSVLVGPVPAGRHMFVFQADAPNTGLIPESDAVGVTVVLITCTYRGQEFIRIGYYVNNEYTDAELRENPPLKPDYGQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Cavefish
Match: asf1ba (histone chaperone asf1b-A [Source:NCBI gene;Acc:103026007])

HSP 1 Score: 88.9669 bits (219), Expect = 8.085e-22
Identity = 44/74 (59.46%), Postives = 58/74 (78.38%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVL 299
            MAK+ + NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQ LDSVLVGP+P GRH FV 
Sbjct:    1 MAKVQVLNVAVLDNPSPFGNPFQFEITFECMEDLPEDLEWKIIYVGSAESEEYDQTLDSVLVGPVPAGRHMFVF 74          
BLAST of Histone chaperone ASF1 vs. Ensembl Sea Lamprey
Match: asf1ba (anti-silencing function 1Ba histone chaperone [Source:NCBI gene;Acc:386897])

HSP 1 Score: 171.4 bits (433), Expect = 1.926e-53
Identity = 83/153 (54.25%), Postives = 115/153 (75.16%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ ++NV VL+NP+ F + F+F++TFEC E L +DLEWK+IYV SA + + DQ LDSVLVGP+P G H FV    A +P  IP  D VGVTVVL+   Y++QEF+RIGY+V+NEY   E+++ PPA+P  S+L+R+++ + PR+TRF INW
Sbjct:    1 MAKVQVNNVVVLDNPSPFFNPFQFEITFECTEDLLEDLEWKIIYVGSAESEEYDQTLDSVLVGPVPAGCHMFVFQAMAANPELIPDTDAVGVTVVLITCTYRNQEFIRIGYYVNNEYIDPELKENPPAKPDYSKLQRNVLGTSPRVTRFQINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Yeast
Match: ASF1 (Nucleosome assembly factor; involved in chromatin assembly, disassembly; required for recovery after DSB repair; role in H3K56 acetylation required for expression homeostasis, buffering mRNA synthesis rate against gene dosage changes in S phase; anti-silencing protein, derepresses silent loci when overexpressed; role in regulating Ty1 transposition; relocalizes to cytosol under hypoxia; growth defect of asf1 null is functionally complemented by either human ASF1A or ASF1B [Source:SGD;Acc:S000003651])

HSP 1 Score: 160.614 bits (405), Expect = 8.979e-49
Identity = 80/158 (50.63%), Postives = 114/158 (72.15%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGYEGE 551
            M+ +S+  ++VL NPAKF+  ++F++TFECLESL+ DLEWKL YV S+ + D DQ LDS+LVGP+PVG ++FV   D P    IP  ++V VTV+LL   Y  +EFVR+GY+V+NEY++EE+R+ PPA+  +  + R+I+   PR+TRF I W  E E
Sbjct:    1 MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENE 158          
BLAST of Histone chaperone ASF1 vs. Ensembl Nematostella
Match: EDO48172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ7])

HSP 1 Score: 185.267 bits (469), Expect = 1.525e-59
Identity = 87/153 (56.86%), Postives = 120/153 (78.43%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+++ +V V ENP  F +  +F+VTFEC E + DDL+WK+IYV SA  +D DQVLDSVLVGP+P+GRH FV + + PDP KI   DI+GVTV+LL   Y+++EFVR+GY+V+NEY  EEM++ PP++P+I  L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVNLISVNVHENPTSFLAPLRFEVTFECTEEITDDLDWKIIYVGSAECSDYDQVLDSVLVGPVPIGRHMFVFEANPPDPKKILDQDILGVTVLLLTCSYREREFVRVGYYVNNEYNNEEMKENPPSKPVIEMLQRNILLSEPRVTRFNINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Medaka
Match: ASF1B (histone chaperone asf1b-B-like [Source:NCBI gene;Acc:101161221])

HSP 1 Score: 184.496 bits (467), Expect = 4.320e-58
Identity = 88/153 (57.52%), Postives = 118/153 (77.12%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ + NV VL+NP++F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV   DAP+   IP  D VGVTVVL+   Y+ QEF+RIGY+V+NEY   E+R+ PP +P  S+L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVLNVAVLDNPSQFGNPFQFEITFECMEDLAEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNTTLIPESDAVGVTVVLITCTYRGQEFIRIGYYVNNEYTDPELRESPPLKPNYSQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Medaka
Match: ENSORLT00000008848.2 (histone chaperone asf1b-B [Source:NCBI gene;Acc:101163979])

HSP 1 Score: 183.341 bits (464), Expect = 9.163e-58
Identity = 87/153 (56.86%), Postives = 118/153 (77.12%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINW 536
            MAK+ + NV VL+NP+ F + F+F++TFEC+E L +DLEWK+IYV SA + + DQ+LDSVLVGP+P GRH FV   DAP+ A IP  D VGVTVVL+   Y+ QEF+RIGY+V+NEY   E+R+ PP +P  ++L+R+I+ S+PR+TRF INW
Sbjct:    1 MAKVQVLNVAVLDNPSPFGNPFQFEITFECMEDLPEDLEWKIIYVGSAESEEYDQILDSVLVGPVPAGRHMFVFQADAPNTALIPESDAVGVTVVLITCTYRGQEFIRIGYYVNNEYTGPELRENPPIKPDYAQLQRNILASNPRVTRFHINW 153          
BLAST of Histone chaperone ASF1 vs. Ensembl Medaka
Match: ASF1B (histone chaperone asf1b-B-like [Source:NCBI gene;Acc:101161221])

HSP 1 Score: 90.5077 bits (223), Expect = 1.780e-22
Identity = 45/74 (60.81%), Postives = 60/74 (81.08%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVL 299
            MAK+ + NV VL+NP++F + F+F++TFEC+E L +DLEWK+IYV SA + + DQVLDSVLVGP+P GRH FV 
Sbjct:    1 MAKVQVLNVAVLDNPSQFGNPFQFEITFECMEDLAEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVF 74          
BLAST of Histone chaperone ASF1 vs. Planmine SMEST
Match: SMESG000057853.1 (SMESG000057853.1)

HSP 1 Score: 342.813 bits (878), Expect = 1.590e-120
Identity = 204/204 (100.00%), Postives = 204/204 (100.00%), Query Frame = 3
Query:   78 MAKISISNVEVLENPAXXXXXXXXXVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGYEGEIVTEVSAXXXXXXXXXXXXXXXXXXXXVIVQKTEDKMEEVKDDKSS 689
            MAKISISNVEVLENPAKFSSKFKFKVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGYEGEIVTEVSAEGDEDETENKENEQETSTENVIVQKTEDKMEEVKDDKSS
Sbjct:    1 MAKISISNVEVLENPAKFSSKFKFKVTFECLESLEDDLEWKLIYVSSAYNADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAFYKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFAINWGYEGEIVTEVSAEGDEDETENKENEQETSTENVIVQKTEDKMEEVKDDKSS 204          
The following BLAST results are available for this feature:
BLAST of Histone chaperone ASF1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASF1B1.507e-5958.82anti-silencing function 1B histone chaperone [Sour... [more]
ASF1B1.507e-5958.82anti-silencing function 1B histone chaperone [Sour... [more]
ASF1A3.323e-5957.52anti-silencing function 1A histone chaperone [Sour... [more]
ASF1B1.160e-4857.78anti-silencing function 1B histone chaperone [Sour... [more]
ASF1B1.160e-4857.78anti-silencing function 1B histone chaperone [Sour... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
unc-856.238e-5354.84Probable histone chaperone asf-1 [Source:UniProtK... [more]
asfl-14.891e-5254.61Probable histone chaperone asf-1-like protein [So... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asf11.868e-5756.13gene:FBgn0029094 transcript:FBtr0302381[more]
asf11.868e-5756.13gene:FBgn0029094 transcript:FBtr0074947[more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asf1bb2.430e-5756.21anti-silencing function 1Bb histone chaperone [Sou... [more]
asf1ba7.516e-5756.21anti-silencing function 1Ba histone chaperone [Sou... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asf1b1.447e-5754.94anti-silencing function 1B histone chaperone [Sour... [more]
pten4.305e-2360.81phosphatase and tensin homolog [Source:Xenbase;Acc... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asf1b1.069e-5958.82anti-silencing function 1B histone chaperone [Sour... [more]
Asf1a2.993e-5856.86anti-silencing function 1A histone chaperone [Sour... [more]
Asf1a2.204e-3554.13anti-silencing function 1A histone chaperone [Sour... [more]
Asf1a1.718e-2753.66anti-silencing function 1A histone chaperone [Sour... [more]
Asf1a1.718e-2753.66anti-silencing function 1A histone chaperone [Sour... [more]
back to top
BLAST of Histone chaperone ASF1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NVP2|ASF1B_HUMAN7.239e-5958.82Histone chaperone ASF1B OS=Homo sapiens OX=9606 GN... [more]
sp|Q9DAP7|ASF1B_MOUSE7.479e-5958.82Histone chaperone ASF1B OS=Mus musculus OX=10090 G... [more]
sp|Q17QJ0|ASF1B_BOVIN1.435e-5858.82Histone chaperone ASF1B OS=Bos taurus OX=9913 GN=A... [more]
sp|Q3C1E9|ASF1_CHICK1.596e-5857.52Histone chaperone ASF1 OS=Gallus gallus OX=9031 GN... [more]
sp|Q9Y294|ASF1A_HUMAN1.596e-5857.52Histone chaperone ASF1A OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Histone chaperone ASF1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R3I41.317e-7269.48Nucleosome assembly factor involved in chromatin a... [more]
A0A4S2MDI38.539e-7268.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
Q5DHP42.208e-7070.13Histone chaperone ASF1 OS=Schistosoma japonicum OX... [more]
G4VR923.705e-6968.18Putative anti-silencing protein OS=Schistosoma man... [more]
A0A094ZWI35.080e-6968.18Histone chaperone ASF1 OS=Schistosoma haematobium ... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asf1ba7.023e-5756.21histone chaperone asf1b-A [Source:NCBI gene;Acc:10... [more]
asf1ba8.085e-2259.46histone chaperone asf1b-A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asf1ba1.926e-5354.25anti-silencing function 1Ba histone chaperone [Sou... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ASF18.979e-4950.63Nucleosome assembly factor; involved in chromatin ... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481721.525e-5956.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ASF1B4.320e-5857.52histone chaperone asf1b-B-like [Source:NCBI gene;A... [more]
ENSORLT00000008848.29.163e-5856.86histone chaperone asf1b-B [Source:NCBI gene;Acc:10... [more]
ASF1B1.780e-2260.81histone chaperone asf1b-B-like [Source:NCBI gene;A... [more]
back to top
BLAST of Histone chaperone ASF1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000057853.11.590e-120100.00SMESG000057853.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001127 ID=SMED30001127|Name=Histone chaperone ASF1|organism=Schmidtea mediterranea sexual|type=transcript|length=779bp
TTTGAATTGTCTTAATTAATTTCATTCTTAAATATTTGAATTTACTATAT
TTTGATTATTTTTGAATATCTTTAACAATGGCTAAAATTAGTATAAGCAA
TGTTGAAGTTCTAGAAAATCCAGCCAAATTTTCTTCTAAGTTTAAATTTA
AAGTTACATTCGAGTGTCTTGAAAGCTTAGAAGATGATTTGGAATGGAAG
TTAATTTATGTCAGCAGTGCCTACAATGCAGATTTAGATCAAGTCCTTGA
CTCAGTATTAGTTGGACCAATTCCTGTTGGTCGTCATGAATTTGTTCTTG
ATACTGATGCTCCAGATCCAGCAAAAATCCCGGTTGACGATATTGTCGGT
GTTACGGTTGTTTTACTTGAAGCATTTTATAAAGACCAGGAATTTGTTCG
AATTGGTTATTTTGTTAGCAATGAGTATGAAAAAGAAGAAATGAGAGATG
AACCACCAGCCGAACCGATAATCAGTGAACTGAAACGGCACATAATCGAA
TCTGATCCGAGAATCACGAGATTTGCTATAAATTGGGGTTACGAGGGCGA
GATTGTTACGGAGGTGAGTGCTGAAGGCGATGAGGATGAGACCGAGAATA
AAGAGAATGAGCAAGAAACATCGACAGAAAATGTGATTGTCCAGAAGACA
GAGGATAAAATGGAAGAAGTGAAGGACGATAAAAGCTCCTAGTAAGGAGA
TCTGTTTTCATTCGATGTGCATTTAATGATTTGGCTTCCTGCCGATCTGT
AATATAAAAAATAGATTTTCTACTGTTGC
back to top

protein sequence of SMED30001127-orf-1

>SMED30001127-orf-1 ID=SMED30001127-orf-1|Name=SMED30001127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=205bp
MAKISISNVEVLENPAKFSSKFKFKVTFECLESLEDDLEWKLIYVSSAYN
ADLDQVLDSVLVGPIPVGRHEFVLDTDAPDPAKIPVDDIVGVTVVLLEAF
YKDQEFVRIGYFVSNEYEKEEMRDEPPAEPIISELKRHIIESDPRITRFA
INWGYEGEIVTEVSAEGDEDETENKENEQETSTENVIVQKTEDKMEEVKD
DKSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036747ASF1-like_sf
IPR006818ASF1-like
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006333chromatin assembly or disassembly
GO:0006334nucleosome assembly
GO:0006337nucleosome disassembly
GO:0016573histone acetylation
Vocabulary: molecular function
TermDefinition
GO:0042393histone binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036747Histone chaperone ASF1-like superfamilyGENE3DG3DSA:2.60.40.1490coord: 1..168
e-value: 5.3E-71
score: 239.8
IPR036747Histone chaperone ASF1-like superfamilySUPERFAMILYSSF101546ASF1-likecoord: 1..153
IPR006818Histone chaperone ASF1-likePFAMPF04729ASF1_hist_chapcoord: 1..153
e-value: 5.8E-66
score: 221.2
IPR006818Histone chaperone ASF1-likePANTHERPTHR12040ANTI-SILENCING PROTEIN 1coord: 1..182
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 163..204
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 163..177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 187..204