slc37a-2

Overview
Nameslc37a-2 (AKN21658.1)
Smed IDSMED30001122
Length (bp)1708
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc37a-2 (SMED30001122) t-SNE clustered cells

Violin plots show distribution of expression levels for slc37a-2 (SMED30001122) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc37a-2 (SMED30001122) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc37a-2 (SMED30001122) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001122

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001122SMESG000000703.1 PL08001A1A11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001122SMESG000000703.1 Contig5470GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30001122SMESG000000703.1 dd_Smed_v4_1904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001122SMESG000000703.1 dd_Smed_v4_1904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc37a-2 vs. Ensembl Human
Match: SLC37A3 (solute carrier family 37 member 3 [Source:HGNC Symbol;Acc:HGNC:20651])

HSP 1 Score: 384.8 bits (987), Expect = 1.148e-127
Identity = 234/481 (48.65%), Postives = 319/481 (66.32%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIV-YPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +E+WT +  NT V  P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+ FYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G IV+   L+  PE  G      S I+  +   E+ +  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G ISD +  R+PV  LSL+L + +L+ Y  +P D   N++ +T+TG  IGGP+ +ISSAISADLG + L+  ++ AL+TVTGI+DG+GS+GAA+GQ  V LI+++  W  VF FF++M S TIV I P++V++I   V L R+ +
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIVIFFGLLVSPEEIG-----LSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLLLAVGSLIGYSRSPNDKSINALLMTVTGFFIGGPSNMISSAISADLGRQELIQRSSEALATVTGIVDGSGSIGAAVGQYLVSLIRDKLGWMWVFYFFILMTSCTIVFISPLIVREIFSLV-LRRQAH 490          
BLAST of slc37a-2 vs. Ensembl Human
Match: SLC37A3 (solute carrier family 37 member 3 [Source:HGNC Symbol;Acc:HGNC:20651])

HSP 1 Score: 360.147 bits (923), Expect = 2.380e-118
Identity = 228/481 (47.40%), Postives = 308/481 (64.03%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIV-YPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +E+WT +  NT V  P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+ FYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G IV+   L+  PE  G      S I+  +   E+ +  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G ISD +  R+PV  LSL+L + +L+ Y                    IGGP+ +ISSAISADLG + L+  ++ AL+TVTGI+DG+GS+GAA+GQ  V LI+++  W  VF FF++M S TIV I P++V++I   V L R+ +
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIVIFFGLLVSPEEIG-----LSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLLLAVGSLIGYSR----------------FFIGGPSNMISSAISADLGRQELIQRSSEALATVTGIVDGSGSIGAAVGQYLVSLIRDKLGWMWVFYFFILMTSCTIVFISPLIVREIFSLV-LRRQAH 474          
BLAST of slc37a-2 vs. Ensembl Human
Match: SLC37A3 (solute carrier family 37 member 3 [Source:HGNC Symbol;Acc:HGNC:20651])

HSP 1 Score: 281.952 bits (720), Expect = 1.688e-88
Identity = 157/326 (48.16%), Postives = 208/326 (63.80%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIV-YPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYD 1084
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +E+WT +  NT V  P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+ FYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G IV+   L+  PE  G      S I+  +   E+ +  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYD
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIVIFFGLLVSPEEIG-----LSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYD 336          
BLAST of slc37a-2 vs. Ensembl Human
Match: SLC37A3 (solute carrier family 37 member 3 [Source:HGNC Symbol;Acc:HGNC:20651])

HSP 1 Score: 184.496 bits (467), Expect = 3.649e-54
Identity = 99/191 (51.83%), Postives = 133/191 (69.63%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIV-YPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYE 730
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +E+WT +  NT V  P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+ FYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYE
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYE 206          
BLAST of slc37a-2 vs. Ensembl Human
Match: SLC37A2 (solute carrier family 37 member 2 [Source:HGNC Symbol;Acc:HGNC:20644])

HSP 1 Score: 192.2 bits (487), Expect = 6.823e-54
Identity = 161/491 (32.79%), Postives = 250/491 (50.92%), Query Frame = 2
Query:  155 FRLFH---FYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFL-------GNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRY------SRIQTVDIVSENNSVIVENFEN---------KNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIK-RVNLHR 1540
            FR F    +++ ++ ++TF  Y   H +RK  S VK    +     N +  + P+ +    N  +         D+ +  LG +D  F+  YAIG++ SG  G+R      LSAGM LS +   +FG+   W IH   Y+  +     NGL Q+TGWP+ VT + NWFG   RGF +G+W+    VGNI+G L+    ++  +   F+VP        ++    LI  PE+      ++      ++    D  +   S+     E          +    ISF+  + IPGV+ +SL     KLV+Y F +WL  Y++   +++   A  +S  +DVGGIIGGIV G++SD+   R+    + LIL  P + +Y     D + +SI  L I G ++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGS+GAA+G +   LI     W  VF   +    +  + +  ++ K+I+  +V+L R
Sbjct:   12 FRAFSRDSWFRGLILLLTFLIYACYHMSRKPISIVKSRLHQ-----NCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSAGMLLSGLFTSLFGLGYFWNIHELWYFVVIQ--VCNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGIWVNGQWGLSFIVPGIITAVMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNGRATTCCVMLILAAPMMFLYNYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLGTHKSLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPT-GWNNVFYMLISADVLACLLLCRLVYKEILAWKVSLSR 494          
BLAST of slc37a-2 vs. Ensembl Celegans
Match: T11G6.2 (pep chromosome:WBcel235:IV:10855497:10858184:-1 gene:WBGene00011717.1 transcript:T11G6.2b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T11G6.2)

HSP 1 Score: 347.821 bits (891), Expect = 9.782e-114
Identity = 214/463 (46.22%), Postives = 282/463 (60.91%), Query Frame = 2
Query:  185 VFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAENPLS 1567
            +F+ TF +Y +LHA RK+ S VKP+    W  +N +T   P+        F    +A  FLGVLDT F+  YAIGLY  G +GD Y+P  +L+AGM LSSI +F FG LTE  HFY+   Y   + LNG  QS GWP  V+IM NWFGH +RG  +G WS CA VGNIIG L+ +  L  GY+Y FL+ C+ LF  S +V   L + P    S           DI+ E       ++   +    I F K  L+PGVI YSLAYACLKLVNY FFFWL  YL    +W  + AD++S WYDVGGI+  ++ G  SD M SR+PV  + L++   +L +Y ++P     N+  L + G  IGGPA +ISS+I+ADLG    L GNA ALSTVTGIIDGTGS+GAAIGQ  +P +Q+ F W AVF  F++MI  T +C++PVL K+  +R  +HR +  ++ L 
Sbjct:   31 IFVHTFMSYAMLHATRKTLSTVKPSLIHTWI-SNTSTPDGPV--------FPSQQAAAEFLGVLDTGFLVAYAIGLYICGILGDNYNPRRLLTAGMMLSSIIVFCFGYLTETFHFYSPMVYSFLWILNGFIQSVGWPVEVSIMGNWFGHNARGAVMGAWSSCASVGNIIGTLIASYTLFLGYQYSFLIACSLLFIYSFLVFFQLPSAPWEVSS-----------DILPEQMEEEETDDEPTERPPPIGFLKAWLLPGVIAYSLAYACLKLVNYGFFFWLPYYLHAGLHWPESYADSLSTWYDVGGIVAAVLAGAFSDHMRSRTPVVFIMLLMATVSLYIYAHSPESYNWNAFLLLVAGFFIGGPANMISSSITADLGKCDQLRGNAEALSTVTGIIDGTGSIGAAIGQWFIPSVQHWFGWDAVFYGFIVMILCTALCLVPVLWKEHKER-RIHRSEEVDSLLQ 472          
BLAST of slc37a-2 vs. Ensembl Celegans
Match: T11G6.2 (pep chromosome:WBcel235:IV:10855485:10858063:-1 gene:WBGene00011717.1 transcript:T11G6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T11G6.2)

HSP 1 Score: 347.821 bits (891), Expect = 9.782e-114
Identity = 214/463 (46.22%), Postives = 282/463 (60.91%), Query Frame = 2
Query:  185 VFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAENPLS 1567
            +F+ TF +Y +LHA RK+ S VKP+    W  +N +T   P+        F    +A  FLGVLDT F+  YAIGLY  G +GD Y+P  +L+AGM LSSI +F FG LTE  HFY+   Y   + LNG  QS GWP  V+IM NWFGH +RG  +G WS CA VGNIIG L+ +  L  GY+Y FL+ C+ LF  S +V   L + P    S           DI+ E       ++   +    I F K  L+PGVI YSLAYACLKLVNY FFFWL  YL    +W  + AD++S WYDVGGI+  ++ G  SD M SR+PV  + L++   +L +Y ++P     N+  L + G  IGGPA +ISS+I+ADLG    L GNA ALSTVTGIIDGTGS+GAAIGQ  +P +Q+ F W AVF  F++MI  T +C++PVL K+  +R  +HR +  ++ L 
Sbjct:   31 IFVHTFMSYAMLHATRKTLSTVKPSLIHTWI-SNTSTPDGPV--------FPSQQAAAEFLGVLDTGFLVAYAIGLYICGILGDNYNPRRLLTAGMMLSSIIVFCFGYLTETFHFYSPMVYSFLWILNGFIQSVGWPVEVSIMGNWFGHNARGAVMGAWSSCASVGNIIGTLIASYTLFLGYQYSFLIACSLLFIYSFLVFFQLPSAPWEVSS-----------DILPEQMEEEETDDEPTERPPPIGFLKAWLLPGVIAYSLAYACLKLVNYGFFFWLPYYLHAGLHWPESYADSLSTWYDVGGIVAAVLAGAFSDHMRSRTPVVFIMLLMATVSLYIYAHSPESYNWNAFLLLVAGFFIGGPANMISSSITADLGKCDQLRGNAEALSTVTGIIDGTGSIGAAIGQWFIPSVQHWFGWDAVFYGFIVMILCTALCLVPVLWKEHKER-RIHRSEEVDSLLQ 472          
BLAST of slc37a-2 vs. Ensembl Celegans
Match: T11G6.2 (pep chromosome:WBcel235:IV:10855497:10858559:-1 gene:WBGene00011717.1 transcript:T11G6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T11G6.2)

HSP 1 Score: 347.436 bits (890), Expect = 1.617e-113
Identity = 214/463 (46.22%), Postives = 282/463 (60.91%), Query Frame = 2
Query:  185 VFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAENPLS 1567
            +F+ TF +Y +LHA RK+ S VKP+    W  +N +T   P+        F    +A  FLGVLDT F+  YAIGLY  G +GD Y+P  +L+AGM LSSI +F FG LTE  HFY+   Y   + LNG  QS GWP  V+IM NWFGH +RG  +G WS CA VGNIIG L+ +  L  GY+Y FL+ C+ LF  S +V   L + P    S           DI+ E       ++   +    I F K  L+PGVI YSLAYACLKLVNY FFFWL  YL    +W  + AD++S WYDVGGI+  ++ G  SD M SR+PV  + L++   +L +Y ++P     N+  L + G  IGGPA +ISS+I+ADLG    L GNA ALSTVTGIIDGTGS+GAAIGQ  +P +Q+ F W AVF  F++MI  T +C++PVL K+  +R  +HR +  ++ L 
Sbjct:   38 IFVHTFMSYAMLHATRKTLSTVKPSLIHTWI-SNTSTPDGPV--------FPSQQAAAEFLGVLDTGFLVAYAIGLYICGILGDNYNPRRLLTAGMMLSSIIVFCFGYLTETFHFYSPMVYSFLWILNGFIQSVGWPVEVSIMGNWFGHNARGAVMGAWSSCASVGNIIGTLIASYTLFLGYQYSFLIACSLLFIYSFLVFFQLPSAPWEVSS-----------DILPEQMEEEETDDEPTERPPPIGFLKAWLLPGVIAYSLAYACLKLVNYGFFFWLPYYLHAGLHWPESYADSLSTWYDVGGIVAAVLAGAFSDHMRSRTPVVFIMLLMATVSLYIYAHSPESYNWNAFLLLVAGFFIGGPANMISSSITADLGKCDQLRGNAEALSTVTGIIDGTGSIGAAIGQWFIPSVQHWFGWDAVFYGFIVMILCTALCLVPVLWKEHKER-RIHRSEEVDSLLQ 479          
BLAST of slc37a-2 vs. Ensembl Celegans
Match: T11G6.4 (pep chromosome:WBcel235:IV:10849749:10851933:-1 gene:WBGene00011719.1 transcript:T11G6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T11G6.4)

HSP 1 Score: 328.176 bits (840), Expect = 4.969e-106
Identity = 200/457 (43.76%), Postives = 266/457 (58.21%), Query Frame = 2
Query:  182 VVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
            +VFI TFF++ ++HA RK+ + VKP+    WT  +  T   P             + A  FLGVLDT FM  YAIGL+ SG +GD Y+P  +LS GM +S+IS+F FG LTE  HFY+   Y+  +  NG  QS GWP  V IM NWFG  +RG  +G+WS C   GNIIG L+ +  L  GYEY FL+ C+ L   S++V   L + P +        S           N    E   N+    + F+K  LIPGVI +SLA+ACLK VN  FFFWL  YL    NW    AD +S WYDVGGI+  +V G  SD M SR+ +    LI +  +L +Y  +P     N+  L +TG  +GGP  +ISS++ ADLG    L GNA AL+TVTGIIDGTGS G+AIGQ  +P +Q+ + W +VF  FM M++ T +CI PVL+K+  KR  L  +++
Sbjct:   28 IVFIHTFFSFAMIHATRKTLATVKPSIIHTWTSNSTGT---PFME--------SEEHATRFLGVLDTSFMITYAIGLFVSGTLGDHYNPRKMLSFGMAMSAISVFCFGFLTEKYHFYSAPLYIFLWICNGFSQSVGWPIEVAIMGNWFGKDARGTVMGIWSACGSTGNIIGTLIASHALSLGYEYPFLIICSLLLGYSMIVYWQLPSAPWDIDHSFPHDSE----------NKEKQELLPNRPPA-LGFFKTWLIPGVISFSLAFACLKFVNDGFFFWLPYYLHDGLNWPETFADALSTWYDVGGILASVVAGAASDRMKSRTSLIFYMLIASFVSLYIYSQSPASYSWNAFLLLVTGFCVGGPLNMISSSVVADLGKSDKLKGNAEALATVTGIIDGTGSCGSAIGQFMIPNLQHWYGWNSVFYGFMAMMACTTICITPVLIKEKRKRHKLKARED 462          
BLAST of slc37a-2 vs. Ensembl Celegans
Match: T11G6.3 (pep chromosome:WBcel235:IV:10852669:10855366:-1 gene:WBGene00011718.1 transcript:T11G6.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T11G6.3)

HSP 1 Score: 301.597 bits (771), Expect = 4.142e-96
Identity = 196/458 (42.79%), Postives = 269/458 (58.73%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRK 1543
            Y   VFI TF  Y L+HA RK+ S VKP+    WT  +++             LF    SA  FLG LDT FM  Y+IGLY  G +GD Y+P  +L+ GM LS+IS+F FG +TE  HFY+   Y V +  NG FQS GWP  V IM NWFG + RG  +G WS  A VGNI+  L+ +  ++ GY+Y FL+   ALFT SI++  +L + P     +      I+  DI        + + +N+    + F++  L+PGV+ ++++Y CLKLVN  FFFWL  YL    NW  + AD ++ WYDVGGII  I+ G +SD M SR+ +    L+ +   L  Y ++P     N+  L I G  IGGP  +I+  I++DLG   +L GNA ALSTVTGIIDGTGSVG+AIGQ  +PL++N   W A+F  FMIM+  + +CI PV+ ++   + N H K
Sbjct:   23 YHVRVFIHTFIIYVLIHAARKTLSTVKPSLINVWTDNSSS---------PDGPLFDSEQSATEFLGALDTGFMITYSIGLYICGTLGDHYNPRRILALGMALSAISVFTFGFVTEVSHFYSAPLYAVLWISNGFFQSVGWPLEVCIMGNWFGKTARGAVIGAWSTNASVGNILATLIASWTVNIGYQYPFLIISTALFTYSIIIFFNLPSAPWEVKQQ------IEGSDIKE------IPSDDNERPPPLGFFRAWLLPGVLAFAISYLCLKLVNDGFFFWLPFYLHNGLNWKESTADGLAAWYDVGGIISSIIAGALSDRMKSRTILVFTMLLFSTVTLFAYAHSPISYYWNAFILLIVGFFIGGPLNMIAGCITSDLGRSEMLRGNAEALSTVTGIIDGTGSVGSAIGQWLIPLVRNWLGWDAIFYGFMIMVVCSALCISPVIWRE--WKENKHEK 457          
BLAST of slc37a-2 vs. Ensembl Fly
Match: MFS16 (gene:FBgn0034611 transcript:FBtr0071589)

HSP 1 Score: 182.185 bits (461), Expect = 2.957e-50
Identity = 157/506 (31.03%), Postives = 241/506 (47.63%), Query Frame = 2
Query:  140 CQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTF----TEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGV-LTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG---------SKLYRYSRIQTVD--IVSENNSVI-----------------VENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTI-TGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI--IKRVNLHRKK 1546
            C +   R    YK  VF++TF AY   H  RK  S VK       +     +  +    P        LF          G+LD+ F+  YAI ++ASG++ +R      LS GM L+ +  ++FG+  T  IH   Y+  V  +A  G+FQ+TGWP  V ++  WFG S RG   G+W+    +GNI+G L+ A  ++  +   F+VP   +     ++   L+ +PE  G          ++   S ++  D   V  N++ I                  E       + IS    + IPGV+ +SL     KLV+Y F +WL  Y+  +       +  +S  +DVGGI+G I  G +SD     + V    L +  P L++Y+      +T SI L I  GI + GP  LI++++SA+LG    L GNA AL+TVT IIDGTGS+GAA+G +   LI     WQ VF   +    I +V +  ++ K+   ++R + HR +
Sbjct:   35 CTRFHARRDLLYKMSVFVLTFLAYACYHMCRKPISVVKSVLQGNCSTALAASGQDCGYAPFDVPDATTLF----------GMLDSAFLFSYAIAMFASGFVAERVSLRYFLSMGMILTGVFTYMFGIARTSNIHSLWYFIIVQIFA--GIFQTTGWPGVVALVGRWFGKSKRGLIFGIWNSHTSIGNILGTLIAAHYVESDWALSFVVPGIIIAAVGFLLFLFLVDQPEIVGCYPQAGQHERRVANESDVEQDDEEQVRHNDAEINYRSAPTERTPILPRSQPEAVPRGRGRPISLIDALFIPGVVEFSLCLFFTKLVSYTFMYWLPLYIQKSSTLGPELSADLSTLFDVGGILGAIAAGYLSDVSGMSATVCTGMLFVASPILLMYQQYGALSMTISIVLLIVVGIFVNGPYALITTSVSAELGQHSSLEGNANALATVTAIIDGTGSIGAAVGPLLAGLISTA-GWQYVFHMLIAADIIAMVLLGRLVFKEFAALRRAS-HRIR 526          
BLAST of slc37a-2 vs. Ensembl Fly
Match: MFS16 (gene:FBgn0034611 transcript:FBtr0342884)

HSP 1 Score: 182.185 bits (461), Expect = 2.957e-50
Identity = 157/506 (31.03%), Postives = 241/506 (47.63%), Query Frame = 2
Query:  140 CQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTF----TEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGV-LTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG---------SKLYRYSRIQTVD--IVSENNSVI-----------------VENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTI-TGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI--IKRVNLHRKK 1546
            C +   R    YK  VF++TF AY   H  RK  S VK       +     +  +    P        LF          G+LD+ F+  YAI ++ASG++ +R      LS GM L+ +  ++FG+  T  IH   Y+  V  +A  G+FQ+TGWP  V ++  WFG S RG   G+W+    +GNI+G L+ A  ++  +   F+VP   +     ++   L+ +PE  G          ++   S ++  D   V  N++ I                  E       + IS    + IPGV+ +SL     KLV+Y F +WL  Y+  +       +  +S  +DVGGI+G I  G +SD     + V    L +  P L++Y+      +T SI L I  GI + GP  LI++++SA+LG    L GNA AL+TVT IIDGTGS+GAA+G +   LI     WQ VF   +    I +V +  ++ K+   ++R + HR +
Sbjct:   35 CTRFHARRDLLYKMSVFVLTFLAYACYHMCRKPISVVKSVLQGNCSTALAASGQDCGYAPFDVPDATTLF----------GMLDSAFLFSYAIAMFASGFVAERVSLRYFLSMGMILTGVFTYMFGIARTSNIHSLWYFIIVQIFA--GIFQTTGWPGVVALVGRWFGKSKRGLIFGIWNSHTSIGNILGTLIAAHYVESDWALSFVVPGIIIAAVGFLLFLFLVDQPEIVGCYPQAGQHERRVANESDVEQDDEEQVRHNDAEINYRSAPTERTPILPRSQPEAVPRGRGRPISLIDALFIPGVVEFSLCLFFTKLVSYTFMYWLPLYIQKSSTLGPELSADLSTLFDVGGILGAIAAGYLSDVSGMSATVCTGMLFVASPILLMYQQYGALSMTISIVLLIVVGIFVNGPYALITTSVSAELGQHSSLEGNANALATVTAIIDGTGSIGAAVGPLLAGLISTA-GWQYVFHMLIAADIIAMVLLGRLVFKEFAALRRAS-HRIR 526          
BLAST of slc37a-2 vs. Ensembl Fly
Match: MFS16 (gene:FBgn0034611 transcript:FBtr0071591)

HSP 1 Score: 182.185 bits (461), Expect = 2.957e-50
Identity = 157/506 (31.03%), Postives = 241/506 (47.63%), Query Frame = 2
Query:  140 CQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTF----TEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGV-LTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG---------SKLYRYSRIQTVD--IVSENNSVI-----------------VENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTI-TGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI--IKRVNLHRKK 1546
            C +   R    YK  VF++TF AY   H  RK  S VK       +     +  +    P        LF          G+LD+ F+  YAI ++ASG++ +R      LS GM L+ +  ++FG+  T  IH   Y+  V  +A  G+FQ+TGWP  V ++  WFG S RG   G+W+    +GNI+G L+ A  ++  +   F+VP   +     ++   L+ +PE  G          ++   S ++  D   V  N++ I                  E       + IS    + IPGV+ +SL     KLV+Y F +WL  Y+  +       +  +S  +DVGGI+G I  G +SD     + V    L +  P L++Y+      +T SI L I  GI + GP  LI++++SA+LG    L GNA AL+TVT IIDGTGS+GAA+G +   LI     WQ VF   +    I +V +  ++ K+   ++R + HR +
Sbjct:   35 CTRFHARRDLLYKMSVFVLTFLAYACYHMCRKPISVVKSVLQGNCSTALAASGQDCGYAPFDVPDATTLF----------GMLDSAFLFSYAIAMFASGFVAERVSLRYFLSMGMILTGVFTYMFGIARTSNIHSLWYFIIVQIFA--GIFQTTGWPGVVALVGRWFGKSKRGLIFGIWNSHTSIGNILGTLIAAHYVESDWALSFVVPGIIIAAVGFLLFLFLVDQPEIVGCYPQAGQHERRVANESDVEQDDEEQVRHNDAEINYRSAPTERTPILPRSQPEAVPRGRGRPISLIDALFIPGVVEFSLCLFFTKLVSYTFMYWLPLYIQKSSTLGPELSADLSTLFDVGGILGAIAAGYLSDVSGMSATVCTGMLFVASPILLMYQQYGALSMTISIVLLIVVGIFVNGPYALITTSVSAELGQHSSLEGNANALATVTAIIDGTGSIGAAVGPLLAGLISTA-GWQYVFHMLIAADIIAMVLLGRLVFKEFAALRRAS-HRIR 526          
BLAST of slc37a-2 vs. Ensembl Fly
Match: MFS16 (gene:FBgn0034611 transcript:FBtr0071590)

HSP 1 Score: 180.644 bits (457), Expect = 1.795e-49
Identity = 157/506 (31.03%), Postives = 241/506 (47.63%), Query Frame = 2
Query:  140 CQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTF----TEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGV-LTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG---------SKLYRYSRIQTVD--IVSENNSVI-----------------VENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTI-TGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI--IKRVNLHRKK 1546
            C +   R    YK  VF++TF AY   H  RK  S VK       +     +  +    P        LF          G+LD+ F+  YAI ++ASG++ +R      LS GM L+ +  ++FG+  T  IH   Y+  V  +A  G+FQ+TGWP  V ++  WFG S RG   G+W+    +GNI+G L+ A  ++  +   F+VP   +     ++   L+ +PE  G          ++   S ++  D   V  N++ I                  E       + IS    + IPGV+ +SL     KLV+Y F +WL  Y+  +       +  +S  +DVGGI+G I  G +SD     + V    L +  P L++Y+      +T SI L I  GI + GP  LI++++SA+LG    L GNA AL+TVT IIDGTGS+GAA+G +   LI     WQ VF   +    I +V +  ++ K+   ++R + HR +
Sbjct:   73 CTRFHARRDLLYKMSVFVLTFLAYACYHMCRKPISVVKSVLQGNCSTALAASGQDCGYAPFDVPDATTLF----------GMLDSAFLFSYAIAMFASGFVAERVSLRYFLSMGMILTGVFTYMFGIARTSNIHSLWYFIIVQIFA--GIFQTTGWPGVVALVGRWFGKSKRGLIFGIWNSHTSIGNILGTLIAAHYVESDWALSFVVPGIIIAAVGFLLFLFLVDQPEIVGCYPQAGQHERRVANESDVEQDDEEQVRHNDAEINYRSAPTERTPILPRSQPEAVPRGRGRPISLIDALFIPGVVEFSLCLFFTKLVSYTFMYWLPLYIQKSSTLGPELSADLSTLFDVGGILGAIAAGYLSDVSGMSATVCTGMLFVASPILLMYQQYGALSMTISIVLLIVVGIFVNGPYALITTSVSAELGQHSSLEGNANALATVTAIIDGTGSIGAAVGPLLAGLISTA-GWQYVFHMLIAADIIAMVLLGRLVFKEFAALRRAS-HRIR 564          
BLAST of slc37a-2 vs. Ensembl Zebrafish
Match: CABZ01071848.1 (solute carrier family 37 member 3 [Source:NCBI gene;Acc:100331554])

HSP 1 Score: 379.022 bits (972), Expect = 1.073e-125
Identity = 229/491 (46.64%), Postives = 315/491 (64.15%), Query Frame = 2
Query:  161 LFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGT---NNNT--IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENK-NEQY------------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAEN 1558
            L+ ++  + F++TFF+Y LLHA+RK+FSNVK + + +WT +    N T   + P + W+ N LF     A +FLG LD++F+  YA+GLY SG IGDR++   VLS G+  S+I+ F+FG LTEW+HFYN Y Y V + +NGL QST WP  V IM NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV     F G +VV   L+  P+  G   Y  + ++ V   S++   ++ + E++  ++Y                  I F++   +PGV+PYSLAYACLKLVNY+FFFWL  YLS NF W    AD +S+WYDVGGIIGG V G+ISD +  R+PV  +SL+L + +LV Y ++P + L N   L  TG +IGGP+ +ISSAISADLG +  L  +  AL+TVTGI+DGTGS+GAA GQ  V LI+++  W  VF FF+IM   +++ I+P+L ++I    +L R + A  
Sbjct:    4 LYTYHHLLTFLLTFFSYVLLHASRKTFSNVKVSISAQWTPSALQQNGTAFTLSPTETWEGNALFADMGEATLFLGALDSIFLFSYAVGLYVSGVIGDRFNLRYVLSFGLCGSAITEFVFGTLTEWLHFYNVYLYCVLWVINGLLQSTVWPCVVAIMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKYGYEYAFLVTSVVQFAGGVVVFFGLLTSPKEIGLNDYFETGLRPVTRDSDSQRPLMSDEEDELTDEYSSIQQQDEEPQPQPQPRAIGFFQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSKNFGWKEVEADRLSVWYDVGGIIGGTVQGLISDLLGKRAPVLAISLLLAMGSLVGYSHSPNNQLVNGALLATTGFLIGGPSNMISSAISADLGRQEALHNSQQALATVTGIVDGTGSIGAAGGQYLVSLIESKLGWMCVFYFFIIMTGCSVLFIIPLLFREI---QSLCRDRQART 491          
BLAST of slc37a-2 vs. Ensembl Zebrafish
Match: CABZ01071848.1 (solute carrier family 37 member 3 [Source:NCBI gene;Acc:100331554])

HSP 1 Score: 360.918 bits (925), Expect = 5.650e-119
Identity = 215/456 (47.15%), Postives = 290/456 (63.60%), Query Frame = 2
Query:  161 LFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGT---NNNT--IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENK-NEQY------------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQV------CVPLIQNRFQ 1435
            L+ ++  + F++TFF+Y LLHA+RK+FSNVK + + +WT +    N T   + P + W+ N LF     A +FLG LD++F+  YA+GLY SG IGDR++   VLS G+  S+I+ F+FG LTEW+HFYN Y Y V + +NGL QST WP  V IM NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV     F G +VV   L+  P+  G   Y  + ++ V   S++   ++ + E++  ++Y                  I F++   +PGV+PYSLAYACLKLVNY+FFFWL  YLS NF W    AD +S+WYDVGGIIGG V G+ISD +  R+PV  +SL+L + +LV Y ++P + L N   L  TG +IGGP+ +ISSAISADLG +  L  +  AL+TVTGI+DGTGS+GAA GQ        +PL+    Q
Sbjct:    4 LYTYHHLLTFLLTFFSYVLLHASRKTFSNVKVSISAQWTPSALQQNGTAFTLSPTETWEGNALFADMGEATLFLGALDSIFLFSYAVGLYVSGVIGDRFNLRYVLSFGLCGSAITEFVFGTLTEWLHFYNVYLYCVLWVINGLLQSTVWPCVVAIMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKYGYEYAFLVTSVVQFAGGVVVFFGLLTSPKEIGLNDYFETGLRPVTRDSDSQRPLMSDEEDELTDEYSSIQQQDEEPQPQPQPRAIGFFQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSKNFGWKEVEADRLSVWYDVGGIIGGTVQGLISDLLGKRAPVLAISLLLAMGSLVGYSHSPNNQLVNGALLATTGFLIGGPSNMISSAISADLGRQEALHNSQQALATVTGIVDGTGSIGAAGGQTGCSVLFIIPLLFREIQ 459          
BLAST of slc37a-2 vs. Ensembl Zebrafish
Match: CABZ01071848.1 (solute carrier family 37 member 3 [Source:NCBI gene;Acc:100331554])

HSP 1 Score: 344.354 bits (882), Expect = 1.375e-112
Identity = 213/491 (43.38%), Postives = 292/491 (59.47%), Query Frame = 2
Query:  161 LFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGT---NNNT--IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENK-NEQY------------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAEN 1558
            L+ ++  + F++TFF+Y LLHA+RK+FSNVK + + +WT +    N T   + P + W+ N LF     A +FLG LD++F+  YA+GLY SG IGDR++   VLS G+  S+I+ F+FG LTEW+HFYN Y Y V + +NGL QST WP  V IM NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV     F G +VV   L+  P+  G   Y  + ++ V   S++   ++ + E++  ++Y                  I F++   +PGV+PYSLAYACLKLVNY+FFFWL  YLS NF W    AD +S+WYDVGGII                                  ++P + L N   L  TG +IGGP+ +ISSAISADLG +  L  +  AL+TVTGI+DGTGS+GAA GQ  V LI+++  W  VF FF+IM   +++ I+P+L ++I    +L R + A  
Sbjct:    4 LYTYHHLLTFLLTFFSYVLLHASRKTFSNVKVSISAQWTPSALQQNGTAFTLSPTETWEGNALFADMGEATLFLGALDSIFLFSYAVGLYVSGVIGDRFNLRYVLSFGLCGSAITEFVFGTLTEWLHFYNVYLYCVLWVINGLLQSTVWPCVVAIMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKYGYEYAFLVTSVVQFAGGVVVFFGLLTSPKEIGLNDYFETGLRPVTRDSDSQRPLMSDEEDELTDEYSSIQQQDEEPQPQPQPRAIGFFQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSKNFGWKEVEADRLSVWYDVGGII----------------------------------DSPNNQLVNGALLATTGFLIGGPSNMISSAISADLGRQEALHNSQQALATVTGIVDGTGSIGAAGGQYLVSLIESKLGWMCVFYFFIIMTGCSVLFIIPLLFREI---QSLCRDRQART 457          
BLAST of slc37a-2 vs. Ensembl Zebrafish
Match: CABZ01071848.1 (solute carrier family 37 member 3 [Source:NCBI gene;Acc:100331554])

HSP 1 Score: 333.183 bits (853), Expect = 9.661e-109
Identity = 203/423 (47.99%), Postives = 273/423 (64.54%), Query Frame = 2
Query:  350 SAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENK-NEQY------------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAEN 1558
             A +FLG LD++F+  YA+GLY SG IGDR++   VLS G+  S+I+ F+FG LTEW+HFYN Y Y V + +NGL QST WP  V IM NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV     F G +VV   L+  P+  G   Y  + ++ V   S++   ++ + E++  ++Y                  I F++   +PGV+PYSLAYACLKLVNY+FFFWL  YLS NF W    AD +S+WYDVGGIIGG V G+ISD +  R+PV  +SL+L + +LV Y ++P + L N   L  TG +IGGP+ +ISSAISADLG +  L  +  AL+TVTGI+DGTGS+GAA GQ  V LI+++  W  VF FF+IM   +++ I+P+L ++I    +L R + A  
Sbjct:    3 EATLFLGALDSIFLFSYAVGLYVSGVIGDRFNLRYVLSFGLCGSAITEFVFGTLTEWLHFYNVYLYCVLWVINGLLQSTVWPCVVAIMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKYGYEYAFLVTSVVQFAGGVVVFFGLLTSPKEIGLNDYFETGLRPVTRDSDSQRPLMSDEEDELTDEYSSIQQQDEEPQPQPQPRAIGFFQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSKNFGWKEVEADRLSVWYDVGGIIGGTVQGLISDLLGKRAPVLAISLLLAMGSLVGYSHSPNNQLVNGALLATTGFLIGGPSNMISSAISADLGRQEALHNSQQALATVTGIVDGTGSIGAAGGQYLVSLIESKLGWMCVFYFFIIMTGCSVLFIIPLLFREI---QSLCRDRQART 422          
BLAST of slc37a-2 vs. Ensembl Zebrafish
Match: slc37a2 (solute carrier family 37 member 2 [Source:NCBI gene;Acc:406287])

HSP 1 Score: 198.364 bits (503), Expect = 2.048e-56
Identity = 154/438 (35.16%), Postives = 231/438 (52.74%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLK-NWKRNNL------FLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG-SKLYRYSRIQ----------TVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTI-TGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQ 1423
            Y+  +  +TF  Y   H +RK  S VK          N + +V+P   N   N+       F G +   +F GVLD  F+  YA+G++ SG  G+R      LS GM LS +   +FG+   W IH   YY  V   ALNGL Q+TGWPA V  + NWFG   RGF +G+W+    VGNI+G L+    +   +   F+VP   + +  ++    L+ +PE+   +    + R++            +I + + S  VE  E+ +E  ISF   + IPGV+ +S      KLV+Y F +WL  Y++   ++    A  +S  +DVGGI+GGIV G++SD+   R+      LI+  P L +Y     + L  ++ + +  G ++ GP  LI++A+SADLG+   L GN+ ALSTVT IIDGTGS+GAA+G +   LI 
Sbjct:   20 YRFSILFLTFVFYTSYHLSRKPISIVKSQLHR-----NCSNVVHPANLNITDNDTWCDWVPFDGKNYQNLF-GVLDNCFLVAYAVGMFFSGIFGERLPLRYYLSTGMLLSGLFTALFGLGFYWQIHSLWYYCLVQ--ALNGLVQTTGWPAVVACVGNWFGKGKRGFIMGVWNSHTSVGNILGSLIAGVYVSSAWGLSFIVPGIIIASTGVICFLFLVERPEDVNCTAPQHHERVEEEPLLRNSSTNEEIFNSHTSTAVEPVEDHSEA-ISFCGALRIPGVVEFSFCLLFAKLVSYTFLYWLPLYIANVAHFDPKKAGDLSTLFDVGGILGGIVAGLVSDYTGGRASTCCAMLIIAAPMLFLYNKIGQNGLPTTVGMLLWCGALVNGPYALITTAVSADLGTHESLRGNSRALSTVTAIIDGTGSIGAAVGPLLAGLIS 448          
BLAST of slc37a-2 vs. Ensembl Xenopus
Match: colec12 (collectin subfamily member 12 [Source:Xenbase;Acc:XB-GENE-984626])

HSP 1 Score: 394.045 bits (1011), Expect = 2.960e-131
Identity = 231/493 (46.86%), Postives = 324/493 (65.72%), Query Frame = 2
Query:  125 SKSIICQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWT--GTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG------SKLYRYSRIQTVD--IVSENNSVIVE-NFENKNEQYIS------FWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
            S+ +  ++  F  +  +   VF++TFF+Y LLHA+RK+FSNVK + + +WT  G N+  IV P + W  N LF    +A +FLG+LDT+F+  YA+GL+ SG IGDR +  LVL+ GM  S+I++F+FG LTEW+ FYN  FY + + LNGL QSTGWP  V +M NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G I++   L+  P+  G       +  R +R +  +  ++S N+    E N+  +++  +S      F +   +PGV+ YSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYD+GGIIGG V G+ISD M  RSPV  +SL+  + +L  Y ++P D + N+  +++TG  +GGP+ +ISSAISADLG + ++ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQN   W  VF FF+ MI +T+V ++P++V++    +   R   
Sbjct:    7 SRRLAGRRGCFSQYSHHHVAVFLLTFFSYALLHASRKAFSNVKVSISSQWTPLGLNSTYIVLPNETWNGNTLFPDTKTATIFLGLLDTIFLFAYAVGLFISGIIGDRLNMRLVLTFGMCSSAITMFVFGTLTEWLRFYNKVFYCLVWILNGLLQSTGWPCVVAVMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLQYGYEYAFLVTASVQFAGGIIIFFGLVTSPKELGLPETGEGETDRAAREEGANRPLISGNDDGDDESNYSIQSDDVVSAPKAIGFVQACCLPGVLLYSLAYACLKLVNYSFFFWLPFYLSNNFKWKEAEADQLSIWYDIGGIIGGTVQGLISDLMKMRSPVLTVSLLCAVGSLFGYSHSPNDKVINAFIMSVTGFFVGGPSNMISSAISADLGRQEMVRGSSEALATVTGIVDGTGSIGAALGQTLVSLIQNALSWMWVFYFFIFMICMTVVFMVPLVVRETRDWLRQRRASR 499          
BLAST of slc37a-2 vs. Ensembl Xenopus
Match: colec12 (collectin subfamily member 12 [Source:Xenbase;Acc:XB-GENE-984626])

HSP 1 Score: 390.963 bits (1003), Expect = 3.083e-130
Identity = 229/485 (47.22%), Postives = 319/485 (65.77%), Query Frame = 2
Query:  149 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWT--GTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG------SKLYRYSRIQTVD--IVSENNSVIVE-NFENKNEQYIS------FWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
            +    +  +   VF++TFF+Y LLHA+RK+FSNVK + + +WT  G N+  IV P + W  N LF    +A +FLG+LDT+F+  YA+GL+ SG IGDR +  LVL+ GM  S+I++F+FG LTEW+ FYN  FY + + LNGL QSTGWP  V +M NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G I++   L+  P+  G       +  R +R +  +  ++S N+    E N+  +++  +S      F +   +PGV+ YSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYD+GGIIGG V G+ISD M  RSPV  +SL+  + +L  Y ++P D + N+  +++TG  +GGP+ +ISSAISADLG + ++ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQN   W  VF FF+ MI +T+V ++P++V++    +   R   
Sbjct:    2 ISLSFYSHHHVAVFLLTFFSYALLHASRKAFSNVKVSISSQWTPLGLNSTYIVLPNETWNGNTLFPDTKTATIFLGLLDTIFLFAYAVGLFISGIIGDRLNMRLVLTFGMCSSAITMFVFGTLTEWLRFYNKVFYCLVWILNGLLQSTGWPCVVAVMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLQYGYEYAFLVTASVQFAGGIIIFFGLVTSPKELGLPETGEGETDRAAREEGANRPLISGNDDGDDESNYSIQSDDVVSAPKAIGFVQACCLPGVLLYSLAYACLKLVNYSFFFWLPFYLSNNFKWKEAEADQLSIWYDIGGIIGGTVQGLISDLMKMRSPVLTVSLLCAVGSLFGYSHSPNDKVINAFIMSVTGFFVGGPSNMISSAISADLGRQEMVRGSSEALATVTGIVDGTGSIGAALGQTLVSLIQNALSWMWVFYFFIFMICMTVVFMVPLVVRETRDWLRQRRASR 486          
BLAST of slc37a-2 vs. Ensembl Xenopus
Match: slc37a2 (solute carrier family 37 (glucose-6-phosphate transporter), member 2 [Source:NCBI gene;Acc:496867])

HSP 1 Score: 200.29 bits (508), Expect = 4.990e-57
Identity = 166/487 (34.09%), Postives = 241/487 (49.49%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLF------LGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYR---------------YSRIQTVDIVSENNSVIVENF--ENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRN-APGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAE 1555
            Y+  + ++TF  Y   H +RK  S VK          N + +  P  N   N+          N + +  LG LDT F+  YAIG++ SG  G+R      LS GM +  I     G+   W IH   YY       LNGL Q+TGWP+ VT M NWFG   RGF +G+W+    VGNI+G L+  + +   +   F+VP   +    I     L+  PE+ G    +               Y+   T+   +E+N     N   E ++ Q ISF+  + IPGV+ +SL     KLV+Y F +WL  Y++ +  +   AA  +S  +DVGGIIGGI+ G ISD+    +    + LILT P L +Y       V T    L + GI++ GP +LI++A+SADLG+   L GNA ALSTVT IIDG+GS+GAA+G     ++ +R  W  VF   +       + ++ ++ K+I       RK   E
Sbjct:   21 YRGFIIVMTFLFYTCYHMSRKPISIVKGQLHR-----NCSALPSP-PNISANDTTWCSWAPFENSNYKELLGSLDTAFLVSYAIGMFFSGIFGERLPLRYYLSGGMIICGIFTSFMGLGYYWNIHALWYYILFQI--LNGLAQTTGWPSVVTCMGNWFGKGKRGFIMGIWNSHTAVGNILGSLIAGAFVSTAWGLSFIVPGIIIAAFGIFCFFFLVEYPEDVGCTPPQQPEDTKENLEDMPVSYNSTDTICKSTESNEDDSGNAHTETEHPQAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANDAQFDPKAAGDLSTLFDVGGIIGGILAGGISDYTGKSAITCTIMLILTAPMLFIYNYLGQTGVSTTVAMLIVCGILVNGPYSLITTAVSADLGTHESLQGNAKALSTVTAIIDGSGSIGAALGPSLAGVLSSR-GWNYVFYMLIAADICACLLLVRLVYKEIRTLCGGMRKSYTE 498          
BLAST of slc37a-2 vs. Ensembl Xenopus
Match: slc37a2 (solute carrier family 37 (glucose-6-phosphate transporter), member 2 [Source:NCBI gene;Acc:496867])

HSP 1 Score: 197.593 bits (501), Expect = 3.734e-56
Identity = 159/440 (36.14%), Postives = 225/440 (51.14%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLF------LGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVP-----CAALFTGSIVVVCS---LIAKP--ENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNE--QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRN-APGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNR 1429
            Y+  + ++TF  Y   H +RK  S VK          N + +  P  N   N+          N + +  LG LDT F+  YAIG++ SG  G+R      LS GM +  I     G+   W IH   YY       LNGL Q+TGWP+ VT M NWFG   RGF +G+W+    VGNI+G L+  + +   +   F+VP        +F    +V C     +  P  EN       Y+   T+   +E+N     N   + E  Q ISF+  + IPGV+ +SL     KLV+Y F +WL  Y++ +  +   AA  +S  +DVGGIIGGI+ G ISD+    +    + LILT P L +Y       V T    L + GI++ GP +LI++A+SADLG+   L GNA ALSTVT IIDG+GS+GAA+G     ++ +R
Sbjct:   12 YRGFIIVMTFLFYTCYHMSRKPISIVKGQLHR-----NCSALPSP-PNISANDTTWCSWAPFENSNYKELLGSLDTAFLVSYAIGMFFSGIFGERLPLRYYLSGGMIICGIFTSFMGLGYYWNIHALWYYILFQI--LNGLAQTTGWPSVVTCMGNWFGKGKRGFIMGIWNSHTAVGNILGSLIAGAFVSTAWGLSFIVPGIIIAAFGIFCFFFLVECKCFYFLKYPNIENLEDMPVSYNSTDTICKSTESNEDDSGNAHTETEHPQAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANDAQFDPKAAGDLSTLFDVGGIIGGILAGGISDYTGKSAITCTIMLILTAPMLFIYNYLGQTGVSTTVAMLIVCGILVNGPYSLITTAVSADLGTHESLQGNAKALSTVTAIIDGSGSIGAALGPSLAGVLSSR 443          
BLAST of slc37a-2 vs. Ensembl Xenopus
Match: slc37a2 (solute carrier family 37 (glucose-6-phosphate transporter), member 2 [Source:NCBI gene;Acc:496867])

HSP 1 Score: 193.741 bits (491), Expect = 8.569e-55
Identity = 156/430 (36.28%), Postives = 222/430 (51.63%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLF------LGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIA-KPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNE--QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNR 1429
            Y+  + ++TF  Y   H +RK  S VK          N + +  P  N   N+          N + +  LG LDT F+  YAIG++ SG  G+R      LS GM +  I     G+   W IH   YY       LNGL Q+TGWP+ VT M NWFG   RGF +G+W+    VGNI+G L+  + +   +   F+VP   +    I     L+    EN       Y+   T+   +E+N     N   + E  Q ISF+  + IPGV+ +SL     KLV+Y F +WL  Y++ +  +   AA  +S  +DVGGIIGGI+ G ISD+    +    + LILT P +V  R A   +L       + GI++ GP +LI++A+SADLG+   L GNA ALSTVT IIDG+GS+GAA+G     ++ +R
Sbjct:   12 YRGFIIVMTFLFYTCYHMSRKPISIVKGQLHR-----NCSALPSP-PNISANDTTWCSWAPFENSNYKELLGSLDTAFLVSYAIGMFFSGIFGERLPLRYYLSGGMIICGIFTSFMGLGYYWNIHALWYYILFQI--LNGLAQTTGWPSVVTCMGNWFGKGKRGFIMGIWNSHTAVGNILGSLIAGAFVSTAWGLSFIVPGIIIAAFGIFCFFFLVEYTKENLEDMPVSYNSTDTICKSTESNEDDSGNAHTETEHPQAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANDAQFDPKAAGDLSTLFDVGGIIGGILAGGISDYTGKSAITCTIMLILTAP-MVSVRGASISMLI------VCGILVNGPYSLITTAVSADLGTHESLQGNAKALSTVTAIIDGSGSIGAALGPSLAGVLSSR 426          
BLAST of slc37a-2 vs. Ensembl Mouse
Match: Slc37a3 (solute carrier family 37 (glycerol-3-phosphate transporter), member 3 [Source:MGI Symbol;Acc:MGI:1919394])

HSP 1 Score: 397.512 bits (1020), Expect = 8.147e-133
Identity = 237/479 (49.48%), Postives = 313/479 (65.34%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNT-IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG-------SKLYRYSRIQTVDIVS-----ENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAEN 1558
            F  +   VF++TFF+Y LLHA+RK+FSNVK + +++WT    NT +  P + W  N+LF   + A +FLG LDTVF+  YA+GL+ SG IGDR +   VLS GM  S+  +F+FG LTEW+HFYN +FY   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G I++   L+  PE  G             S+   +D        E N  I E+      + ISF +   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG ++G ISD +  R+PV  LSL L + +LV Y  +P +   N++ +TITG  IGGP+ ++SSAISADLG + L+ GN+ AL+TVTGI+DGTGS+GAA+GQ  V LIQ+   W  VF FF++M S TI+ ILP++V+++   V   R+ ++ N
Sbjct:   16 FSHHHLAVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPNAFNTSLDLPAEIWSSNHLFPSTEEATLFLGTLDTVFLFSYAVGLFISGIIGDRLNLRWVLSFGMCSSAFVVFVFGTLTEWLHFYNKWFYCGLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGAFLASSVLQYGYEYAFLVTASVQFAGGIIIFFGLLVSPEEIGLPSIGAEESSEEDSQRPLIDGAENEDDYEPNYSIQEDRAVVQVKAISFHQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLLGFISDVLQKRAPVLALSLFLAVGSLVGYSRSPNNKSINALLMTITGFFIGGPSNMVSSAISADLGRQELIQGNSEALATVTGIVDGTGSIGAAVGQYLVSLIQDNLGWMWVFYFFILMTSCTILFILPLIVREVFSLVQ-RRQAHSLN 493          
BLAST of slc37a-2 vs. Ensembl Mouse
Match: Slc37a2 (solute carrier family 37 (glycerol-3-phosphate transporter), member 2 [Source:MGI Symbol;Acc:MGI:1929693])

HSP 1 Score: 199.134 bits (505), Expect = 1.176e-56
Identity = 165/496 (33.27%), Postives = 250/496 (50.40%), Query Frame = 2
Query:  170 FYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTE---EWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRY--------------------SRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIK-RVNLHRKKNAENPLSFPE 1576
            +++  + ++TF  Y   H +RK  S VK    +   E     N+T       W   + F  +D  ++ LG +D  F+  YAIG++ SG  G+R      LSAGM LS +   +FG+   W IH   Y+  +     NGL Q+TGWP+ VT + NWFG   RGF +G+W+    VGNI+G L+    ++  +   F+VP        ++    LI  PE+      R+                    SR   VDI + ++       +    + ISF   + IPGVI +SL     KLV+Y F +WL  Y+    +++   A  +S  +DVGGIIGGI+ G+ISD+  SR+    + LIL  P + +Y     + +T+SI  L I G+++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGS+GAA+G +   LI     W  VF   +    +  + +  ++ K+I+  +    R   +   L+ P 
Sbjct:   20 WFRGFILLLTFLIYACYHMSRKPISIVKSRLHQNCSEMVRPVNDTHDLNDTTWCSWSPFDKDDYKEL-LGAVDNAFLVAYAIGMFISGIFGERLPLRYYLSAGMVLSGLFTSLFGLGYFWNIHMLWYFVLIQI--CNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGVWVNQHWGLSFIVPGIITAIMGVITFLFLIEYPEDVDCTPPRHHDDPEKEQDNPEDPVNSPYSSRESNVDIAASSSKE-----QGPEPEAISFLGALRIPGVIEFSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGIMAGLISDYTNSRATTCCIMLILAAPMMFLYNYIGQNGITSSIVMLIICGVLVNGPYALITTAVSADLGTHESLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPT-GWNNVFYMLISADVLACLLLCRLVYKEILAWKTACGRSSGSSLALTHPR 506          
BLAST of slc37a-2 vs. Ensembl Mouse
Match: Slc37a2 (solute carrier family 37 (glycerol-3-phosphate transporter), member 2 [Source:MGI Symbol;Acc:MGI:1929693])

HSP 1 Score: 199.134 bits (505), Expect = 1.210e-56
Identity = 157/444 (35.36%), Postives = 231/444 (52.03%), Query Frame = 2
Query:  170 FYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTE---EWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRY--------------------SRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQ 1423
            +++  + ++TF  Y   H +RK  S VK    +   E     N+T       W   + F  +D  ++ LG +D  F+  YAIG++ SG  G+R      LSAGM LS +   +FG+   W IH   Y+  +     NGL Q+TGWP+ VT + NWFG   RGF +G+W+    VGNI+G L+    ++  +   F+VP        ++    LI  PE+      R+                    SR   VDI + ++       +    + ISF   + IPGVI +SL     KLV+Y F +WL  Y+    +++   A  +S  +DVGGIIGGI+ G+ISD+  SR+    + LIL  P + +Y     + +T+SI  L I G+++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGS+GAA+G +   LI 
Sbjct:   20 WFRGFILLLTFLIYACYHMSRKPISIVKSRLHQNCSEMVRPVNDTHDLNDTTWCSWSPFDKDDYKEL-LGAVDNAFLVAYAIGMFISGIFGERLPLRYYLSAGMVLSGLFTSLFGLGYFWNIHMLWYFVLIQI--CNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGVWVNQHWGLSFIVPGIITAIMGVITFLFLIEYPEDVDCTPPRHHDDPEKEQDNPEDPVNSPYSSRESNVDIAASSSKE-----QGPEPEAISFLGALRIPGVIEFSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGIMAGLISDYTNSRATTCCIMLILAAPMMFLYNYIGQNGITSSIVMLIICGVLVNGPYALITTAVSADLGTHESLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLIS 455          
BLAST of slc37a-2 vs. Ensembl Mouse
Match: Slc37a1 (solute carrier family 37 (glycerol-3-phosphate transporter), member 1 [Source:MGI Symbol;Acc:MGI:2446181])

HSP 1 Score: 192.2 bits (487), Expect = 9.078e-54
Identity = 162/475 (34.11%), Postives = 236/475 (49.68%), Query Frame = 2
Query:  149 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTN---------NNTIVYPLKNWKRNN------LFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSR-GFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENF--GSKLYRYSR----------IQTVDIVSENNSVIVENFE---------------------NKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQ 1423
            + F    +Y++ +F++TF  Y   H +RK  S VK    ++ T  +         +++  +   +W  NN           ++ Q  LG LD  F+  YAIG+Y SG IG+R      L+ GM  S     +FG L  + + ++  FYVV   +NGL Q+TGWP+ VT +SNWFG  R G  +G+W+    VGNI+G L+    +   +   F+VP A +    IV    LI  P++    S L  + R          +Q     SE N  +    +                     + N   ISF   + IPGVI +SL     KLV+Y F FWL  Y++   +     A  +S  +DVGGI GGI+ G+ISD +  R+    L L+L  P L V+ +     L  +I  L ++G ++ GP  LI++A+SADLG+   L GN+ ALSTVT IIDGTGSVGAA+G +   LI 
Sbjct:   12 ISFSRDQWYRAFIFMLTFLLYASFHLSRKPISIVKGELHKQCTAGDGPESPFSDPSSSTRHGPTHWLLNNETDCGWAPFDKNNYQQLLGALDYAFLCAYAIGMYLSGIIGERLPIRYYLTFGMLASGAFTALFG-LGYFYNIHSLGFYVVTQIINGLVQTTGWPSVVTCLSNWFGKGRRGLIMGIWNSHTSVGNILGSLIAGYWVSTCWGLSFIVPGAIVAAMGIVCFLFLIEHPKDVKCSSTLPTHPRASENGINRFRLQKQTTYSEKNGPLDPELQCLLLSDGKNPLHPSHIVVLPADGNMAAISFTGALRIPGVIEFSLCLLFAKLVSYTFLFWLPLYITSVDHLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYVFSSVSRMGLEATIAMLLLSGALVSGPYALITTAVSADLGTHKSLKGNSHALSTVTAIIDGTGSVGAALGPLLAGLIS 485          
BLAST of slc37a-2 vs. Ensembl Mouse
Match: Slc37a1 (solute carrier family 37 (glycerol-3-phosphate transporter), member 1 [Source:MGI Symbol;Acc:MGI:2446181])

HSP 1 Score: 192.2 bits (487), Expect = 9.078e-54
Identity = 162/475 (34.11%), Postives = 236/475 (49.68%), Query Frame = 2
Query:  149 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTN---------NNTIVYPLKNWKRNN------LFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSR-GFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENF--GSKLYRYSR----------IQTVDIVSENNSVIVENFE---------------------NKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQ 1423
            + F    +Y++ +F++TF  Y   H +RK  S VK    ++ T  +         +++  +   +W  NN           ++ Q  LG LD  F+  YAIG+Y SG IG+R      L+ GM  S     +FG L  + + ++  FYVV   +NGL Q+TGWP+ VT +SNWFG  R G  +G+W+    VGNI+G L+    +   +   F+VP A +    IV    LI  P++    S L  + R          +Q     SE N  +    +                     + N   ISF   + IPGVI +SL     KLV+Y F FWL  Y++   +     A  +S  +DVGGI GGI+ G+ISD +  R+    L L+L  P L V+ +     L  +I  L ++G ++ GP  LI++A+SADLG+   L GN+ ALSTVT IIDGTGSVGAA+G +   LI 
Sbjct:   12 ISFSRDQWYRAFIFMLTFLLYASFHLSRKPISIVKGELHKQCTAGDGPESPFSDPSSSTRHGPTHWLLNNETDCGWAPFDKNNYQQLLGALDYAFLCAYAIGMYLSGIIGERLPIRYYLTFGMLASGAFTALFG-LGYFYNIHSLGFYVVTQIINGLVQTTGWPSVVTCLSNWFGKGRRGLIMGIWNSHTSVGNILGSLIAGYWVSTCWGLSFIVPGAIVAAMGIVCFLFLIEHPKDVKCSSTLPTHPRASENGINRFRLQKQTTYSEKNGPLDPELQCLLLSDGKNPLHPSHIVVLPADGNMAAISFTGALRIPGVIEFSLCLLFAKLVSYTFLFWLPLYITSVDHLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYVFSSVSRMGLEATIAMLLLSGALVSGPYALITTAVSADLGTHKSLKGNSHALSTVTAIIDGTGSVGAALGPLLAGLIS 485          
BLAST of slc37a-2 vs. UniProt/SwissProt
Match: sp|Q17QZ3|SPX3_BOVIN (Sugar phosphate exchanger 3 OS=Bos taurus OX=9913 GN=SLC37A3 PE=2 SV=1)

HSP 1 Score: 399.823 bits (1026), Expect = 6.270e-133
Identity = 231/481 (48.02%), Postives = 316/481 (65.70%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGT--NNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKK 1546
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +++WT +  N +T + P++ W  N+LF   + A +FLG+LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+HFYN   Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  A  F G I++   L+  PE  G        I+T D   E+ +  ++   EN++E                + ISF++   +PGVI YSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G ISD +  R+PV  LSL+L I +LV Y  +P D   N++ + +TG  IGGP+ +ISSAISADLG + L+ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQ+   W  VF FF++M S T++ I P++V++    +   + +
Sbjct:   16 FSHHHMVVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPSAFNKSTELLPVEIWSSNHLFPSAEEATLFLGMLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGTLTEWLHFYNKGLYCSLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTAAVQFAGGIIIFFGLLVSPEEIG-----IPGIETEDNFEEDSHRPLINGAENEDEAEPNYSIQEGNTVTQVKAISFYQACCLPGVIAYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADQLSIWYDVGGIIGGTLQGFISDMLQKRAPVLALSLLLAIGSLVGYSRSPNDKSINALLMAVTGFFIGGPSNMISSAISADLGRQELIQGSSEALATVTGIVDGTGSIGAAVGQYLVSLIQDNLGWMWVFYFFILMTSCTVLFISPLIVRETCSLMQRRQTR 491          
BLAST of slc37a-2 vs. UniProt/SwissProt
Match: sp|Q640L2|SPX3_XENLA (Sugar phosphate exchanger 3 OS=Xenopus laevis OX=8355 GN=slc37a3 PE=2 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 7.759e-132
Identity = 235/502 (46.81%), Postives = 322/502 (64.14%), Query Frame = 2
Query:  125 SKSIICQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNT---IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG------SKLYRYSRIQTVDIVSENNSVIVENFENKNE--------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAEN 1558
            ++ +  ++  F  +  +    F++TFF+Y LLHA+RKSFSNVK + + +WT ++ N+   IV P + W  N LF    SA +FLG+LDT+F+  YA+GL+ SG IGDR +  LVL+ GM  S+I++F+FG LTEW+ FYN  FY + + +NGL QSTGWP  V IM NWFG S RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G I++   L+  P+  G       ++ R ++ +       N  +I  N E  +E              + I F +   +PGV+ YSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYD+GGI+GG V G+ISD M  RSPV  +SL+L + AL  Y ++P D + N+  ++ITG  IGGP+ +ISSAISADLG + ++ G++ AL+TVTGI+DGTGS+GAA+GQ  VPLIQN   W  VF FF+ MI +T V ++P++V++    +   R    E 
Sbjct:    7 TRRMAGRRGFFSQYTHHHLAAFLLTFFSYSLLHASRKSFSNVKVSVSSQWTPSDLNSSAYIVLPNETWNGNTLFPNTKSATLFLGLLDTIFLFAYAVGLFISGIIGDRLNMRLVLTFGMCSSAITMFVFGTLTEWLQFYNKIFYCLVWIVNGLLQSTGWPCVVAIMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKYGYEYAFLVTASVQFAGGIIIFFGLVTSPKELGLPDTGEGEMDRAAQEE-----GANKPLIGGNDEGDDESNYSIQSDDVVITPKAIGFMQACCLPGVLLYSLAYACLKLVNYSFFFWLPYYLSNNFKWKEAEADQLSIWYDIGGIVGGTVQGLISDLMKMRSPVLTVSLLLAVGALFGYSHSPNDKVMNAFIMSITGFFIGGPSNMISSAISADLGRQEMVRGSSEALATVTGIVDGTGSIGAAMGQFLVPLIQNSLNWMWVFYFFIFMICMTTVFMVPLIVRETRDWLRQRRSSRLER 503          
BLAST of slc37a-2 vs. UniProt/SwissProt
Match: sp|Q3TIT8|SPX3_MOUSE (Sugar phosphate exchanger 3 OS=Mus musculus OX=10090 GN=Slc37a3 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.541e-131
Identity = 237/479 (49.48%), Postives = 313/479 (65.34%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNT-IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG-------SKLYRYSRIQTVDIVS-----ENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAEN 1558
            F  +   VF++TFF+Y LLHA+RK+FSNVK + +++WT    NT +  P + W  N+LF   + A +FLG LDTVF+  YA+GL+ SG IGDR +   VLS GM  S+  +F+FG LTEW+HFYN +FY   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G I++   L+  PE  G             S+   +D        E N  I E+      + ISF +   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG ++G ISD +  R+PV  LSL L + +LV Y  +P +   N++ +TITG  IGGP+ ++SSAISADLG + L+ GN+ AL+TVTGI+DGTGS+GAA+GQ  V LIQ+   W  VF FF++M S TI+ ILP++V+++   V   R+ ++ N
Sbjct:   16 FSHHHLAVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPNAFNTSLDLPAEIWSSNHLFPSTEEATLFLGTLDTVFLFSYAVGLFISGIIGDRLNLRWVLSFGMCSSAFVVFVFGTLTEWLHFYNKWFYCGLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGAFLASSVLQYGYEYAFLVTASVQFAGGIIIFFGLLVSPEEIGLPSIGAEESSEEDSQRPLIDGAENEDDYEPNYSIQEDRAVVQVKAISFHQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLLGFISDVLQKRAPVLALSLFLAVWSLVGYSRSPNNKSINALLMTITGFFIGGPSNMVSSAISADLGRQELIQGNSEALATVTGIVDGTGSIGAAVGQYLVSLIQDNLGWMWVFYFFILMTSCTILFILPLIVREVFSLVQ-RRQAHSLN 493          
BLAST of slc37a-2 vs. UniProt/SwissProt
Match: sp|Q8NCC5|SPX3_HUMAN (Sugar phosphate exchanger 3 OS=Homo sapiens OX=9606 GN=SLC37A3 PE=2 SV=2)

HSP 1 Score: 384.8 bits (987), Expect = 5.515e-127
Identity = 234/481 (48.65%), Postives = 319/481 (66.32%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIV-YPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +E+WT +  NT V  P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+ FYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G IV+   L+  PE  G      S I+  +   E+ +  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G ISD +  R+PV  LSL+L + +L+ Y  +P D   N++ +T+TG  IGGP+ +ISSAISADLG + L+  ++ AL+TVTGI+DG+GS+GAA+GQ  V LI+++  W  VF FF++M S TIV I P++V++I   V L R+ +
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTEWLRFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIVIFFGLLVSPEEIG-----LSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLLLAVGSLIGYSRSPNDKSINALLMTVTGFFIGGPSNMISSAISADLGRQELIQRSSEALATVTGIVDGSGSIGAAVGQYLVSLIRDKLGWMWVFYFFILMTSCTIVFISPLIVREIFSLV-LRRQAH 490          
BLAST of slc37a-2 vs. UniProt/SwissProt
Match: sp|Q5F3N0|SPX3_CHICK (Sugar phosphate exchanger 3 OS=Gallus gallus OX=9031 GN=SLC37A3 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 4.165e-125
Identity = 222/462 (48.05%), Postives = 299/462 (64.72%), Query Frame = 2
Query:  182 VVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKN---WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVD-------------IVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI 1516
            VVF++TFF+Y LLHA+RK+FSNVK + + +WT +  N+  + L+    W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F FG LTEW+HFYN +FY   + +NGL QSTGWP  V +M NWFG + RGF  GLWS CA VGNI+G  L + VL +GYEY FLV  +  F G ++V C L+  P+  G          +V+                E N  I     +   + I F++   +PGV+ YSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G+ISD +  R+PV  +SL+  + +L  Y  +P     N++ + ITG  IGGP+ +ISSAISADLG + L+ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQ    W  VF FF++M S TI+ I P++V++I
Sbjct:   26 VVFLLTFFSYSLLHASRKTFSNVKVSISSQWTPSCLNSTTFELRPNELWNSNHLFPNAEEATLFLGTLDTIFLFSYAVGLFVSGIVGDRLNLRWVLSFGMCSSALVVFFFGTLTEWLHFYNKWFYCCLWVVNGLLQSTGWPCVVAVMGNWFGKAGRGFVFGLWSACASVGNILGAFLASCVLKYGYEYAFLVTASVQFAGGVIVFCGLLTSPKEVGLPELGADEEGSVEEDANRPLMGDDDADDDEGNYSIQAADTDSQPKAIGFFQACCLPGVVLYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADQLSIWYDVGGIIGGTIQGLISDVLQKRAPVLAISLLFAVGSLFGYSRSPNSKPINAVIMAITGFFIGGPSNMISSAISADLGRQDLVRGSSEALATVTGIVDGTGSIGAAVGQYLVSLIQENLGWMWVFYFFILMASSTILFISPLIVREI 487          
BLAST of slc37a-2 vs. TrEMBL
Match: A0A0H3YKG7 (Slc37a-2 OS=Schmidtea mediterranea OX=79327 GN=slc37a-2 PE=2 SV=1)

HSP 1 Score: 891.723 bits (2303), Expect = 0.000e+0
Identity = 478/478 (100.00%), Postives = 478/478 (100.00%), Query Frame = 2
Query:  149 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAENPLSFPEIG 1582
            MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHFYNYYFYVVFYALNGLFQSTGWPATVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDVGGIIGGIVIGIISDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVFIFFMIMISITIVCILPVLVKDIIKRVNLHRKKNAENPLSFPEIG
Sbjct:    1 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHFYNYYFYVVFYALNGLFQSTGWPATVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDVGGIIGGIVIGIISDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVFIFFMIMISITIVCILPVLVKDIIKRVNLHRKKNAENPLSFPEIG 478          
BLAST of slc37a-2 vs. TrEMBL
Match: A0A1S3I2T8 (sugar phosphate exchanger 3 OS=Lingula unguis OX=7574 GN=LOC106160482 PE=4 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 2.543e-134
Identity = 242/474 (51.05%), Postives = 309/474 (65.19%), Query Frame = 2
Query:  170 FYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKN---WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRY--------SRIQTVDIVSENNSVIVENFENKNE-QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNA 1552
            FY   +FI+TF +Y   HA RK+FSNVK + T+ WT   +N  +   K    W  + +F   D A+ FLG LDT FM  YA+GLY SG +GDR +   VLS GM  S++ +F+FG +TEW+ FYN YFY+  + LNGL QS+GWP  V IM NWFG S RG   G+WS CA VGNIIG LL+A+VL FGYEY FLV  A LF G +VV   LI  P   G              + + T  +V E N       ++K   + I F + IL+PGVIPYSL+YACLKLVNY+FFFWL  YL+++FNW +  AD +SIWYDVGGII GIV G+ISD M  RSPV V  LIL +P+L +Y  +P D+  N   + +TG  IGGPA LISSAISADLG +  + GN  AL+TV GI+DGTGSVGAAIGQ+ VP+IQ    WQ VF FF++M ++T+VCILP+L  +I+      +++ A
Sbjct:   19 FYHVTIFILTFMSYAFFHATRKTFSNVKDSLTQVWTPQCHNATIRETKPDHIWNDHKMFANKDDAEYFLGALDTAFMVAYAVGLYFSGPLGDRLNMRYVLSFGMCSSALLVFLFGTVTEWVQFYNIYFYMAVWILNGLLQSSGWPTVVAIMGNWFGKSSRGVVFGIWSACASVGNIIGTLLSAAVLPFGYEYPFLVTSAVLFAGGVVVFFGLIPSPREIGMPEADEEEEEDKTGAGVTTPLLVDEVNGDGPNTEDHKERAEAIGFIQAILLPGVIPYSLSYACLKLVNYSFFFWLPFYLAVHFNWPDTTADDLSIWYDVGGIIAGIVGGLISDIMKKRSPVVVFMLILALPSLFIYSKSPKDLYWNGFLMGVTGFFIGGPANLISSAISADLGRQGPVQGNKEALATVAGIVDGTGSVGAAIGQILVPVIQVHTSWQWVFYFFIVMTALTVVCILPLLKNEIMSMRCCQQRRGA 492          
BLAST of slc37a-2 vs. TrEMBL
Match: S7N7R5 (Sugar phosphate exchanger 3 OS=Myotis brandtii OX=109478 GN=D623_10020750 PE=4 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 4.449e-132
Identity = 232/478 (48.54%), Postives = 316/478 (66.11%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKK 1546
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +++WT +  N  + P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +FIFG +TEW+HFYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  A  F G +V+   L+  PE  G            +I  +++  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G ISD +  R+PV  LSL L I +LV Y  +P +   N++ + +TG  IGGP+ +ISSAISADLG + L+ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQ+   W  VF FF++M S TIV ILP++V+++  R  + R++
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPSAFNRSIEPVEIWSSNHLFPSAEEATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRYVLSFGMCSSALVVFIFGTVTEWLHFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTAAVQFAGGVVIFFGLLVSPEEIGLPGIEAEE----NIEEDSHKPLINGAENEDEYEPNYSVQEGSTITQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLFLAIGSLVGYSRSPNNKSINALLMAVTGFFIGGPSNMISSAISADLGRQELIQGSSEALATVTGIVDGTGSIGAAVGQYLVSLIQDNLGWMWVFYFFILMTSCTIVFILPLIVREM--RSLMQRRQ 487          
BLAST of slc37a-2 vs. TrEMBL
Match: H0XL99 (Solute carrier family 37 member 3 OS=Otolemur garnettii OX=30611 GN=SLC37A3 PE=4 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.511e-131
Identity = 233/480 (48.54%), Postives = 320/480 (66.67%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNT-IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI---IKRVNLH 1537
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +E+WT +  NT +  P + W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +F+FG LTEW+HFYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  +  F G I++   L+  P+  G      S I+  +   E+ +  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG ++G ISD +  R+PV  LSL+L I +L+ Y  +P D   N++ +T+TG  IGGP+ +ISSAISADLG + L+ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQ++  W  VF FF++M S T++ I P++V++I   ++R   H
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISEQWTPSAFNTSLELPKEIWNSNHLFPSAEEATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGTLTEWLHFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTASVQFAGGIIIFFGLLVSPQEIG-----LSGIEAEENFEEDSHRPLINGAENEDEYEPNYSIQEDSTIPQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFRWKEAEADKLSIWYDVGGIIGGTLLGFISDILQKRAPVLALSLLLAIGSLIGYSRSPDDKSVNALLMTVTGFFIGGPSNMISSAISADLGRQELIQGSSEALATVTGIVDGTGSIGAAVGQYLVSLIQDKLGWMWVFYFFILMTSCTVLFISPLIVREILYLVRRRQTH 490          
BLAST of slc37a-2 vs. TrEMBL
Match: G1NV27 (MFS domain-containing protein OS=Myotis lucifugus OX=59463 GN=SLC37A3 PE=4 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.893e-131
Identity = 233/479 (48.64%), Postives = 317/479 (66.18%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSEN-NSVIVENFENKNE----------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKK 1546
            F  +  VVF++TFF+Y LLHA+RK+FSNVK + +++WT +  N  + P++ W  N+LF   + A +FLG LDT+F+  YA+GL+ SG +GDR +   VLS GM  S++ +FIFG +TEW+HFYN + Y   + +NGL QSTGWP  V +M NWFG + RG   GLWS CA VGNI+G  L +SVL +GYEY FLV  A  F G +V+   L+  PE  G        I+  + V E+ +  ++   EN++E                + ISF++   +PGVIPYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +SIWYDVGGIIGG + G ISD +  R+PV  LSL L I +LV Y  +P +   N++ + +TG  IGGP+ +ISSAISADLG + L+ G++ AL+TVTGI+DGTGS+GAA+GQ  V LIQ+   W  VF FF++M S TIV I P++V+++  R  + R++
Sbjct:   16 FSHHHVVVFLLTFFSYSLLHASRKTFSNVKVSISKQWTPSAFNRSIEPVEIWSSNHLFPSAEEATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRYVLSFGMCSSALVVFIFGTVTEWLHFYNKWLYCCLWIVNGLLQSTGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYGYEYAFLVTAAVQFAGGVVIFFGLLVSPEEIG-----LPGIEAEENVEEDSHKPLINGAENEDEYEPNYSVQEGSTITQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLFLAIGSLVGYSRSPNNKSINALLMAVTGFFIGGPSNMISSAISADLGRQELIQGSSEALATVTGIVDGTGSIGAAVGQYLVSLIQDNLGWMWVFYFFILMTSCTIVFISPLIVREM--RSLMQRRQ 487          
BLAST of slc37a-2 vs. Ensembl Cavefish
Match: ENSAMXT00000048898.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001981.1:6645:14334:-1 gene:ENSAMXG00000034614.1 transcript:ENSAMXT00000048898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 380.178 bits (975), Expect = 7.064e-126
Identity = 231/490 (47.14%), Postives = 312/490 (63.67%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG-----SKLYRYSR-------IQTVDIVSENNSVIVENF---ENKNEQYIS------FWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI--IKRVNLHRKKNAENPLSF 1570
            +  V F++TFF+Y LLHA+RK+FSNVK + + +WT +  NT   P + W+ N LF  ++ A +FLG LDT+F+  YA+GLY SG IGDR +   VL+ G+  S+I  FIFG LTEW+ FYN YFY   + LNGL QS  WP  V +M NWFG S RGF  GLWS CA VGNI+G  L +SVL  GYEY FLV     F G +VV   L+  P+  G     + L    R       + + D   + ++V    +   + ++E+ +S      F +   +PGV+PYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +S+WYDVGGIIGG V G+ISDF+  R+PV  +SL+L + +LV Y ++P D + N + L  TG +IGGP+ +ISSAISADLG +  L G+  AL+TVTGI+DGTGS+GAA GQ  V LI+++  W  VF FF++M   +IV I+P+++ ++  + R    R    E+   F
Sbjct:   19 HHLVAFLLTFFSYVLLHASRKTFSNVKVSISAQWTPSAQNTSFLPGETWEGNKLFADSEEATLFLGALDTIFLFSYAVGLYISGVIGDRLNLRYVLATGLCGSAIVEFIFGTLTEWLQFYNVYFYCSLWVLNGLLQSAVWPCVVAVMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKHGYEYAFLVTSVVQFAGGVVVFFGLLTSPKEVGLSDSATSLISVERDPDSHQPLMSDDEEGDEDAVCDGGYYSIQQQDEEPVSQAKPIGFCQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAQADRLSVWYDVGGIIGGTVQGLISDFLGKRAPVLSVSLLLAMGSLVGYSHSPNDQVINGVLLATTGFLIGGPSNMISSAISADLGRQEALQGSQEALATVTGIVDGTGSIGAAGGQYLVSLIESKLGWMWVFYFFILMTGFSIVFIIPLIISEVRAMCRDRQARTHQLESLFMF 508          
BLAST of slc37a-2 vs. Ensembl Cavefish
Match: ENSAMXT00000017725.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:8528547:8536193:1 gene:ENSAMXG00000017219.2 transcript:ENSAMXT00000017725.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 373.244 bits (957), Expect = 2.744e-123
Identity = 222/480 (46.25%), Postives = 302/480 (62.92%), Query Frame = 2
Query:  182 VVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYR-----------YSRIQTVDIVSENNSVIVENF---ENKNEQYIS------FWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDX-XXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAE 1555
            V F++TFF+Y LLHA+RK+FSNVK + + +WT +  NT   P + W+ N LF  ++ A +FLG LDT+F+  YA+GLY SG IGDR +   VL+ G+  S+I  FIFG LTEW+ FYN YFY   + LNGL QS  WP  V +M NWFG S RGF  GLWS CA VGNI+G  L +SVL  GYEY FLV     F G +VV   L+       S   R           +  + + D   + ++V    +   + ++E+ +S      F +   +PGV+PYSLAYACLKLVNY+FFFWL  YLS NF W  A AD +S+WYDV G I  G V G+ISDF+  R+PV  +SL+L + +LV Y ++P D + N + L  TG +IGGP+ +ISSAISADLG +  L G+  AL+TVTGI+DGTGS+GAA GQ  V LI+++  W  VF FF++M   +IV I+P+++ ++       + +  +
Sbjct:   24 VAFLLTFFSYVLLHASRKTFSNVKVSISAQWTPSAQNTSFLPGETWEGNKLFADSEEATLFLGALDTIFLFSYAVGLYISGVIGDRLNLRYVLATGLCGSAIVEFIFGTLTEWLQFYNVYFYCSLWVLNGLLQSAVWPCVVAVMGNWFGKSGRGFVFGLWSACASVGNILGAFLASSVLKHGYEYAFLVTSVVQFAGGVVVFFGLLTSQRKLVSGRRRVLISVERDPDSHQPLMSDDEEGDEDAVCDGGYYSIQQQDEEPVSQAKPIGFCQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAQADRLSVWYDVGGIIGKGTVQGLISDFLGKRAPVLSVSLLLAMGSLVGYSHSPNDQVINGVLLATTGFLIGGPSNMISSAISADLGRQEALQGSQEALATVTGIVDGTGSIGAAGGQYLVSLIESKLGWMWVFYFFILMTGFSIVFIIPLIISEVRAMCRDRQARTHQ 503          
BLAST of slc37a-2 vs. Ensembl Cavefish
Match: slc37a2 (solute carrier family 37 member 2 [Source:NCBI gene;Acc:406287])

HSP 1 Score: 187.578 bits (475), Expect = 3.894e-53
Identity = 139/364 (38.19%), Postives = 201/364 (55.22%), Query Frame = 2
Query:  344 NDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGD--VLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQ 1423
             D+ Q   G +D  F+  YA G++ SG  G+R      L++GM LS +   +FG+   W IH   YY  +   ALNGL Q+TGWPA V  + NWFG   RGF +G+W+    VGNI+G L+  + +   +   F+VP   +    I+    L+ KPE+    L ++    T  I  +N+S+    F   + Q           GV+ +SL     KLV+Y F +WL  Y++   N+   +A  +S  +DVGGI+GGI+ G++SD+   R+    + LI+  P L +Y NA G   V T  + L + G ++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGS+GAAIG +   LI 
Sbjct:   25 QDNYQNLFGYIDNCFLVAYAFGMFFSGMFGERLPLRYYLTSGMLLSGLFTSLFGLGFYWNIHSLWYYCLMQ--ALNGLVQTTGWPAVVACVGNWFGKGKRGFIMGVWNSHTSVGNILGSLIAGAFVSSAWGMSFIVPGIIIAVMGIICFFFLVEKPEDVNCSLPQHHVRTTAQI--QNSSLTRNVFCPASLQ-----------GVVEFSLCLLFAKLVSYTFLYWLPLYIANVANFDAKSAGDMSTLFDVGGILGGILAGVVSDYTGGRATTCCVMLIVAAPMLFLY-NAIGQNGVSTTVVMLLVCGALVNGPYALITTAVSADLGTHECLRGNAKALSTVTAIIDGTGSIGAAIGPLLAGLIS 372          
BLAST of slc37a-2 vs. Ensembl Cavefish
Match: slc37a1 (solute carrier family 37 member 1 [Source:NCBI gene;Acc:103047557])

HSP 1 Score: 179.874 bits (455), Expect = 1.167e-49
Identity = 151/458 (32.97%), Postives = 224/458 (48.91%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTE----------EWTGTNNNTIVYPLKN--WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVEN-----------------FENKNE---QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAV 1447
            Y++  F++TF  Y   H +RK  S VK    +          E + +    I++   +  WK  +     D+ +  LG +D  F+  YA+G+Y SG IG+R    L L+ GM  S +   +FG L    + +   FY++    NGL Q+TGWP+ VT + NWFG   RG  +GLW+    VGNI+G L+    +   +   F+VP   +    I+    LI +   F S  +     Q +   + + S   +                     K+E     ISF   + IPGV+ +S      KLV+Y F FWL  Y++   +  +  A  +S  +DVGGI+GGI+ G+ISD +  R+    + L+L  P +      P   L     L + G ++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGSVGAAIG +   L+  +  W  V
Sbjct:   12 YRAFTFVLTFLLYTSFHLSRKPISIVKSELHKNCSLVKELATESSKSGQPQILHVEVDCSWKPFD----RDNYKQLLGAMDLSFLFVYAVGMYLSGIIGERLPIRLFLTMGMLTSGLFTCLFG-LGYICNIHTLSFYIIVQIANGLVQTTGWPSVVTCIGNWFGKGRRGLIMGLWNSHTSVGNILGSLIAGYYVSSNWGLSFIVPGIIIAVMGILCFLFLIEREWCFRSSSHFSKSHQCLMKETPHMSYCCDTELLLGQDSAVCVPVQQVVVVKSEAELSAISFRGALCIPGVVEFSFCLLFAKLVSYTFLFWLPLYITKAAHLDSKTAGDLSTLFDVGGIVGGILAGVISDKLGKRATTCAVMLLLAAPTV-----CPFTALWRKAMLLVCGGLVNGPYALITTAVSADLGTHKSLKGNARALSTVTAIIDGTGSVGAAIGPLLAGLLSAQ-SWDQV 458          
BLAST of slc37a-2 vs. Ensembl Cavefish
Match: slc37a1 (solute carrier family 37 member 1 [Source:NCBI gene;Acc:103047557])

HSP 1 Score: 177.563 bits (449), Expect = 1.125e-48
Identity = 153/481 (31.81%), Postives = 237/481 (49.27%), Query Frame = 2
Query:  155 FRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTE----------EWTGTNNNTIVYPLKN--WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGS------------------------KLYRYSRIQTVD---IVSENNS---VIVENFENKNE---QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPAL----VVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAV 1447
            F    +Y++  F++TF  Y   H +RK  S VK    +          E + +    I++   +  WK  +     D+ +  LG +D  F+  YA+G+Y SG IG+R    L L+ GM  S +   +FG L    + +   FY++    NGL Q+TGWP+ VT + NWFG   RG  +GLW+    VGNI+G L+    +   +   F+VP   +    I+    LI  P +  +                        +LY   + Q+ D   ++ ++++    + +    K+E     ISF   + IPGV+ +S      KLV+Y F FWL  Y++   +  +  A  +S  +DVGGI+GGI+ G+ISD +  R+    + L+L  P L    ++ +   G  +     L + G ++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGSVGAAIG +   L+  +  W  V
Sbjct:   14 FNREQWYRAFTFVLTFLLYTSFHLSRKPISIVKSELHKNCSLVKELATESSKSGQPQILHVEVDCSWKPFD----RDNYKQLLGAMDLSFLFVYAVGMYLSGIIGERLPIRLFLTMGMLTSGLFTCLFG-LGYICNIHTLSFYIIVQIANGLVQTTGWPSVVTCIGNWFGKGRRGLIMGLWNSHTSVGNILGSLIAGYYVSSNWGLSFIVPGIIIAVMGILCFLFLIEHPNDLKAAETHSTASNNQKLHKSWTGVNGHKELYLQYKKQSCDTELLLGQDSAVCVPVQQVVVVKSEAELSAISFRGALCIPGVVEFSFCLLFAKLVSYTFLFWLPLYITKAAHLDSKTAGDLSTLFDVGGIVGGILAGVISDKLGKRATTCAVMLLLAAPTLYGFSMISQFGQGPTIA---MLLVCGGLVNGPYALITTAVSADLGTHKSLKGNARALSTVTAIIDGTGSVGAAIGPLLAGLLSAQ-SWDQV 485          
BLAST of slc37a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002627.1 (pep scaffold:Pmarinus_7.0:GL477247:54318:68321:1 gene:ENSPMAG00000002379.1 transcript:ENSPMAT00000002627.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 362.844 bits (930), Expect = 3.447e-120
Identity = 212/482 (43.98%), Postives = 301/482 (62.45%), Query Frame = 2
Query:  125 SKSIICQKMKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNT---IVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFG---SKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKN 1549
             ++++  +   R +  +   VF++TFF+Y   H  RK+FSNVK + + +WTGT  N     +YP + W  + LF   ++A +FLG LDT+F+  YA+GLY SGY+GDR++  LVL+ GM  S+I + +FG +TEW+ FY+  FY V +A+NGL QSTGWP  V IM NWFG  SRG   GLWS CA VGNI+G LL + VL FGYEY FLV    LF   IVV   L++ P   G            ++V+         +          + F++ + +PGV   ++A    KLVNY+FFFWL  YLS +F W+ A AD +SIWYDVGGIIGG   G++SD +  R+P+  L LIL   +LV Y+ +P +   N   + +TG  +GGPA LISSA+SADLG +  + GN  AL+TVTGI+DGTGS+GA++GQ  V +I+N+  W  VF  F++M  +TIVC+LP++++++ + V   R + 
Sbjct:    7 QRAMLAPEAPRRGWTHHHFCVFLLTFFSYAFFHVTRKTFSNVKVSLSVQWTGTPTNESTGTLYPPEVWSAHQLFPDENNASLFLGALDTIFLFSYAVGLYISGYLGDRFNLRLVLTLGMCSSAIVVLVFGSVTEWLGFYSMPFYAVMWAVNGLLQSTGWPCVVAIMGNWFGKDSRGLVFGLWSACASVGNILGALLVSGVLRFGYEYAFLVTACCLFASGIVVFFGLVSSPLEVGLPAPDCAEDGAGESVNCAEAVEQTTLLGDPVSPPPALGFFQAVCLPGVALLTVAPGDPKLVNYSFFFWLPFYLSGHFGWSEADADRMSIWYDVGGIIGGAAGGLVSDRLGKRAPIITLMLILATGSLVGYKYSPNNKSVNGFLMGVTGFFVGGPANLISSAVSADLGRQGPVQGNQEALATVTGIVDGTGSLGASVGQFLVAVIKNKLGWGWVFYLFILMTLLTIVCLLPLVIREVRELVASSRVRR 488          
BLAST of slc37a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001353.1 (pep scaffold:Pmarinus_7.0:GL476510:345174:359517:-1 gene:ENSPMAG00000001208.1 transcript:ENSPMAT00000001353.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 338.961 bits (868), Expect = 9.769e-111
Identity = 206/467 (44.11%), Postives = 294/467 (62.96%), Query Frame = 2
Query:  185 VFIVTFFAYGLLHANRKSFSNVKPTFTEEWTG---TNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENK-------------------NEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI 1516
            +F++TF +Y L +A RK+ S VK +F  EWT     ++   + P + W  ++LF   + A +FLG LDT+F+  YA+G Y SG++ DR++  LVLS GM+LS++  F+FG +TEW+ FYN  FY   + LNG  QSTGWP TV IM NWFG+ SRGF  G+WS C C+GNI+G +L ++V+ +GYEY FLV  + L +G I+V   +I  P           +  +V   + + S+ V +  N+                    +  + F+KI+ +PGV  Y+LAYACLK VNYAFFFWL  YL+  F+WT   A  +SIWYD GGIIGG + G+ISD +  R+PV  L L+L +  L  Y N   + + N   L +TG  + G A LISSA+ ADLG +  + GN  AL TVTGI+DGTGS+GA++GQ  V +I +RF W+ VF+FF++MI +T++ +LP++V+DI
Sbjct:   23 IFLLTFSSYALFNATRKTLSCVKVSFLSEWTQMRINDSRETLSPPEIWSAHSLFPDEEKASLFLGALDTIFLFTYALGSYISGFLSDRFNLRLVLSVGMWLSALVAFVFGSVTEWLGFYNMPFYAFLWVLNGFVQSTGWPCTVAIMGNWFGNKSRGFIFGVWSSCGCIGNILGAVLVSTVISYGYEYTFLVMASLLLSGGIIVFFGMIVSPAE-----VVLPKEASVTWSNASESLPVVDMANQRTYGTPPDDGPREGSSIPTEKPALGFFKIVCLPGVAVYALAYACLKPVNYAFFFWLPYYLADEFSWTEVDASRMSIWYDFGGIIGGAMAGLISDRLGKRAPVIALMLLLAVVTLACYLNPFSNRVWNGFLLGVTGFFVSGTANLISSAVPADLGQQDTIQGNREALGTVTGIVDGTGSLGASVGQFLVAVIYSRFGWEWVFVFFIVMIFLTLIILLPLVVRDI 484          
BLAST of slc37a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009328.1 (pep scaffold:Pmarinus_7.0:GL487250:2:5046:1 gene:ENSPMAG00000008435.1 transcript:ENSPMAT00000009328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 3.396e-33
Identity = 80/175 (45.71%), Postives = 119/175 (68.00%), Query Frame = 2
Query: 1022 YLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKK 1546
            YL+  F+WT   A  +SIWYD GGIIGG + G+ISD +  R+PV  L L+L +  L  Y N   + + N   L +TG  + G A LISSA+ ADLG +  +  N  AL TVTGI+DGTGS+GA++GQ  V +I +RF W+ VF+FF++MI +T++ +LP++V+D IK + +++++
Sbjct:    3 YLADEFSWTEVDASRMSIWYDFGGIIGGAMAGLISDRLGKRAPVIALMLLLAVVTLACYLNPFSNRVWNGFLLGVTGFFVSGTANLISSAVPADLGQQDTIQSNREALGTVTGIVDGTGSLGASVGQFLVAVIYSRFGWEWVFVFFIVMIFLTLIILLPLVVRD-IKNIFVNQQR 176          
BLAST of slc37a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002283.1 (pep scaffold:Pmarinus_7.0:GL495858:1:3647:-1 gene:ENSPMAG00000002072.1 transcript:ENSPMAT00000002283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 2.966e-23
Identity = 69/212 (32.55%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  155 FRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSA------------QVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVP 748
            + ++H ++  + ++TFF Y   H +RK  S VK    +     N +  + P  ++K N LF  N+              +  LG LD  F+G YAIG++ SG IG+R    L L+ GM LS     +FG+   W IH   +Y  V +  +  +   TGWP+ +  + NWFG   RGF +G+W+    VGNI+G L+    +   + Y F+VP
Sbjct:   16 YDVWHRHRGFILVLTFFLYAAFHMSRKPISIVKSQLHK-----NCSAGMEPF-SFKENLLFKENNETWCDWKPFDRSNYKELLGALDYSFLGAYAIGMFLSGVIGERVPMRLYLTVGMVLSGFFTILFGLGFFWKIHSLPFYIVVQYVTV--IMIPTGWPSVIACIGNWFGKGRRGFIMGVWNSHTSVGNIVGSLIAGVWVSTSWGYSFVVP 219          
BLAST of slc37a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006648.1 (pep scaffold:Pmarinus_7.0:GL489687:3729:6815:-1 gene:ENSPMAG00000006005.1 transcript:ENSPMAT00000006648.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 8.159e-13
Identity = 50/137 (36.50%), Postives = 75/137 (54.74%), Query Frame = 2
Query: 1124 SDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI--YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGS----VGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDI 1516
            SD +  R+    + L+L  P L VY +     +  +I   L + G ++ GP  LI++A+SADLG+   L GNA AL TV+ IIDGTGS    VGAA+G +   LI +   W  VF   M   +   + ++ ++ K+I
Sbjct:   11 SDAIGGRATTCGVMLLLAAPMLFVYNSVGYQNMPTTIGRMLVLCGALVNGPYALITTAVSADLGTHKSLKGNARALHTVSAIIDGTGSIVTRVGAALGPLLAGLI-SPLGWDNVFYMLMGADACACLLLIRLMYKEI 146          
BLAST of slc37a-2 vs. Ensembl Nematostella
Match: EDO46981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNS3])

HSP 1 Score: 371.318 bits (952), Expect = 1.798e-123
Identity = 211/437 (48.28%), Postives = 282/437 (64.53%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNG--LFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQY----------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQN 1426
            Y  +VFI+TF +Y   HA RK+FSN K    +EWT  N    + P   W+    F    SA+ FLG +DT F+  YAIGL+ SG +GDR++   VL+ GM  S+I +F+FG +++W++ +N ++Y VF ALNG  + QSTGWP+TV +M NWFG  SRG   GLWS CA VGNI G L  A+VLD+GYEY  LVP A LF G +V+   LI  P++ G  +       + ++ S      V N  +  + Y                I F + + +PGVIPYSL+YACLKLVNY+FFFWL  YLS+  NW ++ AD +S +YD+GGIIGG + G I+D M SRSPV V+ LIL++ +L VY++   +   N + + ITG +IGGPA LISSAISADLG +P L G+  AL+TVTGI+DGTGSVGAAIGQ+ +P+I N
Sbjct:    7 YHILVFILTFMSYAFFHATRKAFSNCKDNMRKEWTPFNKTNPIEPESTWEAVQFFETKKSAEYFLGAMDTTFLSTYAIGLFISGALGDRFNLRKVLAFGMCSSAIMVFMFGTVSKWLNIHNIWYYGVFMALNGKCILQSTGWPSTVAVMGNWFGKSSRGLVFGLWSACASVGNIFGALEVAAVLDYGYEYAMLVPSAMLFAGGLVIFFCLIPSPQDIGLPM------PSDELSSAEKQRPVFNDTDDQQPYPNQAPYALPDALFQKAIGFCQALFLPGVIPYSLSYACLKLVNYSFFFWLPYYLSVKLNWKDSIADDLSTFYDIGGIIGGAIAGFITDRMRSRSPVVVVMLILSVISLFVYKSIGAEYTLNVVVMAITGFMIGGPANLISSAISADLGRQPCLKGDDEALATVTGIVDGTGSVGAAIGQILIPVITN 437          
BLAST of slc37a-2 vs. Ensembl Nematostella
Match: EDO48752 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIP4])

HSP 1 Score: 55.8398 bits (133), Expect = 1.262e-8
Identity = 72/319 (22.57%), Postives = 132/319 (41.38%), Query Frame = 2
Query:  590 WPATVTIMSNWFG-HSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLIL---TIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILP-VLVKDIIKRVN 1531
            WP  V  +  WF    R    G +  C   G I+G                    +AL  G+ +VV   I  PE  G ++    ++QT                 ++  YI  W++ ++P     S     +KLV Y  + WL  YL     ++   A  +S  +++GG+ G   +G+I   ++    V  ++L +   T+     +  +   +  N +++ + G    GP   +S +I+A++G       NA A   V+G+I+G GS+G  +    +  +  R+ W   F F + +  +  VC+   V + + +KR  
Sbjct:    2 WPNCVKTLGMWFNDQQRTTIFGFFGTCTFGGGILG--------------------SALAGGTGLVVFMFIRSPEELGMQIP--GKVQT-----------------RSLSYIQLWRLRMVP---ELSWTNFSIKLVRYCMYMWLPMYLFQALGYSKLQAGLLSTVFEIGGVAGSASLGLIISRLFGGRAVYGVALTVLGSTVFLAAFHFTSHMGIPINCVFMFLAGACNCGPDPYLSGSIAAEIGERE----NAQA--AVSGLINGFGSIGTVVEGPVIGWMVERYGWAGPFYFMITLSLVGTVCMFKAVTIDNKMKRAE 272          
BLAST of slc37a-2 vs. Ensembl Medaka
Match: ENSORLT00000013862.2 (solute carrier family 37 member 3 [Source:NCBI gene;Acc:101160451])

HSP 1 Score: 377.096 bits (967), Expect = 8.287e-125
Identity = 223/482 (46.27%), Postives = 305/482 (63.28%), Query Frame = 2
Query:  185 VFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGT--NNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHS-RGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVI----------VENFENKNEQY-------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNA 1552
            VF++TFF+Y LLH++RK+FSNVK + + +WT +  N++    P + W+ N LF     A +FLG LD++F+  YA GLY SG IGDR +   VL  G+  S++  F+FG LTEW+H YN Y Y   + LNGL QS  WP  V +M +WFG + RGF  GLWS CA VGNI+G  L +SVL +GYEY FLV     F G +VV   L+  P+  G  L   + +  V+  ++++  +          VE +  +                 I F++   +PGV+PYSLAYACLKLVNY+FFFWL  YLS N+ W  A AD +S+WYDVGGIIGG V+G+ISDFM  RSPV V+SL++ + ALV Y  +P D L N++ L +TG  IGGP+ +ISSAISADLG +  L  +  AL+TVTGI+DGTGS+GAA GQ  V LI+++  W +VF FF++M   +I  I P+L+++     +L R + A
Sbjct:   19 VFLLTFFSYVLLHSSRKTFSNVKVSISAQWTPSISNDSAQFSPAETWENNRLFADEKQATLFLGALDSIFLFSYAAGLYLSGVIGDRVNLRYVLCFGLCGSAVVEFVFGTLTEWLHIYNVYLYCGLWVLNGLLQSAVWPCVVAVMGHWFGKTGRGFVFGLWSACASVGNILGAFLASSVLKYGYEYAFLVTSIVQFAGGVVVFFGLLTSPKEVGLSLEEATGLGPVETETDSHKPLMSDEEEEEEQVEAYARRRRSAKPQEDPPPEPPQAIGFFQAFCLPGVLPYSLAYACLKLVNYSFFFWLPFYLSNNYGWKEAEADRLSVWYDVGGIIGGTVLGLISDFMGKRSPVLVISLVMAMGALVGYSRSPNDQLINAVILAVTGFFIGGPSNMISSAISADLGRQEALRSSQEALATVTGIVDGTGSIGAAAGQYVVSLIESKLGWMSVFYFFVVMTGGSIFFITPLLIRET---RDLWRDRQA 497          
BLAST of slc37a-2 vs. Ensembl Medaka
Match: slc37a2 (solute carrier family 37 member 2 [Source:NCBI gene;Acc:101169803])

HSP 1 Score: 192.971 bits (489), Expect = 2.040e-54
Identity = 151/444 (34.01%), Postives = 226/444 (50.90%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLK-NWKRNNLF-----LGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNE------------------QYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQ 1423
            Y+  + ++TF  Y   H +RK  S VK          N +T++ P   N   N  +        D+ Q   GVLD  F+  YAIG++ SG  G+R      LS GM  S     +FG+   W IH   YY +V    +NGL Q+TGWP+ V  + NWFG   RGF +G+W+    VGNI+G L+  + +   +   F+VP   + +  I+    L+ KPE+      ++   +     +E    +++N  N N+                  + ISF   + IPGV+ +SL     KLV+Y F +WL  Y+S   ++    A  +S  +DVGGI+GGI  G++SD+   R+    + LI   P L +Y +     L  +I  L + G ++ GP  LI++A+SADLG+   L GN+ ALSTVT IIDGTGS+GAA+G +   +I 
Sbjct:   21 YRGFILLLTFLFYTAYHLSRKPISIVKSELHR-----NCSTVIRPPGINITDNETWCDWSPFDQDNYQTLFGVLDNSFLVAYAIGMFISGIFGERLPLRYYLSFGMVTSGFFTCLFGLGFYWNIHSLGYYAFVQ--VMNGLVQTTGWPSVVACVGNWFGKGKRGFIMGVWNSHTSVGNILGSLIAGAFVSSAWGMSFIVPGLIITSTGILCFFFLVEKPEDVNCSPPQHHSEKE----NEETEPLLQNLPNGNQTINGGVSAESPVTVHDHTKAISFTGALCIPGVVEFSLCLLFAKLVSYTFLYWLPLYISNVAHFDAKQAGDMSTLFDVGGIVGGIFAGLVSDYTGGRASTCCVMLIAAAPMLFLYNSIGQRNLGTTIGMLLLCGGLVNGPYALITTAVSADLGTHESLRGNSRALSTVTAIIDGTGSIGAALGPLLAGVIS 453          
BLAST of slc37a-2 vs. Ensembl Medaka
Match: slc37a1 (solute carrier family 37 member 1 [Source:NCBI gene;Acc:101171400])

HSP 1 Score: 167.548 bits (423), Expect = 5.711e-45
Identity = 144/455 (31.65%), Postives = 222/455 (48.79%), Query Frame = 2
Query:  155 FRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTN----NNTIVYPLKN--WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSR-GFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGS----------------------------KLYRYSRIQTVD---IVSENNSVIVEN-----FENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSV 1384
            F    +Y+++ F +TF  Y   H +RK  S VK    +  +       ++ ++ P  +  WK  +      + +  LG +D  F+  YA+G+Y SG IG+R    L L+ GM  S     +FG+   + IH  ++Y +V     NGL Q+TGWP+ VT + NWFG  R G  +GLW+    VGNI+G L+ A  +   +   F++P   +    +V    LI  P +  S                              Y++ + Q  D   ++ ++++ I                ISF   + IPGV+ +SL     KLV+Y F FWL  Y++   +     A  +S  +DVGGI+GG++ G+ISD +  R+    + L+L  P L  +       L  +I  L ++G ++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGSV
Sbjct:   14 FNKDQWYRALTFFLTFLLYTSFHLSRKPISIVKSELHKNCSAFGGQGPSSLLLRPDMDCSWKPFD----KKNYKELLGTMDYSFLCAYAVGMYLSGIIGERLPIRLYLTVGMLSSGFFTCLFGMGYIYNIHSLSFYIFVQVA--NGLVQTTGWPSVVTCIGNWFGKGRRGLIMGLWNSHTSVGNILGSLIAAYWVSSNWGLSFIIPGLIIMAMGVVCFLFLIEHPNDLRSIHAQNLPPGVQSVPAKCWSGANGHTQVYLQYKHHKNQGCDTELLLPQDDACIPLQPVMVVKSGAEPSAISFMGALRIPGVVEFSLCLLFAKLVSYTFLFWLPLYITKAAHLDAKRAGDLSTLFDVGGIVGGVLAGVISDKLGKRATTCAVMLLLAAPTLYGFSMISQFGLGPTIGMLLVSGALVNGPYALITTAVSADLGTHKSLKGNARALSTVTAIIDGTGSV 462          
BLAST of slc37a-2 vs. Ensembl Medaka
Match: slc37a1 (solute carrier family 37 member 1 [Source:NCBI gene;Acc:101171400])

HSP 1 Score: 160.614 bits (405), Expect = 8.607e-43
Identity = 144/430 (33.49%), Postives = 216/430 (50.23%), Query Frame = 2
Query:  167 HFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTN----NNTIVYPLKN--WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEW-IHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSR-----IQTVD-----IVSENNSVIVENFENKNEQYISFWKI-----ILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSI-YLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSV 1384
             +Y+++ F +TF  Y   H +RK  S VK    +  +       ++ ++ P  +  WK  +      + +  LG +D  F+  YA+G+Y SG IG+R    L L+ GM  S     +FG+   + IH  ++Y +V     NGL Q+TGWP+ VT + NWFG   RG  +GLW+    VGNI+G L+ A  +   +   F++P   L   ++ VVC L      F   L    R      Q+ D     +  E   V V           S W+      + + GV+ +SL     KLV+Y F FWL  Y++   +     A  +S  +DVGGI+GG++ G+ISD +  R+    + L+L  P L  +       L  +I  L ++G ++ GP  LI++A+SADLG+   L GNA ALSTVT IIDGTGSV
Sbjct:   18 QWYRALTFFLTFLLYTSFHLSRKPISIVKSELHKNCSAFGGQGPSSLLLRPDMDCSWKPFD----KKNYKELLGTMDYSFLCAYAVGMYLSGIIGERLPIRLYLTVGMLSSGFFTCLFGMGYIYNIHSLSFYIFVQVA--NGLVQTTGWPSVVTCIGNWFGKGRRGLIMGLWNSHTSVGNILGSLIAAYWVSSNWGLSFIIP--GLIIMAMGVVCFLFLIEREFLLLLLLLQRRNCTSRQSADQQDPFLCGEKPCVFVVCLVPGGG---SPWRRANGGGVPLQGVVEFSLCLLFAKLVSYTFLFWLPLYITKAAHLDAKRAGDLSTLFDVGGIVGGVLAGVISDKLGKRATTCAVMLLLAAPTLYGFSMISQFGLGPTIGMLLVSGALVNGPYALITTAVSADLGTHKSLKGNARALSTVTAIIDGTGSV 436          
BLAST of slc37a-2 vs. Ensembl Medaka
Match: slc37a4a (solute carrier family 37 member 4 [Source:NCBI gene;Acc:101156517])

HSP 1 Score: 58.5362 bits (140), Expect = 1.081e-8
Identity = 56/218 (25.69%), Postives = 95/218 (43.58%), Query Frame = 2
Query:  164 FHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSR-GFWLGLWSGCACVGNIIGDL--LTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPE 808
            + +Y+S +F+  F  Y L + +RK+FS V P+  +E                    + L  D     LG++ +     YAI  + SG + DR     + S G+F+      + G+   +        +   +  NGL Q  GWP    I+  WF  S+ G W   W+  +C  N+ G L  + A+VL   Y +  ++  + +   ++ VVC L+ K E
Sbjct:    6 YGYYRSTIFLAMFVGYTLYYFSRKTFSFVMPSVMQE--------------------VKLDKDD----LGLITSSQSLAYAISKFISGVLSDRISARWLFSIGLFV------VGGINVVFSWSSTVAVFSALWFFNGLGQGLGWPPCGRILRKWFEPSQFGTW---WAVLSCSMNLAGSLGPIIATVLAESYSWRAIMWASGMTCVALSVVCLLVIKNE 190          
BLAST of slc37a-2 vs. Planmine SMEST
Match: SMESG000000703.1 (SMESG000000703.1)

HSP 1 Score: 891.723 bits (2303), Expect = 0.000e+0
Identity = 478/478 (100.00%), Postives = 478/478 (100.00%), Query Frame = 2
Query:  149 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAENPLSFPEIG 1582
            MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHFYNYYFYVVFYALNGLFQSTGWPATVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDVGGIIGGIVIGIISDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVFIFFMIMISITIVCILPVLVKDIIKRVNLHRKKNAENPLSFPEIG
Sbjct:    1 MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHFYNYYFYVVFYALNGLFQSTGWPATVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDVGGIIGGIVIGIISDFMWSRSPVTVLSLILTIPALVVYRNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVFIFFMIMISITIVCILPVLVKDIIKRVNLHRKKNAENPLSFPEIG 478          
BLAST of slc37a-2 vs. Planmine SMEST
Match: SMESG000001052.1 (SMESG000001052.1)

HSP 1 Score: 176.792 bits (447), Expect = 2.562e-48
Identity = 150/445 (33.71%), Postives = 229/445 (51.46%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTIVYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGH-SRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSE---------------NNSVIVENFENKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLS-MNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMW-----------SRSPVTVLSLILTIPALVVYRNAPGDVLTNSIY-LTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLI 1420
            ++S + I+TF  Y   H +RK  S VK    +     N  +      NWK    F GND +Q  LG L+  ++  YA  ++ASG++ +R +    L+ GM  S +    FG L  ++  +N+ FY++   + G+ Q+TGWPA VTIM NWFG   RG  +G+W+     GN+IG ++    +   + Y F+VP   +    IVV   +I  PE+ G       +   VD+ S                +   ++   + K+++ IS W+ + IP VI YS A    KLV+Y F +WL +YL+ +    T   A  +S  +D+GGI GG++ G  SD +W            RS    + LIL  P + +Y+    D    S + L I G+++ GP  LI++A+SADLGS+     ++ AL+TVT IIDGTGS+GAA+G     LI
Sbjct:   23 HQSFILILTFICYTTFHMSRKPISIVKSVLHKT-CPYNPESKDEFWCNWKP---FDGNDWSQK-LGSLEYAYLLAYAFFMFASGHLAERINLRYYLAIGMISSGLMTCCFG-LGYFMSNHNFMFYLIVQTITGITQATGWPAVVTIMGNWFGKGRRGLIMGIWNSHTSFGNVIGSIIAGMFVSTAWGYSFVVPGLIMVFIGIVVWLIMIPYPEDIGLSSPDDQKSLVVDLKSSLDLNDDKGRVLKSHGSTKPLLPYHDRKSDKPISIWEALKIPNVIAYSFALFFAKLVSYTFLYWLPNYLNRVGQGMTPKMAGNLSTLFDIGGIFGGVLAGFASD-IWLISSSKPSSSNGRSGTCAVMLILAAPMMFLYQYVAADQSYFSYFLLIICGLLVNGPYALITTAVSADLGSQN-GKHDSRALATVTAIIDGTGSLGAALGPFLTGLI 459          
BLAST of slc37a-2 vs. Planmine SMEST
Match: SMESG000016731.1 (SMESG000016731.1)

HSP 1 Score: 172.555 bits (436), Expect = 6.775e-47
Identity = 160/502 (31.87%), Postives = 252/502 (50.20%), Query Frame = 2
Query:  173 YKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWT--GTNNNTIVYPLKN----WKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDPTLVLSAGMFLSSISIFIFGVLTEWIHXXXXXXXXXXXALNGLFQSTGWPATVTIMSNWFGHSR-GFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVPCAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVE-------------------NFENKNEQY-------------ISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWTNAAADTISIWYDXXXXXXXXXXXXXSDFMWSRSPVTVLSLILTIPALVVYRNAPG--DVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALSTVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVXXXXXXXXSITIVCILPVLVKDIIKRVNLHRKKNAE 1555
            YK V+F  T   Y   H  RK  S VK    E  T      + IV P  N    WK        D+    LG LD  ++  YA+ ++ SG+I +R +    L+ GMFL  +S  +FG L  ++  +NYY+Y+      G+ Q++GWP  V+ M NWFG  R GF +GLW+    +GNI+G ++ A+ ++  +   F+VP A +    I+V   L   PE+ G     ++  QT +++   +S +                     ++E+ N +              ISF + +LIPGVI YSL     KLV+Y F FWL   +       +  +  +S   D GGI+GGI+ GII+D   + S +T   +++     +      G   +    I L   GI++ GP  LI++A+SADLG+   L GNA A++TVT IIDGTGS+GAA+G +   L+  R+ W+++FI  MI  ++  + +   + K+I   V +H+++  +
Sbjct:   25 YKVVIFFFTLLIYTTFHMTRKPISVVKSVLHENCTDKAAKEHKIVTPDNNTFCDWKP----FDKDNWSELLGNLDLAYLLAYAVSMFCSGHIAERVNIRYFLTIGMFLCGLSTSLFG-LGFYLQIHNYYYYLFVQIFAGMVQASGWPTVVSCMGNWFGKKRRGFLMGLWNAHTSLGNILGAIIAAAFVETAWGLSFIVPGAIIIGMGIIVFLFLTPYPEDVGC----HTAPQTGELLGSMHSAVAVIYAGSSSQSQSLDSSISTLDYESVNRETQPILSKKLEIQSNISFLQALLIPGVIEYSLCLFFAKLVSYTFLFWLPTLIKNTGTLDSKDSANLSAIMDAGGILGGIIAGIINDLTGA-SALTCSGMLVIAVPYLYVYYLYGSTQMAATIILLLFLGILVNGPYALITTAVSADLGTHDTLMGNARAIATVTAIIDGTGSLGAALGPLLTGLLLTRYGWKSIFIMLMIATALAAILLTRRVFKEI---VIIHKQRKEK 513          
The following BLAST results are available for this feature:
BLAST of slc37a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC37A31.148e-12748.65solute carrier family 37 member 3 [Source:HGNC Sym... [more]
SLC37A32.380e-11847.40solute carrier family 37 member 3 [Source:HGNC Sym... [more]
SLC37A31.688e-8848.16solute carrier family 37 member 3 [Source:HGNC Sym... [more]
SLC37A33.649e-5451.83solute carrier family 37 member 3 [Source:HGNC Sym... [more]
SLC37A26.823e-5432.79solute carrier family 37 member 2 [Source:HGNC Sym... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T11G6.29.782e-11446.22pep chromosome:WBcel235:IV:10855497:10858184:-1 ge... [more]
T11G6.29.782e-11446.22pep chromosome:WBcel235:IV:10855485:10858063:-1 ge... [more]
T11G6.21.617e-11346.22pep chromosome:WBcel235:IV:10855497:10858559:-1 ge... [more]
T11G6.44.969e-10643.76pep chromosome:WBcel235:IV:10849749:10851933:-1 ge... [more]
T11G6.34.142e-9642.79pep chromosome:WBcel235:IV:10852669:10855366:-1 ge... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MFS162.957e-5031.03gene:FBgn0034611 transcript:FBtr0071589[more]
MFS162.957e-5031.03gene:FBgn0034611 transcript:FBtr0342884[more]
MFS162.957e-5031.03gene:FBgn0034611 transcript:FBtr0071591[more]
MFS161.795e-4931.03gene:FBgn0034611 transcript:FBtr0071590[more]
back to top
BLAST of slc37a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01071848.11.073e-12546.64solute carrier family 37 member 3 [Source:NCBI gen... [more]
CABZ01071848.15.650e-11947.15solute carrier family 37 member 3 [Source:NCBI gen... [more]
CABZ01071848.11.375e-11243.38solute carrier family 37 member 3 [Source:NCBI gen... [more]
CABZ01071848.19.661e-10947.99solute carrier family 37 member 3 [Source:NCBI gen... [more]
slc37a22.048e-5635.16solute carrier family 37 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colec122.960e-13146.86collectin subfamily member 12 [Source:Xenbase;Acc:... [more]
colec123.083e-13047.22collectin subfamily member 12 [Source:Xenbase;Acc:... [more]
slc37a24.990e-5734.09solute carrier family 37 (glucose-6-phosphate tran... [more]
slc37a23.734e-5636.14solute carrier family 37 (glucose-6-phosphate tran... [more]
slc37a28.569e-5536.28solute carrier family 37 (glucose-6-phosphate tran... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc37a38.147e-13349.48solute carrier family 37 (glycerol-3-phosphate tra... [more]
Slc37a21.176e-5633.27solute carrier family 37 (glycerol-3-phosphate tra... [more]
Slc37a21.210e-5635.36solute carrier family 37 (glycerol-3-phosphate tra... [more]
Slc37a19.078e-5434.11solute carrier family 37 (glycerol-3-phosphate tra... [more]
Slc37a19.078e-5434.11solute carrier family 37 (glycerol-3-phosphate tra... [more]
back to top
BLAST of slc37a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17QZ3|SPX3_BOVIN6.270e-13348.02Sugar phosphate exchanger 3 OS=Bos taurus OX=9913 ... [more]
sp|Q640L2|SPX3_XENLA7.759e-13246.81Sugar phosphate exchanger 3 OS=Xenopus laevis OX=8... [more]
sp|Q3TIT8|SPX3_MOUSE1.541e-13149.48Sugar phosphate exchanger 3 OS=Mus musculus OX=100... [more]
sp|Q8NCC5|SPX3_HUMAN5.515e-12748.65Sugar phosphate exchanger 3 OS=Homo sapiens OX=960... [more]
sp|Q5F3N0|SPX3_CHICK4.165e-12548.05Sugar phosphate exchanger 3 OS=Gallus gallus OX=90... [more]
back to top
BLAST of slc37a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKG70.000e+0100.00Slc37a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3I2T82.543e-13451.05sugar phosphate exchanger 3 OS=Lingula unguis OX=7... [more]
S7N7R54.449e-13248.54Sugar phosphate exchanger 3 OS=Myotis brandtii OX=... [more]
H0XL991.511e-13148.54Solute carrier family 37 member 3 OS=Otolemur garn... [more]
G1NV272.893e-13148.64MFS domain-containing protein OS=Myotis lucifugus ... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048898.17.064e-12647.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000017725.22.744e-12346.25pep primary_assembly:Astyanax_mexicanus-2.0:7:8528... [more]
slc37a23.894e-5338.19solute carrier family 37 member 2 [Source:NCBI gen... [more]
slc37a11.167e-4932.97solute carrier family 37 member 1 [Source:NCBI gen... [more]
slc37a11.125e-4831.81solute carrier family 37 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002627.13.447e-12043.98pep scaffold:Pmarinus_7.0:GL477247:54318:68321:1 g... [more]
ENSPMAT00000001353.19.769e-11144.11pep scaffold:Pmarinus_7.0:GL476510:345174:359517:-... [more]
ENSPMAT00000009328.13.396e-3345.71pep scaffold:Pmarinus_7.0:GL487250:2:5046:1 gene:E... [more]
ENSPMAT00000002283.12.966e-2332.55pep scaffold:Pmarinus_7.0:GL495858:1:3647:-1 gene:... [more]
ENSPMAT00000006648.18.159e-1336.50pep scaffold:Pmarinus_7.0:GL489687:3729:6815:-1 ge... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc37a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO469811.798e-12348.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487521.262e-822.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc37a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013862.28.287e-12546.27solute carrier family 37 member 3 [Source:NCBI gen... [more]
slc37a22.040e-5434.01solute carrier family 37 member 2 [Source:NCBI gen... [more]
slc37a15.711e-4531.65solute carrier family 37 member 1 [Source:NCBI gen... [more]
slc37a18.607e-4333.49solute carrier family 37 member 1 [Source:NCBI gen... [more]
slc37a4a1.081e-825.69solute carrier family 37 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc37a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000000703.10.000e+0100.00SMESG000000703.1[more]
SMESG000001052.12.562e-4833.71SMESG000001052.1[more]
SMESG000016731.16.775e-4731.87SMESG000016731.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30001122
GenBankAKN21658.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001122 ID=SMED30001122|Name=slc37a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1708bp
CAAATTTTAGAAACATCCTATGAATCCCTTTAGTGTTATATTTTTAAAAT
AAATTAGTAAATTTTGAAAATTTTCTACTGCTAATAAGATATTCTTTATA
ATTCTTTATATTTTTGGAGGTTTTTCTAAATCAATTATATGTCAAAAAAT
GAAATTCAGATTGTTTCATTTCTATAAATCTGTTGTTTTTATTGTTACAT
TTTTTGCTTATGGTCTACTTCACGCCAATCGAAAGTCATTTTCTAATGTA
AAACCGACATTCACTGAGGAATGGACAGGAACAAATAACAATACAATTGT
CTATCCTCTGAAAAATTGGAAGCGGAACAATTTATTTTTGGGAAATGATT
CTGCCCAAGTCTTTCTTGGTGTTTTGGATACGGTGTTTATGGGATTTTAT
GCGATTGGGTTGTATGCTAGTGGGTATATAGGGGATAGGTATGATCCAAC
TTTAGTTCTGAGCGCGGGAATGTTTTTGAGTTCAATTTCCATATTTATAT
TTGGTGTCCTGACAGAATGGATTCACTTTTATAATTATTATTTTTACGTC
GTGTTTTATGCACTGAATGGACTATTTCAGTCAACCGGATGGCCAGCAAC
AGTTACGATAATGTCTAATTGGTTCGGTCATTCGCGAGGATTTTGGTTGG
GTTTATGGAGTGGATGCGCATGCGTGGGCAATATCATTGGTGATTTGCTG
ACGGCATCTGTACTAGATTTCGGATACGAATACGGATTTCTCGTGCCTTG
CGCTGCATTATTTACTGGGTCTATTGTTGTCGTTTGTAGTCTAATTGCAA
AACCAGAAAATTTTGGCTCTAAACTCTATAGATATAGTCGAATACAAACC
GTAGATATTGTCAGTGAAAATAATTCGGTAATCGTTGAAAATTTCGAAAA
CAAAAACGAACAATATATAAGCTTTTGGAAGATAATTCTTATTCCCGGAG
TTATTCCATATTCTTTAGCGTATGCTTGTCTGAAATTGGTTAATTATGCC
TTCTTTTTTTGGCTTGCGGACTATCTGTCGATGAATTTCAATTGGACAAA
TGCAGCAGCCGATACGATTTCTATTTGGTATGACGTAGGAGGCATTATAG
GGGGCATTGTGATTGGAATCATTTCTGACTTTATGTGGTCTCGTTCACCA
GTGACAGTTTTAAGTTTAATTTTAACTATACCCGCTTTAGTTGTATATAG
AAATGCCCCGGGTGATGTTTTGACGAATTCCATTTATTTGACAATTACTG
GAATTGTCATTGGCGGTCCGGCCACTTTGATTAGTTCCGCAATTTCTGCG
GATTTAGGTAGTGAACCTTTGCTCAGCGGGAATGCCGCCGCGTTGTCAAC
CGTAACAGGAATCATTGATGGAACCGGGAGTGTCGGAGCAGCCATTGGCC
AAGTTTGTGTACCTCTCATACAAAATCGATTTCAATGGCAAGCTGTTTTC
ATATTTTTTATGATTATGATAAGCATTACAATTGTCTGCATTCTGCCAGT
TCTTGTAAAGGACATAATAAAACGCGTCAATCTTCATCGTAAGAAAAATG
CAGAAAATCCGTTATCATTTCCAGAAATCGGTTGATTAAAAACAAATGTT
ATTTTTATTGTAATTTTATTTCGTTAAATTTTAATTAATTTCATTTTTAA
TCACATGGAATAACATAATTTAATGGCGGATTAATTATATCACATGATTG
CAAAAAAA
back to top

protein sequence of SMED30001122-orf-1

>SMED30001122-orf-1 ID=SMED30001122-orf-1|Name=SMED30001122-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=479bp
MKFRLFHFYKSVVFIVTFFAYGLLHANRKSFSNVKPTFTEEWTGTNNNTI
VYPLKNWKRNNLFLGNDSAQVFLGVLDTVFMGFYAIGLYASGYIGDRYDP
TLVLSAGMFLSSISIFIFGVLTEWIHFYNYYFYVVFYALNGLFQSTGWPA
TVTIMSNWFGHSRGFWLGLWSGCACVGNIIGDLLTASVLDFGYEYGFLVP
CAALFTGSIVVVCSLIAKPENFGSKLYRYSRIQTVDIVSENNSVIVENFE
NKNEQYISFWKIILIPGVIPYSLAYACLKLVNYAFFFWLADYLSMNFNWT
NAAADTISIWYDVGGIIGGIVIGIISDFMWSRSPVTVLSLILTIPALVVY
RNAPGDVLTNSIYLTITGIVIGGPATLISSAISADLGSEPLLSGNAAALS
TVTGIIDGTGSVGAAIGQVCVPLIQNRFQWQAVFIFFMIMISITIVCILP
VLVKDIIKRVNLHRKKNAENPLSFPEIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR000849Sugar_P_transporter
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
GO:0008643carbohydrate transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005829cytosol
GO:0016020membrane
GO:0030176integral component of endoplasmic reticulum membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 257..459
e-value: 8.8E-31
score: 108.8
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 5..225
e-value: 1.9E-33
score: 117.6
NoneNo IPR availablePANTHERPTHR43184FAMILY NOT NAMEDcoord: 10..459
NoneNo IPR availablePANTHERPTHR43184:SF7SUGAR PHOSPHATE EXCHANGER 3coord: 10..459
NoneNo IPR availableCDDcd17342MFS_SLC37A3coord: 10..452
e-value: 0.0
score: 574.262
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 166..188
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
NoneNo IPR availableTMHMMTMhelixcoord: 333..350
NoneNo IPR availableTMHMMTMhelixcoord: 195..217
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
NoneNo IPR availableTMHMMTMhelixcoord: 268..290
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 129..151
IPR000849Sugar phosphate transporterPIRSFPIRSF002808Hexose_phosphate_transpcoord: 1..469
e-value: 6.5E-111
score: 368.9
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 18..383
e-value: 2.0E-25
score: 89.5
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 13..456
score: 13.589
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 4..452