cilia- and flagella-associated protein 44-like

Overview
Namecilia- and flagella-associated protein 44-like
Smed IDSMED30001116
Length (bp)5778
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 44-like (SMED30001116) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 44-like (SMED30001116) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 44-like (SMED30001116) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 44-like (SMED30001116) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001116

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001116SMESG000022927.1 SmedASXL_018384SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30001116SMESG000022927.1 SmedASXL_018383SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30001116SMESG000022927.1 dd_Smed_v6_8760_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30001116SMESG000022927.1 dd_Smed_v4_8760_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Human
Match: CFAP44 (cilia and flagella associated protein 44 [Source:HGNC Symbol;Acc:HGNC:25631])

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 551/1414 (38.97%), Postives = 842/1414 (59.55%), Query Frame = 1
Query:  304 IPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPN--PSSVDHS-KTYELREIEPINSYKFVSIKS-VXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNL-EKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAK-TVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSD-EYFQILSDLER--IRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLK-------KLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIK---KTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEE--NSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAED-PTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYL 4473
            I E F+YDY E  S PF++ +S +P +++ L HSFGY+C+KR NL LLD     YI+GN + F+NL      YLRS SGEGIG + VHP K Y  V EK   S P   IYEYPSL+ YR+LRDGTEK Y+Y  FN SG LLA+VGS+PD+ LT+W WK EQ +LR+KAFSQ++++V ++ D E  LTT+G+GHI+FW+MA TFTGLKLQG +G+FGKT  +DIEG++ LPDGKVLSGSEWGNML+W+G LIKV++ R   K CH+G INQI++ EGE++T+G+DG +  WDFETIDTA+V +E    E++P+NEL V  +  L  ++K  ET ++ W AQD NG IWKLDLSFS+ +  PE L +FHSG I    VSPL+YL A+   D S+R++DFA++  +A+MKF   G+ ++W P  V+  G  +I GF DGV+RIL     + L     +K     +I L Q  KPHT  +T+L+ +  G+IL TGS+D+TVFFF +   +Y PIG++    P+  + W       P+     +++    G + E   P       DH   +YE++++  I  + F S+KS +LR  E  +++R  E + +    +  K   E G + E+E  ++ EE E+   EE    E ++P  P   SPIL GF   ++  KFW+S+G YD+G+LY CEFP  D+ +  K  E+ +EPI+   L ++ D P+ ++ ++ +   +  G +NG+IR+  L +    L ++   W +++HDNNYG I S+  S+D++FLV+ G DGN FV+ I  E +  K +   +A++PS +  ++++   +DIEDP AYSIE  ++K E+D+ ++   E KA   ++I  L+ +F NL + N+KLPK +Q     F++  ++R ++ R    KIQ V K++A++ EKH + L KL+ RFR+PLE D IV+HAI S+H +S+ +    S    F+  S  ER   + D   K+          A  +  +Q   + + E GK      K+  K    + V  Q++       K +  + K   RK +W+ LY  KP +++EDP+D+ AI+EA+  MGDF LK++ DY + E  R NA K  +EL  +++ +   +   N  IL LR+ K  ++E I+   +  K I+   ++ K    P +P   I+P+E PEK+F+Y +ETL+ FK++  + K     G E   S      F K S+ + G   T+      S+  T + D P  +  E   P  V  ++ +      ++K +Y+ + ++N   + +  FD +L+LLRH+K      ++ + L  +T+F+E  LLK +EK E  L E+      E+  +  K+ E   +++ KK +I +L E+++  +  F+ ++GENNKFA +L
Sbjct:  105 ISESFFYDYMELASMPFVTLDSNIPLDLLTLVHSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEK--GSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRGTSKSCHNGPINQIMLYEGEVITVGSDGYVRIWDFETIDTADVIDETGLLEIEPINELQVDKNVNLFSMIKMNETGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGAIEAVAVSPLTYLMATTALDCSVRIYDFASKTPLAQMKFKQGGTALVWVPRMVNFTGAQIIVGFEDGVVRILELYDPKGLTIFAGRKKILDADIQLKQVFKPHTACVTALAYERDGEILATGSKDQTVFFFEVE-RDYKPIGYINTPGPVCQLMWSPM--SHPE---STLLIICENGYILEAPLPTIKQEEDDHDVVSYEIKDM-CIKCFHFSSVKSKILRLIEIEKRERQRELKEKIREERRNKLAAEMGEDGEKEFQEEEEEKEEEEEEEEPLPEIFIPSTP---SPILCGFY--SEPGKFWVSLGGYDSGFLYHCEFPPCDESSDFK--EQKDEPIDVRYLADTEDNPIQTITFNINKVMMFCGMKNGAIRVYVLNQNDPSLTSLVDYWHFNMHDNNYGCIKSIANSFDDRFLVTAGADGNIFVFNIFSEFMLRKDM---KAKVPSPRFGIETEPIPEDIEDPKAYSIENARRKREHDKLMKEVGEIKARKREQIKALRSEFCNLLEMNEKLPKHMQFKRTDFDVDSQIRAEMHRKTAFKIQQVEKELAWEKEKHELGLMKLKNRFRDPLESDTIVVHAILSDHKISSYRLVQPSKYSKFKRASQSERKPSKLDRFEKEGPGRKDSQRDAGGSVTIQE--ESIIEKGK------KFRPKTLSEIIVENQIEKTRKLILKAERAQLKIQQRKKEWEELYKSKPGDDYEDPKDLQAIKEAQVYMGDFNLKTAPDYKIPEHMRINAAKKEEELGHLDSLVHGNKRHMNKCILSLRDLKVAVVEEIQCLVQELKNIQSTLHISKHIPIPKIPQ--IHPEEVPEKRFQYDEETLLNFKQQQMKSKDEKSPGVEQTGSGGPVGGFLKLSSRKDGDLTTRDSISRSSKASTFSLDIPKCLEFEKAEPTDVELEIMKR----DEIKHVYMQQYLVNRIKELVVTFDAELRLLRHQKLKLDTQMKLSDLHHVTLFQEILLLKNFEKQENILQERVNSLDKEEQYMQWKINETLKEMEEKKNEITKLQEQEKALYAGFQAAIGENNKFANFL 1485          

HSP 2 Score: 141.739 bits (356), Expect = 8.139e-33
Identity = 112/310 (36.13%), Postives = 182/310 (58.71%), Query Frame = 1
Query: 4660 VYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISK--LNQLVHIQAQELDALKEEIGMLSRKGGHILPPM 5583
            V+D  +CP  C   L++    LRE  LDIEE + EEKK+ + LKKE + L+KK K+V   L  A++ LEA+Q EKQQ+LN+L  ++ LKLHQI     G +PSD+   L+F     + L+ RI +LQ+E  KQ    K+ + R  +L + ++   + I + +    ++M +KFG++ NLE ++ + +N  +EEL  + L  +     E   WE++I   + + + + K +T  L  + +L  EK+ L+ +LN+ Q   G  FQ  GP   + +++  + +L+ +QA+ + ALKEEI +L RKG  ILPP+
Sbjct: 1534 VFDDSICPTNCDVALFELALHLREKRLDIEEALVEEKKIVDNLKKEYDTLSKKVKIVATNLNAAEEALEAYQREKQQRLNELLVVIPLKLHQIEYVVFGEIPSDLSGTLVFSNHALRRLQERIHELQEENSKQQKLNKEWRERRKQLIREKREMTKTIHKMEETVRQLMISKFGRVVNLEALQTLSVNTTLEELKIRKLRKELANAKEMKMWEEKIAQMRWELMMKTKEHTRKLYQMNDLCIEKKKLDSRLNTLQNQQGNAFQ--GPREADVVAREEVTELIQLQAERISALKEEIALLRRKGSLILPPI 1841          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Human
Match: CFAP44 (cilia and flagella associated protein 44 [Source:HGNC Symbol;Acc:HGNC:25631])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 392/891 (44.00%), Postives = 571/891 (64.09%), Query Frame = 1
Query:  304 IPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPN--PSSVDHS-KTYELREIEPINSYKFVSIKS-VXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEK--PFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAK-TVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQI 2949
            I E F+YDY E  S PF++ +S +P +++ L HSFGY+C+KR NL LLD     YI+GN + F+NL      YLRS SGEGIG + VHP K Y  V EK S   P   IYEYPSL+ YR+LRDGTEK Y+Y  FN SG LLA+VGS+PD+ LT+W WK EQ +LR+KAFSQ++++V ++ D E  LTT+G+GHI+FW+MA TFTGLKLQG +G+FGKT  +DIEG++ LPDGKVLSGSEWGNML+W+G LIKV++ R   K CH+G INQI++ EGE++T+G+DG +  WDFETIDTA+V +E    E++P+NEL V  +  L  ++K  ET ++ W AQD NG IWKLDLSFS+ +  PE L +FHSG I    VSPL+YL A+   D S+R++DFA++  +A+MKF   G+ ++W P  V+  G  +I GF DGV+RIL     + L     +K     +I L Q  KPHT  +T+L+ +  G+IL TGS+D+TVFFF +   +Y PIG++    P+  + W       P+     +++    G + E   P       DH   +YE++++  I  + F S+KS +LR  E  +++R  E + +    +  K   E G + E+E  ++ EE E+   EE    E ++P  P   SPIL GF   ++  KFW+S+G YD+G+LY CEFP  D+ +  K  E+ +EPI+   L ++ D P+ ++ ++ +   +  G +NG+IR+  L +  P  L ++   W +++HDNNYG I S+  S+D++FLV+ G DGN FV+ I  E +  K +   +A++PS +  ++++   +DIEDP AYSIE  ++K E+D+ ++   E KA   ++I  L+ +F NL + N+KLPK +Q 
Sbjct:  105 ISESFFYDYMELASMPFVTLDSNIPLDLLTLVHSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEKGSF--PDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRGTSKSCHNGPINQIMLYEGEVITVGSDGYVRIWDFETIDTADVIDETGLLEIEPINELQVDKNVNLFSMIKMNETGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGAIEAVAVSPLTYLMATTALDCSVRIYDFASKTPLAQMKFKQGGTALVWVPRMVNFTGAQIIVGFEDGVVRILELYDPKGLTIFAGRKKILDADIQLKQVFKPHTACVTALAYERDGEILATGSKDQTVFFFEVE-RDYKPIGYINTPGPVCQLMWSPM--SHPE---STLLIICENGYILEAPLPTIKQEEDDHDVVSYEIKDM-CIKCFHFSSVKSKILRLIEIEKRERQRELKEKIREERRNKLAAEMGEDGEKEFQEEEEEKEEEEEEEEPLPEIFIPSTP---SPILCGFY--SEPGKFWVSLGGYDSGFLYHCEFPPCDESSDFK--EQKDEPIDVRYLADTEDNPIQTITFNINKVMMFCGMKNGAIRVYVLNQNDP-SLTSLVDYWHFNMHDNNYGCIKSIANSFDDRFLVTAGADGNIFVFNIFSEFMLRKDM---KAKVPSPRFGIETEPIPEDIEDPKAYSIENARRKREHDKLMKEVGEIKARKREQIKALRSEFCNLLEMNEKLPKHMQF 975          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Human
Match: EML6 (EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412])

HSP 1 Score: 107.842 bits (268), Expect = 1.500e-22
Identity = 138/593 (23.27%), Postives = 248/593 (41.82%), Query Frame = 1
Query:  130 INNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLA--HSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMA-DTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            ++N M + A   +GG+  + ++EE+  DS +  V     +   E +IN+ RQ  KE+   +P+      E+  + PF+  E   P + +KL   H + GY+C  R+NL       + Y I+   + +         YL     + I  + +HP K Y+A G+   D+     +++  +LK   +L+   ++      F+  G+ L +VG D    +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+ A   FT  +  G  G  GK E      +  + D  V SG+  G++ +W   L+   +        H G +  +   +   +T G DG +  WD  FE       A + +         LL  N +     +++             NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A+  M  ++   +G +         P GK +  G +DG   ++N   V         + +   H       H K++ S    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  598 VSNGMLETAPQ-EGGA--DSYSEES--DSDLSDVPELDSDIEQEAQINYDRQVYKED---LPQLKQQSKEKNHAVPFLKREKA-PEDSLKLQFIHGYRGYDC--RNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGH--DDDILSLTIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKR--GTFGSVGKLETMMCVSYGRMED-LVFSGAATGDIFIWKDILLLKTV------KAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERC-LKTYAIKRSALSTSSKGLLLEDNPS-----IRAITLGHGHILVGTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSAQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVNADTV---------EDMVSFH-------HRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 97.0561 bits (240), Expect = 3.332e-19
Identity = 115/508 (22.64%), Postives = 203/508 (39.96%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEW 1869
            P   ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP K  +A G+   +  P   I++  +++   +L+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       + + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D +L+   +  E    I   +D                 P  IL     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +   P G  +  G  DG   V+R+ + ++V              +H+    K   + I  +     G  L  GS D  V  +++    Y  IG   K    I H++W
Sbjct:    7 PRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDKTLVATGQVGKE--PYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDITYSGALNGDIYVWKG----LNLVRTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKAD-RLLAGTQDSEIFEVIVRERD----------------KPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFSPDGSQLALGMKDGSFIVLRVRDMTEV--------------VHI----KDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAV-AQRYKKIGECSKSLSFITHIDW 459          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Human
Match: EML6 (EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412])

HSP 1 Score: 107.457 bits (267), Expect = 2.424e-22
Identity = 138/593 (23.27%), Postives = 248/593 (41.82%), Query Frame = 1
Query:  130 INNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLA--HSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMA-DTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            ++N M + A   +GG+  + ++EE+  DS +  V     +   E +IN+ RQ  KE+   +P+      E+  + PF+  E   P + +KL   H + GY+C  R+NL       + Y I+   + +         YL     + I  + +HP K Y+A G+   D+     +++  +LK   +L+   ++      F+  G+ L +VG D    +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+ A   FT  +  G  G  GK E      +  + D  V SG+  G++ +W   L+   +        H G +  +   +   +T G DG +  WD  FE       A + +         LL  N +     +++             NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A+  M  ++   +G +         P GK +  G +DG   ++N   V         + +   H       H K++ S    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  598 VSNGMLETAPQ-EGGA--DSYSEES--DSDLSDVPELDSDIEQEAQINYDRQVYKED---LPQLKQQSKEKNHAVPFLKREKA-PEDSLKLQFIHGYRGYDC--RNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGH--DDDILSLTIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKR--GTFGSVGKLETMMCVSYGRMED-LVFSGAATGDIFIWKDILLLKTV------KAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERC-LKTYAIKRSALSTSSKGLLLEDNPS-----IRAITLGHGHILVGTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSAQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVNADTV---------EDMVSFH-------HRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 96.2857 bits (238), Expect = 6.323e-19
Identity = 115/508 (22.64%), Postives = 203/508 (39.96%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEW 1869
            P   ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP K  +A G+   +  P   I++  +++   +L+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       + + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D +L+   +  E    I   +D                 P  IL     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +   P G  +  G  DG   V+R+ + ++V              +H+    K   + I  +     G  L  GS D  V  +++    Y  IG   K    I H++W
Sbjct:    7 PRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDKTLVATGQVGKE--PYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDITYSGALNGDIYVWKG----LNLVRTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKAD-RLLAGTQDSEIFEVIVRERD----------------KPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFSPDGSQLALGMKDGSFIVLRVRDMTEV--------------VHI----KDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAV-AQRYKKIGECSKSLSFITHIDW 459          

HSP 3 Score: 93.9745 bits (232), Expect = 3.106e-18
Identity = 111/497 (22.33%), Postives = 197/497 (39.64%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  R+NL  L D   + + +       NLS  S S+    + + I C+ V  HP K    V   +  + P   I++  +     +LR    K  +Y  F+ +G+LL +VG DP+  +TVW W+    V       + I+ V +  D +    + G  H++FW +A +   L  +G IG  G  ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++           +L+  V+S             +G+I    +     +A   IL   H  GEI      P   L  S  +DG+ R++D A +KL+ ++          ++     P G+ V  G  +G  VI ++N  +V      +KS                  I  +      + L  GS + TV F+ +     L  IG+ K
Sbjct: 1363 LALDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDD-ILCLTVNQHP-KYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSAL-LYKKGVIGSLGAAKMQTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLET---------GQLVECVRSVCRGKGKILVGTKDGEI----IEVGEKNAASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYS-----PDGEMVAIGMKNGEFVILLVNSLKVWGKKRDRKS-----------------AIQDIRISPDNRFLAVGSSEHTVDFYDLTQGTNLNRIGYCK 1812          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Human
Match: EML6 (EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412])

HSP 1 Score: 107.457 bits (267), Expect = 2.424e-22
Identity = 138/593 (23.27%), Postives = 248/593 (41.82%), Query Frame = 1
Query:  130 INNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLA--HSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMA-DTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            ++N M + A   +GG+  + ++EE+  DS +  V     +   E +IN+ RQ  KE+   +P+      E+  + PF+  E   P + +KL   H + GY+C  R+NL       + Y I+   + +         YL     + I  + +HP K Y+A G+   D+     +++  +LK   +L+   ++      F+  G+ L +VG D    +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+ A   FT  +  G  G  GK E      +  + D  V SG+  G++ +W   L+   +        H G +  +   +   +T G DG +  WD  FE       A + +         LL  N +     +++             NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A+  M  ++   +G +         P GK +  G +DG   ++N   V         + +   H       H K++ S    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  598 VSNGMLETAPQ-EGGA--DSYSEES--DSDLSDVPELDSDIEQEAQINYDRQVYKED---LPQLKQQSKEKNHAVPFLKREKA-PEDSLKLQFIHGYRGYDC--RNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGH--DDDILSLTIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKR--GTFGSVGKLETMMCVSYGRMED-LVFSGAATGDIFIWKDILLLKTV------KAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERC-LKTYAIKRSALSTSSKGLLLEDNPS-----IRAITLGHGHILVGTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSAQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVNADTV---------EDMVSFH-------HRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 96.2857 bits (238), Expect = 6.323e-19
Identity = 115/508 (22.64%), Postives = 203/508 (39.96%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEW 1869
            P   ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP K  +A G+   +  P   I++  +++   +L+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       + + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D +L+   +  E    I   +D                 P  IL     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +   P G  +  G  DG   V+R+ + ++V              +H+    K   + I  +     G  L  GS D  V  +++    Y  IG   K    I H++W
Sbjct:    7 PRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDKTLVATGQVGKE--PYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDITYSGALNGDIYVWKG----LNLVRTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKAD-RLLAGTQDSEIFEVIVRERD----------------KPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFSPDGSQLALGMKDGSFIVLRVRDMTEV--------------VHI----KDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAV-AQRYKKIGECSKSLSFITHIDW 459          

HSP 3 Score: 93.9745 bits (232), Expect = 3.106e-18
Identity = 111/497 (22.33%), Postives = 197/497 (39.64%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  R+NL  L D   + + +       NLS  S S+    + + I C+ V  HP K    V   +  + P   I++  +     +LR    K  +Y  F+ +G+LL +VG DP+  +TVW W+    V       + I+ V +  D +    + G  H++FW +A +   L  +G IG  G  ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++           +L+  V+S             +G+I    +     +A   IL   H  GEI      P   L  S  +DG+ R++D A +KL+ ++          ++     P G+ V  G  +G  VI ++N  +V      +KS                  I  +      + L  GS + TV F+ +     L  IG+ K
Sbjct: 1363 LALDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDD-ILCLTVNQHP-KYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSAL-LYKKGVIGSLGAAKMQTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLET---------GQLVECVRSVCRGKGKILVGTKDGEI----IEVGEKNAASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYS-----PDGEMVAIGMKNGEFVILLVNSLKVWGKKRDRKS-----------------AIQDIRISPDNRFLAVGSSEHTVDFYDLTQGTNLNRIGYCK 1812          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 75.485 bits (184), Expect = 3.943e-13
Identity = 66/302 (21.85%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEG--IGCMAVHPTKMYLAVGEKKSDS------PPVTAIYEYP--------------------SLKLYRIL-RDGTEKAYSYCQFNT--SGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIII-EEGELMTLGTDGKINTWDFE 1182
            P+  V L H + Y  +  R N+ +L    L + S N +  MN++    S  R   G    + C+ +HP K+ +A G+    S      P  T+  + P                    ++KL  ++  +G EK   +  F+   SG LLA V      +++VW W+  +     KA +  ++   W   +  ++   G GH  F+   D  TG+ ++      G+ +   +       + +V++G   G + +WD    K     K     H G +  + + + G++++ G D  ++ WD +
Sbjct:  276 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQ-RIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNY-DPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTT---KQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQ 572          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 75.485 bits (184), Expect = 3.943e-13
Identity = 66/302 (21.85%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEG--IGCMAVHPTKMYLAVGEKKSDS------PPVTAIYEYP--------------------SLKLYRIL-RDGTEKAYSYCQFNT--SGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIII-EEGELMTLGTDGKINTWDFE 1182
            P+  V L H + Y  +  R N+ +L    L + S N +  MN++    S  R   G    + C+ +HP K+ +A G+    S      P  T+  + P                    ++KL  ++  +G EK   +  F+   SG LLA V      +++VW W+  +     KA +  ++   W   +  ++   G GH  F+   D  TG+ ++      G+ +   +       + +V++G   G + +WD    K     K     H G +  + + + G++++ G D  ++ WD +
Sbjct:  276 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQ-RIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNY-DPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTT---KQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQ 572          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 75.0998 bits (183), Expect = 4.321e-13
Identity = 66/302 (21.85%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEG--IGCMAVHPTKMYLAVGEKKSDS------PPVTAIYEYP--------------------SLKLYRIL-RDGTEKAYSYCQFNT--SGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIII-EEGELMTLGTDGKINTWDFE 1182
            P+  V L H + Y  +  R N+ +L    L + S N +  MN++    S  R   G    + C+ +HP K+ +A G+    S      P  T+  + P                    ++KL  ++  +G EK   +  F+   SG LLA V      +++VW W+  +     KA +  ++   W   +  ++   G GH  F+   D  TG+ ++      G+ +   +       + +V++G   G + +WD    K     K     H G +  + + + G++++ G D  ++ WD +
Sbjct:  273 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQ-RIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNY-DPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTT---KQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQ 569          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 75.0998 bits (183), Expect = 4.321e-13
Identity = 66/302 (21.85%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEG--IGCMAVHPTKMYLAVGEKKSDS------PPVTAIYEYP--------------------SLKLYRIL-RDGTEKAYSYCQFNT--SGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIII-EEGELMTLGTDGKINTWDFE 1182
            P+  V L H + Y  +  R N+ +L    L + S N +  MN++    S  R   G    + C+ +HP K+ +A G+    S      P  T+  + P                    ++KL  ++  +G EK   +  F+   SG LLA V      +++VW W+  +     KA +  ++   W   +  ++   G GH  F+   D  TG+ ++      G+ +   +       + +V++G   G + +WD    K     K     H G +  + + + G++++ G D  ++ WD +
Sbjct:  273 PTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQ-RIYHGHTCDVKCITLHPNKILVASGQSSCHSVEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTLMVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNY-DPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTT---KQAHSVHPGGVYSLTLAKSGKILSGGKDRMVSEWDLQ 569          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Fly
Match: CG34124 (gene:FBgn0083960 transcript:FBtr0110838)

HSP 1 Score: 355.14 bits (910), Expect = 1.610e-98
Identity = 194/570 (34.04%), Postives = 314/570 (55.09%), Query Frame = 1
Query:  370 GLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYL-AVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSN-DAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEY-----LPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSK--TYELREIEPINSYKFVSIKS 2046
              P ++V + HSFGY+C+K  NL L+D  TL + SGN++ + ++S    S+  ++ G G+G +    HP    L  VGE  + + P   IYEYPSL +   L +  +  ++   +N +GEL A+    PDF++T+W W+N + VLR+K+F  DI  V +S     +L ++G  HI+FWKMA+TFTGLKL+GD+G+FGKT+ SDI    +L D  V+SGS+WGNML+W   LIK +I RK +KPCH+  I +I ++ GE+ T+G DG +  W +ET+D A+  E+    E+DP+ E  +++ + + M  +   +      YAQDGNG IW  D++       P  L +   G++    +SP+S     +   G L V+ +  ++L+ E +F  EG  ++W    +  KG  ++A F DG++R +        D+S   +   ++  ++A K HT  IT+L+      +L+TGS D+++F + ++  E+      P+GFV+     +   W  T   +P      ++V    G++ E         DH    +Y + E   +   KF SIKS
Sbjct:   23 SFPRDIVSVEHSFGYDCKKLFNLVLVDSDTLVFASGNFLNYFSISRQEISFQETVYGCGVGFITKNEHPDYTNLFTVGE--NGARPTVFIYEYPSLNVRVKLLNAAQNCFTAGSYNKTGELFASQAGYPDFIITIWRWENAEVVLRAKSFQSDILFVHFSEHNPILLCSSGLSHIKFWKMANTFTGLKLKGDLGRFGKTDFSDIYAMYMLQDENVISGSDWGNMLLWQAGLIKFEICRKGRKPCHTKPITRITMKNGEVTTVGMDGYVRVWYWETVDLADPPEDDLFVEIDPIYEFKIADVELRCMQKIHPFDESDFTHYAQDGNGGIWFCDINTYDVPQKPRKLYSCIGGKVLAAQMSPVSPHFLCMSESGKLFVYQYDEQRLILEKEFPAEGVDVIWLDTNISVKGTELVAAFKDGILRQMYL------DLSNGERP--KMTRVRAFKAHTSPITALTVSRNSSLLLTGSADKSIFIYQLSRDEHQMVDMRPLGFVQFAAIPNCFYWHET---EP----TVVLVGCKSGDLYEYNI-RTEVTDHETYLSYNITENSRMRHTKFASIKS 574          

HSP 2 Score: 168.318 bits (425), Expect = 3.733e-41
Identity = 267/1148 (23.26%), Postives = 485/1148 (42.25%), Query Frame = 1
Query: 2230 LPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRF-REPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLE-RIRQ--DMSNKDY----SKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETI-KKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSK----TVFATFNKQSNVE-SGLKPTKIFRPHISQQVTLAED-------PTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTET--------------MINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDE--ERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKG 5562
            +P +P  +  + Y     T  D  W+SM  YDAGY+Y+ EF +              EP     +  ++D+ + S  +    + +I G  NG IR+  +  P +   ++    Y +HD   G+I  + +SY  + L+++G DGN F+++     +   ++ +    LP   T     QI DIE P A S+E+ K  +E  R+   A       L KIG LQ  + ++   N++LP  ++       L  ++   +    + ++  V + +A+D E   +   KL   F +E ++    V     +   VST +   L +E+ QI  D+E R+++  DM   DY      + ++ +  P +F          +P  IE  F+K      + MR+  + +K      +R F    WD L  +KP  N   P D A IE+A+  +GDFKLK  +DY  E K      +   E++    + F +   FN  +L LR  K E+ + I  K N+   + N + +  ++P+ P   I  D       EY +  LIE        +   +   E+S        A     +NV    L    +   H     T+ +        P   LDE+L      SD     +L  D +  Y+ ET              +  E  +++R FD  L+ L+  ++   +          ++ +E  +L+  E+ E  L+   +   + + D+   +     +LD  +++ID+L E+  +  +    +  + +KF ++L +++K              K      +R +        S  SS  D+   +      D  T+  D   CP G  + LYD    +R    D+E  + E  +  E  +KE   +  K K  E    + K  L  F+  +QQ++N++    IL++ Q+    +G    D+  A++F+A    DL+ R ++L +E    K+ +    + LR  ++  + K  + +I+  + E  + M  KFG + NL+++E+ ++   I +L     D    +  E  E +  +   +E+ + E + NT  ++ +  L  E  IL   L+ + K+              +I KL  +      +++ L+ EI  L  K 
Sbjct:  632 IPTVPNAIIWLRY-----TLRDTIWVSMAGYDAGYIYELEFNAA-------------EPTRATIIAEADDIEIHS--YCIIDEFIIFGLHNGRIRINRI-NPDNFTDLSEFRIYPMHDGLKGTIPKIDISYSGEHLLTIGYDGNVFLHKWNGPKIVRNKVRDKLPPLPEGVT-----QIPDIE-PEACSLEQEKINAELRRQQEAADAHDRDVLSKIGALQNVYFDIIRINEELPPGLRAKDTDLLLDDRITRQIRNELQAELDDVREDLAYDLEFAQVGHTKLYNHFLKELVQVPFTVAPLRANVPGVSTFRLQALGEEHAQIKQDIEDRLKREHDMGLHDYVAPERSDESIGEPPPESFFFGR------DPKSIEPRFSK------KMMRLLTRYRKRQIFEVRRIF---DWDKLERQKPDPNRNHPDDDAQIEDAKRNLGDFKLKIGSDY--EPKSSETLTQKYIEVVECREQYFAMVDAFNQMVLDLRERKGELDQFITAKRNRLAVIHNYLPEPDRQPLDPIQEIDMD------LEYPELNLIEHYTPGCGVEIDDILTLEHSVDQVIARMAPMRSTANVSLFSLHGLDVPELHEHTAFTMLQISKLNRSLPNAELDEELLKLPPKSD-PAYFELNDDGQVPYMMETRHRWLRQLLVEQNAIRTEVDEEVRQFDKALEKLQVRRFHVKMDAEFMTAFMNSLNQELYILRDSEEIETQLLLNAKTAMSTRNDLQMVINSTNRQLDELRRNIDKLGEQ-IVALQVLFATTVKGHKFFDFLRRIFK-------------KKWRPPKVSRGDDESSSSSSSSSSSSEDEQADNKSLDSLDMTTIRLDEATCPTGLDRSLYDLAFSMRSDRHDLERNVRELTREVENKRKEIAEMQIKMKFHEEVYQREKNALLQFRRNRQQEVNKVHISAILRMDQLQHFYDGDDYRDLSKAILFDADMLVDLRRRADQLSEETLATKRWHRINFIHLR--RMNTDIKFMRFEITRLEEEIRQAMMKKFGIIVNLDELEEEVLRRYIFDLETNAEDELMALEKELLEKQKELARCEEELVLETQNNTEKVNIMTVLREENNILRTLLDIQNKNYAKWANPNALNLSYDIEKLRGIEKSLLDQIECLEREICALRLKS 1712          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0330139)

HSP 1 Score: 57.7658 bits (138), Expect = 1.134e-7
Identity = 69/284 (24.30%), Postives = 117/284 (41.20%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYN-CQKRDNLALLDQ-QTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKS---DSPPVTAIYEYPSLKLYRIL----RDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFW-KMADTFTGLKLQGDIGKFGKTEI------SDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLG-TDGKINTWD 1176
            P   ++L    GY     R NL +L   + L Y++   + F    D    Y  +   E I CM VHP++  +A G+K      S     I+   SL+   +      D    A ++ Q N    +LA V S  + +L+VW+W+    + +     + +   A+    + ++ T G GH+ FW +  D F           F +T+I      S +      PDG V++    G + ++  +       R   +  + G    I++ EG L++ G  D KI  WD
Sbjct:  248 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHY--TGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILA-VDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGF-----------FERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD 517          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 57.7658 bits (138), Expect = 1.234e-7
Identity = 69/284 (24.30%), Postives = 117/284 (41.20%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYN-CQKRDNLALLDQ-QTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKS---DSPPVTAIYEYPSLKLYRIL----RDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFW-KMADTFTGLKLQGDIGKFGKTEI------SDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLG-TDGKINTWD 1176
            P   ++L    GY     R NL +L   + L Y++   + F    D    Y  +   E I CM VHP++  +A G+K      S     I+   SL+   +      D    A ++ Q N    +LA V S  + +L+VW+W+    + +     + +   A+    + ++ T G GH+ FW +  D F           F +T+I      S +      PDG V++    G + ++  +       R   +  + G    I++ EG L++ G  D KI  WD
Sbjct:  473 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHY--TGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILA-VDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGF-----------FERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD 742          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 57.7658 bits (138), Expect = 1.311e-7
Identity = 68/277 (24.55%), Postives = 115/277 (41.52%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYN-CQKRDNLALLDQ-QTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKS---DSPPVTAIYEYPSLKLYRIL----RDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLG-TDGKINTWD 1176
            P   ++L    GY     R NL +L   + L Y++   + F    D    Y  +   E I CM VHP++  +A G+K      S     I+   SL+   +      D    A ++ Q N    +LA V S  + +L+VW+W+    + +     + +   A+    + ++ T G GH+ FW       G   + DI K  +   S +      PDG V++    G + ++  +       R   +  + G    I++ EG L++ G  D KI  WD
Sbjct:  473 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHY--TGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILA-VDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRK--DGFFERTDIVK--QPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD 742          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299510)

HSP 1 Score: 57.3806 bits (137), Expect = 1.405e-7
Identity = 69/284 (24.30%), Postives = 117/284 (41.20%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYN-CQKRDNLALLDQ-QTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKS---DSPPVTAIYEYPSLKLYRIL----RDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFW-KMADTFTGLKLQGDIGKFGKTEI------SDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLG-TDGKINTWD 1176
            P   ++L    GY     R NL +L   + L Y++   + F    D    Y  +   E I CM VHP++  +A G+K      S     I+   SL+   +      D    A ++ Q N    +LA V S  + +L+VW+W+    + +     + +   A+    + ++ T G GH+ FW +  D F           F +T+I      S +      PDG V++    G + ++  +       R   +  + G    I++ EG L++ G  D KI  WD
Sbjct:  216 PDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHY--TGHTEDIMCMDVHPSRELVASGQKAGRDRKSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILA-VDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGF-----------FERTDIVKQPSRSHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWD 485          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 103.219 bits (256), Expect = 2.215e-21
Identity = 111/453 (24.50%), Postives = 191/453 (42.16%), Query Frame = 1
Query:  556 MAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKL-QGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEWKATVEGK 1890
            + VHP K Y+A G+   D  P   +++  +LK   +L+   ++     +F   G+ L +VG D +  + +W+WK  + + +S+     I+ V  +      L T G  HI+FW    T  GL   +G  G  GK E + +       +  V SG+  G++ +W D  L+K           H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A   M  ++   +G +         P GK +  G +DG   ++N            + TL ++     T  H K+I S    + D GK L   S D  V  +++  S+   +G  K  +  I HV+W   V GK
Sbjct:  143 LTVHPLKDYVASGQVGRD--PAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFW--LHTGGGLTFRRGIFGNLGKQE-TMMSACYGRSEDLVFSGATTGDVYIWKDTTLMK-------SIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVN------------ADTLEDM----VTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSK--RVGICKGASSCITHVDWD--VRGK 548          

HSP 2 Score: 80.4925 bits (197), Expect = 1.984e-14
Identity = 106/484 (21.90%), Postives = 192/484 (39.67%), Query Frame = 1
Query:  274 HKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVV--------------KLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFET-------IDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            H++QKE  +++ E           +P +S  + LP  +V               L H FGY   +C  R+NL  L D   + + +       +LS  + S+    + + I C+ V  HP K    +   +    P   +++  S +   +LR    K   Y  F+ +G+LL +VG DP+  +TVW W+    V      +  I+ V +  D +    + G  HI+FW    T  G  L    G  G  E   ++  + +  G      +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        ++T    E + +        L+ + D ++M V +     ++I       G+IW L    +H S                 DV    ++SAS   DG++R +D A +KL+ ++          ++     P G+ V  G  +G   +L
Sbjct:  731 HQQQKE--ILVDE-----------RPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDD-ILCLTVNQHP-KYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFW----TLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQLETGLPVEIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHT-QGRIWGLA---THPSK----------------DV----FISAS--DDGTIRFWDLADKKLLNKVSLGHPAKCTAYS-----PNGEMVSIGMENGEFIVL 1162          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 103.219 bits (256), Expect = 2.478e-21
Identity = 111/453 (24.50%), Postives = 191/453 (42.16%), Query Frame = 1
Query:  556 MAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKL-QGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEWKATVEGK 1890
            + VHP K Y+A G+   D  P   +++  +LK   +L+   ++     +F   G+ L +VG D +  + +W+WK  + + +S+     I+ V  +      L T G  HI+FW    T  GL   +G  G  GK E + +       +  V SG+  G++ +W D  L+K           H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A   M  ++   +G +         P GK +  G +DG   ++N            + TL ++     T  H K+I S    + D GK L   S D  V  +++  S+   +G  K  +  I HV+W   V GK
Sbjct:  143 LTVHPLKDYVASGQVGRD--PAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFW--LHTGGGLTFRRGIFGNLGKQE-TMMSACYGRSEDLVFSGATTGDVYIWKDTTLMK-------SIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVN------------ADTLEDM----VTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSK--RVGICKGASSCITHVDWD--VRGK 548          

HSP 2 Score: 80.1073 bits (196), Expect = 2.693e-14
Identity = 108/490 (22.04%), Postives = 196/490 (40.00%), Query Frame = 1
Query:  274 HKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVV--------------KLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMY---LAVGE--KKSDSP---PVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFET-------IDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            H++QKE  +++ E           +P +S  + LP  +V               L H FGY   +C  R+NL  L D   + + +       +LS  + S+    + + I C+ V+    Y   +A G+    +D P   P   +++  S +   +LR    K   Y  F+ +G+LL +VG DP+  +TVW W+    V      +  I+ V +  D +    + G  HI+FW    T  G  L    G  G  E   ++  + +  G      +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        ++T    E + +        L+ + D ++M V +     ++I       G+IW L    +H S                 DV    ++SAS   DG++R +D A +KL+ ++          ++     P G+ V  G  +G   +L
Sbjct:  731 HQQQKE--ILVDE-----------RPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDD-ILCLTVNQHPKYQNIIATGQIGDITDLPGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFW----TLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQLETGLPVEIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHT-QGRIWGLA---THPSK----------------DV----FISAS--DDGTIRFWDLADKKLLNKVSLGHPAKCTAYS-----PNGEMVSIGMENGEFIVL 1169          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 103.219 bits (256), Expect = 2.851e-21
Identity = 111/453 (24.50%), Postives = 191/453 (42.16%), Query Frame = 1
Query:  556 MAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKL-QGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEWKATVEGK 1890
            + VHP K Y+A G+   D  P   +++  +LK   +L+   ++     +F   G+ L +VG D +  + +W+WK  + + +S+     I+ V  +      L T G  HI+FW    T  GL   +G  G  GK E + +       +  V SG+  G++ +W D  L+K           H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A   M  ++   +G +         P GK +  G +DG   ++N            + TL ++     T  H K+I S    + D GK L   S D  V  +++  S+   +G  K  +  I HV+W   V GK
Sbjct:  556 LTVHPLKDYVASGQVGRD--PAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFW--LHTGGGLTFRRGIFGNLGKQE-TMMSACYGRSEDLVFSGATTGDVYIWKDTTLMK-------SIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVN------------ADTLEDM----VTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSK--RVGICKGASSCITHVDWD--VRGK 961          

HSP 2 Score: 91.2781 bits (225), Expect = 1.291e-17
Identity = 72/280 (25.71%), Postives = 121/280 (43.21%), Query Frame = 1
Query:  556 MAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFE-----TIDTAEVAEEMATFEMDPM-----NELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDL 1356
            +A+HP K+ +A G+   D  P   +++  +L    ILRD      +   F+  G+ LA+VG D    + VW+WK  + +  +   S  I+ ++W   L   L + G  HI+FW +     G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG +  WD +      ID  E  +      +  +       L  + D+++  V+     +  +       G++W LDL
Sbjct:   66 LALHPDKIQVATGQVGKD--PYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFWALC----GNALTPKRGIFGKT--GDLQTILCLATAKEEVTYSGALNGDIYVWKG----LNLTRTIQAAHGAGIFSMHSCEEG-FATGGRDGCVRLWDVDFKPITKIDLREAEQGYKGLSIRSVCWRADRILAGTQDSEIFEVMVRDRDKPLLIMQGHSEGELWALDL 332          

HSP 3 Score: 79.7221 bits (195), Expect = 3.729e-14
Identity = 106/484 (21.90%), Postives = 192/484 (39.67%), Query Frame = 1
Query:  274 HKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVV--------------KLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFET-------IDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            H++QKE  +++ E           +P +S  + LP  +V               L H FGY   +C  R+NL  L D   + + +       +LS  + S+    + + I C+ V  HP K    +   +    P   +++  S +   +LR    K   Y  F+ +G+LL +VG DP+  +TVW W+    V      +  I+ V +  D +    + G  HI+FW    T  G  L    G  G  E   ++  + +  G      +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        ++T    E + +        L+ + D ++M V +     ++I       G+IW L    +H S                 DV    ++SAS   DG++R +D A +KL+ ++          ++     P G+ V  G  +G   +L
Sbjct: 1144 HQQQKE--ILVDE-----------RPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDD-ILCLTVNQHP-KYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFW----TLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQLETGLPVEIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHT-QGRIWGLA---THPSK----------------DV----FISAS--DDGTIRFWDLADKKLLNKVSLGHPAKCTAYS-----PNGEMVSIGMENGEFIVL 1575          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Zebrafish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:100000931])

HSP 1 Score: 103.219 bits (256), Expect = 3.128e-21
Identity = 111/453 (24.50%), Postives = 191/453 (42.16%), Query Frame = 1
Query:  556 MAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKL-QGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEWKATVEGK 1890
            + VHP K Y+A G+   D  P   +++  +LK   +L+   ++     +F   G+ L +VG D +  + +W+WK  + + +S+     I+ V  +      L T G  HI+FW    T  GL   +G  G  GK E + +       +  V SG+  G++ +W D  L+K           H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A   M  ++   +G +         P GK +  G +DG   ++N            + TL ++     T  H K+I S    + D GK L   S D  V  +++  S+   +G  K  +  I HV+W   V GK
Sbjct:  556 LTVHPLKDYVASGQVGRD--PAIHVWDIQTLKCLSLLKGQHQRGVCALEFTADGKSLVSVGIDEEHCIVIWDWKKGEKLAKSRGHKDKIFVVKGNPFRMDKLVTVGMKHIKFW--LHTGGGLTFRRGIFGNLGKQE-TMMSACYGRSEDLVFSGATTGDVYIWKDTTLMK-------SIKAHDGPVFAMCSLDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVN------------ADTLEDM----VTFHHRKEIISDIRFSQDAGKYLAVASHDSFVDIYNVLTSK--RVGICKGASSCITHVDWD--VRGK 961          

HSP 2 Score: 91.2781 bits (225), Expect = 1.238e-17
Identity = 90/368 (24.46%), Postives = 153/368 (41.58%), Query Frame = 1
Query:  556 MAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFS 1635
            +A+HP K+ +A G+   D  P   +++  +L    ILRD      +   F+  G+ LA+VG D    + VW+WK  + +  +   S  I+ ++W   L   L + G  HI+FW +     G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG +  W  DF+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  I+     GE+   D+ P   L+ +   D S+R++  +   L+A  + N E +      +     G  +  G  DG   V+R+  FS
Sbjct:   66 LALHPDKIQVATGQVGKD--PYICVWDSYALTTVSILRDVHTHGVACLAFDADGQRLASVGLDAKNTVCVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFWALC----GNALTPKRGIFGKT--GDLQTILCLATAKEEVTYSGALNGDIYVWKG----LNLTRTIQAAHGAGIFSMHSCEEG-FATGGRDGCVRLWDVDFKPITKIDLREAEQGYKGLSIRSVCWRADRIL-----AGTQDSEI------------FEVMVRDRDKPLLIMQGHSEGELWALDLHPKQPLAVTGSDDRSVRLWSLSEHTLIA--RCNMEEAV---RSVSFINDGSQLALGMKDGSFTVLRVRYFS 398          

HSP 3 Score: 79.337 bits (194), Expect = 4.526e-14
Identity = 106/484 (21.90%), Postives = 192/484 (39.67%), Query Frame = 1
Query:  274 HKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVV--------------KLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFET-------IDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            H++QKE  +++ E           +P +S  + LP  +V               L H FGY   +C  R+NL  L D   + + +       +LS  + S+    + + I C+ V  HP K    +   +    P   +++  S +   +LR    K   Y  F+ +G+LL +VG DP+  +TVW W+    V      +  I+ V +  D +    + G  HI+FW    T  G  L    G  G  E   ++  + +  G      +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        ++T    E + +        L+ + D ++M V +     ++I       G+IW L    +H S                 DV    ++SAS   DG++R +D A +KL+ ++          ++     P G+ V  G  +G   +L
Sbjct: 1144 HQQQKE--ILVDE-----------RPPVSRAAPLPDKLVKNNITKKKKTVEELSLDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAAVIHSLSAGTQSFYLEHTDD-ILCLTVNQHP-KYQNIIATGQIGLAPSIHVWDAMSKQTMSVLRCAHAKGIGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSRVCSKGGHTDRIFVVEFRPDSDTQFVSVGIKHIKFW----TLVGGSLLYKKGVIGAVEDGHMQTMLSVAFGANNLTFTGAINGDVFVWREHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQLETGLPVEIVRSVCRGKGKILVGTKDGEIMEVGEKNAASNTIINGHT-QGRIWGLA---THPSK----------------DV----FISAS--DDGTIRFWDLADKKLLNKVSLGHPAKCTAYS-----PNGEMVSIGMENGEFIVL 1575          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Zebrafish
Match: EML5 (si:dkey-1f12.3 [Source:ZFIN;Acc:ZDB-GENE-030131-1677])

HSP 1 Score: 98.9821 bits (245), Expect = 5.759e-20
Identity = 128/563 (22.74%), Postives = 227/563 (40.32%), Query Frame = 1
Query:  211 DSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTE--ISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDIS--KKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEW 1869
            DS    V     E   E ++ ++RQ  KE+   + E     +     K    E +      +   H + GY+C  R NL       + Y ++   + +    +    YL     + I C+A+HP K Y+A G+   DS     I+E   LK   +L+   +       F+  G+ LA+VG D +  + +WEW+  + +   +     I+ +  +  +   L +AG  H++FW  A    G  L G  G  GKTE  +  + G+    +  V SG+  G++ +W D  L+K           H G +  +   E   +T G DG +  WD +T +       +    + P ++ L+  D   +  +        +      NG+I ++D      + P  +L   H  GE+      P   L A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N +  L+  +S   +   + EI     T               GK L   S D  V  +++  S+ + +    +N  I H++W
Sbjct:  620 DSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKHRAMAMKK--RERAPASGMRLHFIHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGH--DDDILCLAIHPVKDYVATGQVGRDSS--IHIWETEFLKPLSVLKGFHQFGVCALDFSADGKRLASVGLDDNHTIVLWEWRKGEKLSTIRGSKDKIFVIKINPYMPDKLISAGVKHMKFWHRA----GGGLIGKKGSMGKTETMMCAVYGWT---EEMVFSGTCTGDICIWRDMFLVKTV-------KAHDGPVFSMHALEKGFVTGGKDGIVALWD-DTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KNGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRCCC----FSPDGKALAVGLNDGSFLIVN-ADTLEDLVSFHHRKDIISEIRFSPVT---------------GKYLAVASGDSFVDIYNVMSSKRVGVCKGSMNY-ITHLDW 1130          

HSP 2 Score: 97.4413 bits (241), Expect = 1.609e-19
Identity = 118/526 (22.43%), Postives = 210/526 (39.92%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHS-GEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEG-KPDEGIGRIMVY 1923
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   ILRD      +   F+  G+ L +VG D    + VW+W+  + +  +   +  I+ ++W    +  L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    SG  +    EEG   T G DG I  WD  F+ I   ++ E    ++   +  +    D  L+    S   E  +                  H    P ++   H  GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS D +V  + +    Y  +G  V  +  I H++W    +  + ++G GR + Y
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILRDMHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRQGKVLAAAPGHTDRIFDISWDLYQQSKLVSCGVKHIKFWSLC----GNALTPKRGVFGKTGDLQTILCLACARDEITYSGALNGDIYVWKG----INLIRTVQGAHGSGIFSMNACEEG-FATGGRDGCIRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVV------------------HDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLVDHALIA--RCNME-EPIRCAAVSTD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGAHLAVGSNDNSVDIYGV-VQRYKKVGECVGSSSFITHMDWSTDSKYLQTNDGNGRRLFY 478          

HSP 3 Score: 77.7962 bits (190), Expect = 1.650e-13
Identity = 120/551 (21.78%), Postives = 229/551 (41.56%), Query Frame = 1
Query:  106 EMADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQP-TQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLP-----SNVVK---------LAHSFGYNCQK-RDNLALLDQQT-LCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HP-------TKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQI--IIEEGELMTLGTD------GKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            E   + ++ +++ +D  +  DGG  ++V    TRE+  +  ++  + +  P+     H +QKE  V          +E  S+P +S    +P     +NV K         L   FGY     R+N+  L++   + Y + +    +NL+    S+    S + I C+ +  HP       T      G+  + SP +  ++E  + +   +LR    +      F+ +G+LL +VG DP   LT+W+W+    V      +Q I+   +  D +    + G  H+RFW +A    G  L    G     E + ++  + +  G      +G+  G++ VW  E I V+I  K     H+G +  +   + +G ++T G +      G +  WD E        ++T +V + + +        L+ + +A+++  V       +I      +G +W L        A P           RD       +LSA+   DG++R++D + RK++ ++        + ++     P+G  V  G  +G   IL
Sbjct: 1268 ESCREARQCDSEESDIESEDDGGYDSDV----TRENEIVYVIKALSTNMRPMTGVKPHLQQKEPTV----------DERGSRPPVSRAPPMPEKLQTNNVGKKKRPIEDLVLELVFGYRGNDCRNNVHYLNEGADIIYHTASIGVVLNLTTACQSFYLEHSDD-ILCLTINQHPKFPNVVATGQVGDTGDMSATSPSI-HVWEAMNKQTLSVLRCHHSRGVCSVSFSATGKLLLSVGLDPQHTLTIWKWQEGAKVASRAGHTQRIFVAEFRPDSDTQFVSVGIKHVRFWTLA----GRALLSKKGVLSSIEDARMQTMLSVAFGANNLTFTGTISGDVCVWK-EHILVRIVAK----AHTGPVFTMYTTLRDGLIVTGGKERPSKEGGALKLWDQELKRCRAFRLETGQVIDCVRSVCRGKGKILVGTRNAEIIE-VGEKNAACNILVNGHMDGPVWGL-------GAHP----------TRDV------FLSAA--EDGTVRLWDISQRKMLNKVNLGHPARTVSYS-----PEGDMVAIGMKNGEFIIL 1762          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 105.916 bits (263), Expect = 5.740e-22
Identity = 126/552 (22.83%), Postives = 232/552 (42.03%), Query Frame = 1
Query:  259 EEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNV-VKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK----VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            E +IN+ RQ  KE+   +P+    + E+  S P +  E     ++ +K  H + GY+C  R+NL       + Y ++   + +  L      YL     + I  +A+HP K Y+A G+   D+     +++  +LK   +L+   ++  S   F+  G+ L +VG D +  +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+     TG       G FG   I  +E  + +  G+    V SG+  G++ +W   ++   I        H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR+++ +++  M  ++   +G +         P GK +  G  DG   ++N            + TL ++     +  H K+I +    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  636 ETQINYDRQVYKED---LPQLKQQNKEKQQSLPSLKREKAPDESLKLKFVHGYRGYDC--RNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGH--DDDILSLAIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQ----TGGGFTAKRGTFG--TIGKLETMMCVSYGRAEDLVFSGAATGDIYIWKDVVLLKTI------KAHDGPVFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELSSQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLSDGSFLVVN------------ADTLEDM----VSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIYNVLSSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 94.7449 bits (234), Expect = 1.411e-18
Identity = 98/433 (22.63%), Postives = 178/433 (41.11%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQ 1647
            P+  ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP +  +A G+   D  P   I++  +++   IL+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       L + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  I+     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +     G  +  G  DG   V+R+ + ++V+ 
Sbjct:    7 PACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDRTLVATGQVGKD--PYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDVTYSGALNGDIYVWKG----LTLARTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDADFKAITKIDLRESEQGYKGLSIRSVCWKADRIL-----AGTQDSEI------------FEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVH 403          

HSP 3 Score: 89.7373 bits (221), Expect = 4.570e-17
Identity = 112/497 (22.54%), Postives = 201/497 (40.44%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPT-KMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  RDNL  L D   + + +       NLS  S S+    + + I C+ V  HP  K  +A G+    + P   I++  S +   ILR    K      F+ +G+LL +VG DP+  +TVW W+    V      ++ I+   +  D +    + G  HI+FW +A +   L  +G +G     ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++    L           V+S             +G+I ++       +A   I+N    GEI      P   +  +  +DG+ R++D A +KL+ ++   F      ++     P G+ V  G  +G  VI ++N  ++      KK    G I  I+           +S D+  + L  GS + TV F+ +     L   G+ K
Sbjct: 1363 LSLDHVFGYRGFDC--RDNLHYLNDGADIVFHTAAASIVQNLSTGSQSFYLEHTDD-ILCLTVNQHPKYKNVIATGQ--IGATPSIHIWDAMSKQTLSILRCFHGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTLAGSAL-LYKKGIVGSVDNAKMQTMLSVAFGANSLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLETGQPL---------DCVRSVCRGKGKVLVGTKDGEIIEVG---EKNAASNIIMNGHVEGEIWGLATHPSKEICLTASNDGTARIWDLADKKLLNKVSLGFAACCAAYS-----PNGEMVTIGMRNGEFVILLVNSLKIW----GKKRDRKGAIQDIR-----------ISPDN--RYLAVGSAENTVDFYDLTQGPSLNRFGYCK 1812          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 105.916 bits (263), Expect = 6.241e-22
Identity = 126/552 (22.83%), Postives = 232/552 (42.03%), Query Frame = 1
Query:  259 EEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNV-VKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK----VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            E +IN+ RQ  KE+   +P+    + E+  S P +  E     ++ +K  H + GY+C  R+NL       + Y ++   + +  L      YL     + I  +A+HP K Y+A G+   D+     +++  +LK   +L+   ++  S   F+  G+ L +VG D +  +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+     TG       G FG   I  +E  + +  G+    V SG+  G++ +W   ++   I        H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR+++ +++  M  ++   +G +         P GK +  G  DG   ++N            + TL ++     +  H K+I +    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  636 ETQINYDRQVYKED---LPQLKQQNKEKQQSLPSLKREKAPDESLKLKFVHGYRGYDC--RNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGH--DDDILSLAIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQ----TGGGFTAKRGTFG--TIGKLETMMCVSYGRAEDLVFSGAATGDIYIWKDVVLLKTI------KAHDGPVFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELSSQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLSDGSFLVVN------------ADTLEDM----VSFHHRKEIIADIKFSPDAGKYLAVASHDNFVDIYNVLSSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 94.7449 bits (234), Expect = 1.522e-18
Identity = 98/433 (22.63%), Postives = 178/433 (41.11%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQ 1647
            P+  ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP +  +A G+   D  P   I++  +++   IL+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       L + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  I+     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +     G  +  G  DG   V+R+ + ++V+ 
Sbjct:    7 PACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDRTLVATGQVGKD--PYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDVTYSGALNGDIYVWKG----LTLARTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDADFKAITKIDLRESEQGYKGLSIRSVCWKADRIL-----AGTQDSEI------------FEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVH 403          

HSP 3 Score: 92.0485 bits (227), Expect = 1.082e-17
Identity = 114/498 (22.89%), Postives = 202/498 (40.56%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPT-KMYLAVGE-KKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  RDNL  L D   + + +       NLS  S S+    + + I C+ V  HP  K  +A G+  K  S P   I++  S +   ILR    K      F+ +G+LL +VG DP+  +TVW W+    V      ++ I+   +  D +    + G  HI+FW +A +   L  +G +G     ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++    L           V+S             +G+I ++       +A   I+N    GEI      P   +  +  +DG+ R++D A +KL+ ++   F      ++     P G+ V  G  +G  VI ++N  ++      KK    G I  I+           +S D+  + L  GS + TV F+ +     L   G+ K
Sbjct: 1375 LSLDHVFGYRGFDC--RDNLHYLNDGADIVFHTAAASIVQNLSTGSQSFYLEHTDD-ILCLTVNQHPKYKNVIATGQIGKMISTPSIHIWDAMSKQTLSILRCFHGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTLAGSAL-LYKKGIVGSVDNAKMQTMLSVAFGANSLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLETGQPL---------DCVRSVCRGKGKVLVGTKDGEIIEVG---EKNAASNIIMNGHVEGEIWGLATHPSKEICLTASNDGTARIWDLADKKLLNKVSLGFAACCAAYS-----PNGEMVTIGMRNGEFVILLVNSLKIW----GKKRDRKGAIQDIR-----------ISPDN--RYLAVGSAENTVDFYDLTQGPSLNRFGYCK 1827          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Xenopus
Match: EML6 (echinoderm microtubule associated protein like 6 [Source:NCBI gene;Acc:100498213])

HSP 1 Score: 103.605 bits (257), Expect = 3.487e-21
Identity = 108/469 (23.03%), Postives = 199/469 (42.43%), Query Frame = 1
Query:  259 EEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNV-VKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK----VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILN 1629
            E +IN+ RQ  KE+   +P+    + E+  S P +  E     ++ +K  H + GY+C  R+NL       + Y ++   + +  L      YL     + I  +A+HP K Y+A G+   D+     +++  +LK   +L+   ++  S   F+  G+ L +VG D +  +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+     TG       G FG   I  +E  + +  G+    V SG+  G++ +W   ++   I        H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR+++ +++  M  ++   +G +         P GK +  G  DG   ++N
Sbjct:  636 ETQINYDRQVYKED---LPQLKQQNKEKQQSLPSLKREKAPDESLKLKFVHGYRGYDC--RNNLFYTQAGEVVYHVAAIAVVYDRLQHSQRFYLGH--DDDILSLAIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVSALDFSADGKCLVSVGLDDNHTIVYWDWKKGEKIACTRGHKDKIFVVKCNPHHTDKLVTVGMKHIKFWQQ----TGGGFTAKRGTFG--TIGKLETMMCVSYGRAEDLVFSGAATGDIYIWKDVVLLKTI------KAHDGPVFAMYALDKGFVTGGKDGVVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLATHPQLPLCATVSDDKTLRIWELSSQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLSDGSFLVVN 1068          

HSP 2 Score: 95.1301 bits (235), Expect = 1.071e-18
Identity = 98/433 (22.63%), Postives = 178/433 (41.11%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQ 1647
            P+  ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP +  +A G+   D  P   I++  +++   IL+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       L + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  I+     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +     G  +  G  DG   V+R+ + ++V+ 
Sbjct:    7 PACQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDRTLVATGQVGKD--PYICIWDSYTVQTVSILKDVHTHGVAGLAFDSEGQRLASVGLDAKNTVCIWDWQKGKVLATATGHSDRIFDISWDPYQPNRLVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDVTYSGALNGDIYVWKG----LTLARTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDADFKAITKIDLRESEQGYKGLSIRSVCWKADRIL-----AGTQDSEI------------FEVMVRERDKPMLIMQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFISDGSQLALGMKDGSFTVLRVRDMTEVVH 403          

HSP 3 Score: 90.1225 bits (222), Expect = 4.039e-17
Identity = 112/497 (22.54%), Postives = 201/497 (40.44%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPT-KMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  RDNL  L D   + + +       NLS  S S+    + + I C+ V  HP  K  +A G+    + P   I++  S +   ILR    K      F+ +G+LL +VG DP+  +TVW W+    V      ++ I+   +  D +    + G  HI+FW +A +   L  +G +G     ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++    L           V+S             +G+I ++       +A   I+N    GEI      P   +  +  +DG+ R++D A +KL+ ++   F      ++     P G+ V  G  +G  VI ++N  ++      KK    G I  I+           +S D+  + L  GS + TV F+ +     L   G+ K
Sbjct: 1319 LSLDHVFGYRGFDC--RDNLHYLNDGADIVFHTAAASIVQNLSTGSQSFYLEHTDD-ILCLTVNQHPKYKNVIATGQ--IGATPSIHIWDAMSKQTLSILRCFHGKGVGCINFSATGKLLVSVGVDPEHTITVWRWQEGAKVAIKGGHAERIFVAQFRPDSDTQFVSVGVKHIKFWTLAGSAL-LYKKGIVGSVDNAKMQTMLSVAFGANSLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLETGQPL---------DCVRSVCRGKGKVLVGTKDGEIIEVG---EKNAASNIIMNGHVEGEIWGLATHPSKEICLTASNDGTARIWDLADKKLLNKVSLGFAACCAAYS-----PNGEMVTIGMRNGEFVILLVNSLKIW----GKKRDRKGAIQDIR-----------ISPDN--RYLAVGSAENTVDFYDLTQGPSLNRFGYCK 1768          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Xenopus
Match: EML5 (echinoderm microtubule associated protein like 5 [Source:NCBI gene;Acc:100145498])

HSP 1 Score: 93.2041 bits (230), Expect = 4.219e-18
Identity = 126/565 (22.30%), Postives = 227/565 (40.18%), Query Frame = 1
Query:  211 DSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKV----LSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKP-IHHVEW 1869
            DS    V     E   E +  ++RQ  KE+   + E     +    SK    E + L S  +   H + GY+C  R NL       + Y ++   + +    +    YL     + I C+A+HP K Y+A G+   +S     I++  ++K   +L+   +       F+  G+ LA+VG D +  + +W+WK  + +   K   + I+ V  +  +   L TAG  H+RFW+ A    G  L G     G    + I+  + +  G       SG+  G++ +W    +   +        H G +  +   +   +T G DG +  WD ++ +       +    + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   + A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N            + TL ++     +  H K I S    +   GK L   S D  V  +++  S+   IG  K +   I H++W
Sbjct:  620 DSDQSDVPELDSEIEQETQTTYRRQVYKEDLPQLKEQCKDLHRSASSKR--RERAPLNSIRLHFVHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGH--NDDILCLAIHPLKDYVATGQVGRES--TVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYMPDKLITAGIKHMRFWRRA----GGGLIGRKACIGTGAGAKIDTMMSVVYGWTEEMSFSGTSTGDVCIWRDLFLMKTV------KAHDGPVFSMHALDKGFVTGGKDGVVALWD-DSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPVTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRC----CSFSPDGKALAVGLNDGSFIIVN------------ADTLEDL----VSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIYNVMSSK--RIGVCKGSASYITHLDW 1135          

HSP 2 Score: 92.0485 bits (227), Expect = 1.005e-17
Identity = 115/529 (21.74%), Postives = 211/529 (39.89%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKP-IHHVEWKATVEG-KPDEGIGRIMVYMAEG 1935
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   IL+D      +   F+  G+ L +VG D    + VW+WK  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG +  WD  F+ I   ++ E    ++   +  +    D  L   V + ++E                ++     + P  I+     GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS D  V  + +    Y  +G    +   I H++W +  +  + ++G G+ M Y   G
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYMGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC----GNSLTPKRGVFGKTGDLQTILCLACARDEVTYSGALNGDIYVWKG----LNLARTIQGAHAAGIFSMNACEEG-FATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHIL---VGTQDSEI--------------FEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSLIDHALIA--RCNME-EPIRCAAVSTD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGSFLAVGSNDSCVDIYGV-VQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMPG 482          

HSP 3 Score: 77.411 bits (189), Expect = 2.604e-13
Identity = 87/424 (20.52%), Postives = 176/424 (41.51%), Query Frame = 1
Query:  406 FGYNCQK-RDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            FGY  +  R+N+  L D   + Y + +     N++  S S+ +  + + I C+ V  HP K    V   +  + P   +++  S +   +LR    K      F+ +G+LL +VG DP+  +T+W+W+    +      +Q I+   +  D +    + G  H+RFW +A    G  L    G     E + ++  + +  G      +G+  G++ VW   ++   + + +  P    ++   + +I+  G+       G +  WD E        ++T +  + + +        L+ + +A+++  V       +I      +G IW L    +H S              RD       +LSA+   DG++R++D   +K++ ++        + ++     P+G  V  G  +G   IL
Sbjct: 1371 FGYRGKDCRNNVHYLNDGDDILYHAASVGILYNVATGSQSFYQEHTDD-ILCLTVNQHP-KFINIVATGQVATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFRPDSDTQFVSVGVKHVRFWTLA----GRALLSKKGMLSSIEDARMQTMLAVAFGAGNLTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRCRAFRLETGQTTDCVRSVCRGKGKILVGTRNAEIIE-VGEKNAACNILINGHVDGPIWGLA---THPS--------------RD------FFLSAA--EDGTVRLWDIGDKKMLNKVNLGHAARTVCYS-----PEGDMVAIGMKNGEFIIL 1757          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Xenopus
Match: EML5 (echinoderm microtubule associated protein like 5 [Source:NCBI gene;Acc:100145498])

HSP 1 Score: 93.2041 bits (230), Expect = 4.368e-18
Identity = 126/565 (22.30%), Postives = 227/565 (40.18%), Query Frame = 1
Query:  211 DSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDG----KVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKP-IHHVEW 1869
            DS    V     E   E +  ++RQ  KE+   + E     +    SK    E + L S  +   H + GY+C  R NL       + Y ++   + +    +    YL     + I C+A+HP K Y+A G+   +S     I++  ++K   +L+   +       F+  G+ LA+VG D +  + +W+WK  + +   K   + I+ V  +  +   L TAG  H+RFW+ A    G  L G     G    + I+  + +  G       SG+  G++ +W    +   +        H G +  +   +   +T G DG +  WD ++ +       +    + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   + A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N            + TL ++     +  H K I S    +   GK L   S D  V  +++  S+   IG  K +   I H++W
Sbjct:  620 DSDQSDVPELDSEIEQETQTTYRRQVYKEDLPQLKEQCKDLHRSASSKR--RERAPLNSIRLHFVHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGH--NDDILCLAIHPLKDYVATGQVGRES--TVHIWDTETIKPLSVLKGHHQYGVCAVDFSADGKRLASVGIDDNHTIVLWDWKKGEKLSSVKGSKEKIFVVKINPYMPDKLITAGIKHMRFWRRA----GGGLIGRKACIGTGAGAKIDTMMSVVYGWTEEMSFSGTSTGDVCIWRDLFLMKTV------KAHDGPVFSMHALDKGFVTGGKDGVVALWD-DSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPVTLLVQGHMEGEVWGLATHPHLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRC----CSFSPDGKALAVGLNDGSFIIVN------------ADTLEDL----VSFHHRKDIISDIRFSPGTGKYLAVASYDNFVDIYNVMSSK--RIGVCKGSASYITHLDW 1135          

HSP 2 Score: 91.6633 bits (226), Expect = 1.170e-17
Identity = 115/529 (21.74%), Postives = 212/529 (40.08%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKP-IHHVEWKATVEG-KPDEGIGRIMVYMAEG 1935
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   IL+D      +   F+  G+ L +VG D    + VW+WK  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG +  WD  F+ I   ++ E    ++   +  +    D    H++   + +S I             ++     + P  I+     GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS D  V  + +    Y  +G    +   I H++W +  +  + ++G G+ M Y   G
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYMGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILKDVHTHGIACLAFDLDGQRLVSVGLDAKNTICVWDWKKGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC----GNSLTPKRGVFGKTGDLQTILCLACARDEVTYSGALNGDIYVWKG----LNLARTIQGAHAAGIFSMNACEEG-FATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGD----HILVGTQ-DSEI------------FEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAITGSDDRSVRIWSLIDHALIA--RCNME-EPIRCAAVSTD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGSFLAVGSNDSCVDIYGV-VQRYKKVGECMGSVTFITHMDWSSDSKFLQTNDGSGKRMFYRMPG 482          

HSP 3 Score: 75.8702 bits (185), Expect = 8.187e-13
Identity = 86/430 (20.00%), Postives = 179/430 (41.63%), Query Frame = 1
Query:  406 FGYNCQK-RDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTA------IYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            FGY  +  R+N+  L D   + Y + +     N++  S S+ +  + + I C+ V  HP  + +    +  D+  ++A      +++  S +   +LR    K      F+ +G+LL +VG DP+  +T+W+W+    +      +Q I+   +  D +    + G  H+RFW +A    G  L    G     E + ++  + +  G      +G+  G++ VW   ++   + + +  P    ++   + +I+  G+       G +  WD E        ++T +  + + +        L+ + +A+++  V       +I      +G IW L    +H S              RD       +LSA+   DG++R++D   +K++ ++        + ++     P+G  V  G  +G   IL
Sbjct: 1376 FGYRGKDCRNNVHYLNDGDDILYHAASVGILYNVATGSQSFYQEHTDD-ILCLTVNQHPKFINIVATGQVGDAADMSATAPSIHVWDAMSKQTLSVLRCYHSKGICSVSFSATGKLLLSVGLDPEHTVTIWKWQEGARIASKMGHNQRIFVAEFRPDSDTQFVSVGVKHVRFWTLA----GRALLSKKGMLSSIEDARMQTMLAVAFGAGNLTFTGTISGDVCVWKDHILSRIVAKAHNGPVFTMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELKRCRAFRLETGQTTDCVRSVCRGKGKILVGTRNAEIIE-VGEKNAACNILINGHVDGPIWGLA---THPS--------------RD------FFLSAA--EDGTVRLWDIGDKKMLNKVNLGHAARTVCYS-----PEGDMVAIGMKNGEFIIL 1769          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Mouse
Match: Cfap44 (cilia and flagella associated protein 44 [Source:MGI Symbol;Acc:MGI:1277238])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 552/1445 (38.20%), Postives = 846/1445 (58.55%), Query Frame = 1
Query:  235 PTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSK--TYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEK--PFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAK-TVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPS-------TFGVQNVFDE-VDEPGKIEDSFAKYNLKGARGMRVARQL---KKLDDNRRKRSF----RKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIE-LCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXX------XAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKV 4482
            P+Q EPPVE  +  + + + K V+ E FYYDY E +S P++S E  +P   + L HSFGY+C+KR NL LLD  TL Y++GN +  ++  D +  YL+S SG+GIG + VHP K Y AV EK   S P   IYEYPSLK YRILRDG EKAY+Y  FN  G LLA+VG  PD+ +T+W WK EQ +LR+KAFSQD+++V ++ D +  LTT+G+GHI+FW+MA TFTGLKLQG +G+FGKT  SDIEG+  LPDGKVLSGSEWGN+L+W+G LIKV++ R   K CHSG+INQI+++EGE++T G+DG +  WDFETIDTA+V ++    E++P+NEL +     L  ++K  E  ++ W AQD NG IWKLDLSFS+ +  PE L +FHSG I    VSPL+YL A+   D S+RV+DF+++  +  MKF   G+ ++WAP  V      ++ GF DGV+R+L     + L     +K     E+HL    KPHT ++T+L+ +  G IL TGSED+TVFFF +   EY PIGF     PI  + W       P++    +++    G + E +CP    VD     T+ +  +  +  + F S+KS +    E++++  ++  ++K   + R +  E      EE+  + E  E+   EE    E ++P  P   SPIL GF   ++  KFW+S+G YDAG+LY C+FPS    +  +  E  NEP +   L N+ D P+ ++ +S+    +  G  NG+IR+  L +  PF L ++   W ++VHDNNYGSI S+  S+D+++L++ G DGN FV++I  E +  K I   +A++PS +  ++S+   +DIEDP AYSIE  ++K E+D+ ++  +E KA   ++I  L+ +F  L + N +LP  +Q     F +  K+  ++ +    KI+ V K++A++ +KH + L KL+ RFREPLE D IV++A +S+H +++ +    S       S L+R  Q  S +  SK   +  + P        T G  ++ +E V E GK      K+  +    + V  Q+   KKL     +  F    RK +W+ LY  KP +++EDP+D+ AI+EA+  MGDF LK++ DY + E  R NA K  +EL  ++      +   N  IL LR+ K  +IE I+   ++++ + +++   +  P+     IYP+E PE++F+Y +ETL+ F+++ ++R+      ++      ++      F K S+ + G   T+      S+   L E P  V  E   P    SD + E     ++K +Y+ + + N   +    FD +L LLRH+K      ++ + L  LT+F+E  LLK +EK E  L E+      E+ D+  K+ E   +++ KK +I +L ++++  +  F+ +LGENNKFA +L KV
Sbjct:   73 PSQ-EPPVE--VKEEPEADVKKVLSETFYYDYPELVSIPYVSSEERIPLYFLTLNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEK--GSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTGMKSCHSGSINQIMLDEGEVITAGSDGSVRIWDFETIDTADVIDDTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQDGVVRVLELFDPKGLTVYAGRKKIPDAELHLKYVFKPHTDEVTALAYERDGDILATGSEDKTVFFFDVE-KEYKPIGFFNTPGPICQLMWSPA--SHPEKT---LLIICENGYILESLCPTIKDVDDQNVITFAIPNVF-LRCFHFTSVKSKILRFLEVQRREQQKMLKEKEKLERRMKLAEEREAFGEEEIPEEETSEEGEEEEPPLPEIFMPPTP---SPILCGFY--SEPGKFWVSLGNYDAGFLYHCQFPSYLHNSDFQKQE--NEPFDFRVLENTEDNPIRNITFSNDQTMMFCGMTNGAIRVYVLSENDPF-LVSLQHYWHFNVHDNNYGSIKSITSSFDDQYLLTAGEDGNIFVFDIFSEFIVPKGI---KAKVPSPRFGIESEAAPEDIEDPKAYSIENARKKREHDKLMKKVEELKAHKREQIKILRNEFWKLLELNKELPAHMQFQRTDFNIDAKIHAEIHKKTSLKIEQVEKELAWEKQKHELGLKKLQDRFREPLESDTIVVYATQSDHQIASYRLVKPSK-----YSKLKRPSQ--SERRQSKMERLEKEGPGKKESQRDTGGSISLQEESVLEKGK------KFRPRTLSEIMVENQIEKTKKLIQQAERAQFKILQRKKEWEELYKSKPDDDYEDPKDVQAIKEAQTYMGDFNLKTAPDYKIPEHMRINAAKKEEELGYLDTMAHGKKRYMNKCILSLRDLKLAVIEEIQCLVQELKNIQSSIPASKHMPIPQVPQIYPEEVPERRFQYDEETLLRFQRKQKKRQDKSSSKQSGTGSGGSAGGGLVGFLKLSSGKEGDLTTRDSLSRSSKASALLELPKPVEFEKAEP----SDAELEIMKRDEVKHLYMQQFLCNRINELTVTFDAELHLLRHQKLKLDTKMKLSDLHHLTLFQEMLLLKNFEKQENILQERVNSLDKEEQDMQWKINETLKEMEEKKNEITKLQDQEKALYAGFQAALGENNKFANFLMKV 1477          

HSP 2 Score: 124.405 bits (311), Expect = 1.243e-27
Identity = 114/309 (36.89%), Postives = 178/309 (57.61%), Query Frame = 1
Query: 4660 VYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMN 5586
            V+D  +CP  C   L++   QLRE  LDIEE + EEKK+ + LKKE + ++KK KVV   L  A++ LEA+Q EKQQ+LN+L  ++ LKLHQI   E G +P D+   L+F   +   L+ RI +LQ+E  KQ    K+ + R   L + ++   + IS+ +    E+M +KFG++ +LE ++ + +N  +EEL  K L  +     E   WE++I   +   + + K +T  L  + +L  EK+ L+ +LN+ Q   G  FQ    A      K+ +LV  Q +++ ALKEEI +L +KGG +LPP+ 
Sbjct: 1523 VFDDSICPTNCDVSLFELALQLREKRLDIEEALVEEKKIVDNLKKEYDTISKKVKVVATNLNAAEEALEAYQREKQQRLNELLVVIPLKLHQIEYMEFGEVPEDLSGTLVFSNHSLDRLQERIVQLQEENAKQQKLNKECRERRKLLIREKREMAKTISKMEETVRELMISKFGRVIDLEALQTLSVNTTLEELKIKKLRKELSNAKELRMWEEKIAQVRWDLMMKTKEHTKKLHQMNDLCLEKKKLDSRLNTLQNQQGNAFQGLRKADIVAKQKVTELVQTQLEKITALKEEIELLRKKGGLLLPPIT 1831          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Mouse
Match: Cfap44 (cilia and flagella associated protein 44 [Source:MGI Symbol;Acc:MGI:1277238])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 552/1445 (38.20%), Postives = 846/1445 (58.55%), Query Frame = 1
Query:  235 PTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSK--TYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEK--PFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAK-TVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPS-------TFGVQNVFDE-VDEPGKIEDSFAKYNLKGARGMRVARQL---KKLDDNRRKRSF----RKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIE-LCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXX------XAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKV 4482
            P+Q EPPVE  +  + + + K V+ E FYYDY E +S P++S E  +P   + L HSFGY+C+KR NL LLD  TL Y++GN +  ++  D +  YL+S SG+GIG + VHP K Y AV EK   S P   IYEYPSLK YRILRDG EKAY+Y  FN  G LLA+VG  PD+ +T+W WK EQ +LR+KAFSQD+++V ++ D +  LTT+G+GHI+FW+MA TFTGLKLQG +G+FGKT  SDIEG+  LPDGKVLSGSEWGN+L+W+G LIKV++ R   K CHSG+INQI+++EGE++T G+DG +  WDFETIDTA+V ++    E++P+NEL +     L  ++K  E  ++ W AQD NG IWKLDLSFS+ +  PE L +FHSG I    VSPL+YL A+   D S+RV+DF+++  +  MKF   G+ ++WAP  V      ++ GF DGV+R+L     + L     +K     E+HL    KPHT ++T+L+ +  G IL TGSED+TVFFF +   EY PIGF     PI  + W       P++    +++    G + E +CP    VD     T+ +  +  +  + F S+KS +    E++++  ++  ++K   + R +  E      EE+  + E  E+   EE    E ++P  P   SPIL GF   ++  KFW+S+G YDAG+LY C+FPS    +  +  E  NEP +   L N+ D P+ ++ +S+    +  G  NG+IR+  L +  PF L ++   W ++VHDNNYGSI S+  S+D+++L++ G DGN FV++I  E +  K I   +A++PS +  ++S+   +DIEDP AYSIE  ++K E+D+ ++  +E KA   ++I  L+ +F  L + N +LP  +Q     F +  K+  ++ +    KI+ V K++A++ +KH + L KL+ RFREPLE D IV++A +S+H +++ +    S       S L+R  Q  S +  SK   +  + P        T G  ++ +E V E GK      K+  +    + V  Q+   KKL     +  F    RK +W+ LY  KP +++EDP+D+ AI+EA+  MGDF LK++ DY + E  R NA K  +EL  ++      +   N  IL LR+ K  +IE I+   ++++ + +++   +  P+     IYP+E PE++F+Y +ETL+ F+++ ++R+      ++      ++      F K S+ + G   T+      S+   L E P  V  E   P    SD + E     ++K +Y+ + + N   +    FD +L LLRH+K      ++ + L  LT+F+E  LLK +EK E  L E+      E+ D+  K+ E   +++ KK +I +L ++++  +  F+ +LGENNKFA +L KV
Sbjct:   73 PSQ-EPPVE--VKEEPEADVKKVLSETFYYDYPELVSIPYVSSEERIPLYFLTLNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEK--GSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTGMKSCHSGSINQIMLDEGEVITAGSDGSVRIWDFETIDTADVIDDTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQDGVVRVLELFDPKGLTVYAGRKKIPDAELHLKYVFKPHTDEVTALAYERDGDILATGSEDKTVFFFDVE-KEYKPIGFFNTPGPICQLMWSPA--SHPEKT---LLIICENGYILESLCPTIKDVDDQNVITFAIPNVF-LRCFHFTSVKSKILRFLEVQRREQQKMLKEKEKLERRMKLAEEREAFGEEEIPEEETSEEGEEEEPPLPEIFMPPTP---SPILCGFY--SEPGKFWVSLGNYDAGFLYHCQFPSYLHNSDFQKQE--NEPFDFRVLENTEDNPIRNITFSNDQTMMFCGMTNGAIRVYVLSENDPF-LVSLQHYWHFNVHDNNYGSIKSITSSFDDQYLLTAGEDGNIFVFDIFSEFIVPKGI---KAKVPSPRFGIESEAAPEDIEDPKAYSIENARKKREHDKLMKKVEELKAHKREQIKILRNEFWKLLELNKELPAHMQFQRTDFNIDAKIHAEIHKKTSLKIEQVEKELAWEKQKHELGLKKLQDRFREPLESDTIVVYATQSDHQIASYRLVKPSK-----YSKLKRPSQ--SERRQSKMERLEKEGPGKKESQRDTGGSISLQEESVLEKGK------KFRPRTLSEIMVENQIEKTKKLIQQAERAQFKILQRKKEWEELYKSKPDDDYEDPKDVQAIKEAQTYMGDFNLKTAPDYKIPEHMRINAAKKEEELGYLDTMAHGKKRYMNKCILSLRDLKLAVIEEIQCLVQELKNIQSSIPASKHMPIPQVPQIYPEEVPERRFQYDEETLLRFQRKQKKRQDKSSSKQSGTGSGGSAGGGLVGFLKLSSGKEGDLTTRDSLSRSSKASALLELPKPVEFEKAEP----SDAELEIMKRDEVKHLYMQQFLCNRINELTVTFDAELHLLRHQKLKLDTKMKLSDLHHLTLFQEMLLLKNFEKQENILQERVNSLDKEEQDMQWKINETLKEMEEKKNEITKLQDQEKALYAGFQAALGENNKFANFLMKV 1477          

HSP 2 Score: 124.405 bits (311), Expect = 1.243e-27
Identity = 114/309 (36.89%), Postives = 178/309 (57.61%), Query Frame = 1
Query: 4660 VYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMN 5586
            V+D  +CP  C   L++   QLRE  LDIEE + EEKK+ + LKKE + ++KK KVV   L  A++ LEA+Q EKQQ+LN+L  ++ LKLHQI   E G +P D+   L+F   +   L+ RI +LQ+E  KQ    K+ + R   L + ++   + IS+ +    E+M +KFG++ +LE ++ + +N  +EEL  K L  +     E   WE++I   +   + + K +T  L  + +L  EK+ L+ +LN+ Q   G  FQ    A      K+ +LV  Q +++ ALKEEI +L +KGG +LPP+ 
Sbjct: 1523 VFDDSICPTNCDVSLFELALQLREKRLDIEEALVEEKKIVDNLKKEYDTISKKVKVVATNLNAAEEALEAYQREKQQRLNELLVVIPLKLHQIEYMEFGEVPEDLSGTLVFSNHSLDRLQERIVQLQEENAKQQKLNKECRERRKLLIREKREMAKTISKMEETVRELMISKFGRVIDLEALQTLSVNTTLEELKIKKLRKELSNAKELRMWEEKIAQVRWDLMMKTKEHTKKLHQMNDLCLEKKKLDSRLNTLQNQQGNAFQGLRKADIVAKQKVTELVQTQLEKITALKEEIELLRKKGGLLLPPIT 1831          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Mouse
Match: Eml6 (echinoderm microtubule associated protein like 6 [Source:MGI Symbol;Acc:MGI:2442895])

HSP 1 Score: 105.531 bits (262), Expect = 5.645e-22
Identity = 134/581 (23.06%), Postives = 240/581 (41.31%), Query Frame = 1
Query:  166 DGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLA--HSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMA-DTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            +GG+  + ++EE+  DS    V     +   E +IN+ RQ  KE+   +P+      E+  + PF+  E   P + +KL   H + GY+C  R+NL       + Y I+   + +         YL     + I  + +HP K Y+A G+   D+     +++  +LK   +L+   ++      F+  G+ L +VG D    +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+ A   FT  +  G  G  GK E      +  + D  V SG+  G++ +W   L+   +        H G +  +   +   +T G DG +  WD  FE       A +           LL  N +     +++             NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +++  M  ++   +G +         P GK +  G +DG   ++N   V         + +   H       H K++ S    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  609 EGGA--DSYSEES--DSDFSDVPELDSDIEQETQINYDRQVYKED---LPQLKQQSKEKNHAVPFLKREKA-PEDSLKLQFIHGYRGYDC--RNNLFYTQAGEVVYHIAAVAVVYNRQQHAQRLYLGH--DDDILSLTIHPVKDYVATGQVGRDAA--VHVWDTQTLKCLSLLKGHHQRGVCALDFSADGKCLVSVGLDDFHSVVFWDWKKGEKIATTRGHKDKIFVVKCNPQHADKLVTVGIKHIKFWQQAGGGFTSKR--GSFGSAGKLETMMCVSYGRMED-LVFSGAATGDIFIWKDVLLLKTV------KAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERC-LKTYAIKRTALSTSSKGLLLEDNPS-----IRAITLGHGHILVGTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSSQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVNADTV---------EDMLSFH-------HRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 97.4413 bits (241), Expect = 1.902e-19
Identity = 117/510 (22.94%), Postives = 201/510 (39.41%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKP---IHHVEW 1869
            P   ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP K  +A G+   +  P   I+   ++    IL+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       + + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G  +   I     +  HS  I  +   E    T G DG I  W  DF+ I   ++ E    ++   +  +    D +L+   +  E    I   +D                 P  IL     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +   P G  +  G  DG   V+R+ + ++V              +H+    K   + I  +     G  L  GS D  V  +++    Y  IG  + NK    I H++W
Sbjct:    7 PRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDKTLIATGQVGKE--PYICIWNSYNVHTVSILKDVHTHGVACLAFDSDGQHLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRMVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDITYSGALNGDIYVWKGLTLVRTI-----QGAHSAGIFSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKAD-RLLAGTQDSEIFEVIVRERD----------------KPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVSFSPDGSQLALGMKDGSFIVLRVRDMTEV--------------VHI----KDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAV-AQRYKKIG--ECNKSLSFITHIDW 459          

HSP 3 Score: 91.2781 bits (225), Expect = 1.418e-17
Identity = 110/497 (22.13%), Postives = 197/497 (39.64%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  R+NL  L D   + + +       NLS  S S+    + + I C+ V  HP K    V   +  + P   I++  +     +LR    K  +Y  F+ +G+LL +VG DP+  +TVW W+    V       + I+ V +  D +    + G  H++FW +A +   L  +G IG     ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++           +L+  V+S             +G+I    +     SA   IL   H  GEI      P   +  S  +DG+ R++D A +KL+ ++          ++     P G+ V  G  +G  VI ++N  +V      +KS                  I  +      + L  GS ++TV F+ +     L  IG+ K
Sbjct: 1363 LALDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDD-ILCLTVNQHP-KYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHTKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGTKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSAL-LYKKGVIGSMEAAKMQTMLSVAFGANNLTFTGAINGDVYVWKEHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLET---------GQLVECVRSVCRGKGKILVGTKDGEI----IEVGEKSAASNILIDGHMEGEIWGLATHPSKDMFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYS-----PDGEMVAIGMKNGEFVILLVNTLKVWGKKRDRKS-----------------AIQDIRISPDNRFLAVGSSEQTVDFYDLTQGTSLNRIGYCK 1812          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Mouse
Match: Eml5 (echinoderm microtubule associated protein like 5 [Source:MGI Symbol;Acc:MGI:2442513])

HSP 1 Score: 95.5153 bits (236), Expect = 6.521e-19
Identity = 117/529 (22.12%), Postives = 213/529 (40.26%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEG-KPDEGIGRIMVYMAEG 1935
            PS  ++L   +GY   Q R+NL     + + Y         +  +    + R  S + I  +A+HP ++ +A G+   +  P   +++  +++   +L+D      +   F+  G+ L +VG D    + VW+WK  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  WD  F+ I   ++ E    ++   +  +    D  L   V + ++E                ++     + P  I+     GE+    V P   L+ +   D S+R++      L+A  + N E   I  A + VD  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  G  D +V  + +    Y  +G  V     I H++W +     + ++G G+ ++Y   G
Sbjct:    7 PSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFFRGHSDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGRMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC----GNALTPKRGVFGKTGDLQTILCLACARDELTYSGALNGDIYVWKG----INLIRTIQGAHTAGIFSMNSCEEG-FATGGRDGCIRLWDLTFKPITVIDLRETEQGYKGLSVRSVCWRGDHIL---VGTQDSEI--------------FEIVVHERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALIA--RCNME-EPIRCAAVNVD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGAYLAVGCNDSSVDIYGV-AQRYKKVGECVGSLSFITHLDWSSDSRYLQTNDGSGKRLLYKMPG 482          

HSP 2 Score: 93.9745 bits (232), Expect = 2.102e-18
Identity = 102/448 (22.77%), Postives = 188/448 (41.96%), Query Frame = 1
Query:  547 IGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGK--TEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            I C+A+HP K Y+A G+   D  P   +++  ++K   IL+   +       F+  G+ LA+VG D    + +W+WK  + +  ++     I+ V  +  +   L TAG  H++FW+ A     +  +G +G  GK  T +  + G+    +    SG+  G++ +W D  L+K           H G +  +   E   +T G DG +  WD ++ +       +   ++ P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   + A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   + N            + TL ++     +  H K I S    +   GK L   S D  V  +++  S+   +G  K     I H++W
Sbjct:  730 ILCLAIHPLKDYVATGQVGRD--PSIHVWDTETIKPLSILKGYHQYGICAVDFSADGKRLASVGIDDSHTIVLWDWKKGEKLSVTRGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRRAGGGL-IGKKGYVGTLGKNDTMMCAVYGWT---EEMAFSGTSTGDVCIWRDVFLVKTV-------KAHDGPVFSMHALEKGFVTGGKDGMVALWD-DSFERCLKTYAIKRADLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRC----CCFSPDGKALAVGLNDGSFLMAN------------ADTLEDL----VSFHHRKDIISDIRFSPGSGKYLAVASHDSFVDIYNVTSSK--RVGVCKGATSYITHIDW 1133          

HSP 3 Score: 78.1814 bits (191), Expect = 1.338e-13
Identity = 89/436 (20.41%), Postives = 182/436 (41.74%), Query Frame = 1
Query:  403 SFGYNCQK-RDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTA------IYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQV 1641
            +FGY  +  R+N+  L D   + Y + +     N++  + S+ +    + I C+ V  HP  + +    +  DS  ++A      I++  + +   ILR    K      F+ +G+LL +VG DP+  +T+W W+    +      +Q I+   +  D +    + G  H++FW +A    G  L    G     E + ++  + +  G      +G+  G++ VW   ++   + R +  P    ++   + +I+  G+       G +  WD E        ++T +V + + +        L+ + +++++  V       +I      +G IW L    +H S              RD       +LSA+   DG++R++D A +K++ ++        + ++     P+G  V  G  +G   IL  S +
Sbjct: 1376 AFGYRGRDCRNNVHYLNDGDDIIYHTASIGILHNVATGTQSFYQE-HNDDILCLTVNQHPKFINIVATGQVGDSADMSATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFRPDSDTQFVSVGIKHVKFWTLA----GRALLSKKGLLSSLEDARMQTMLAVAFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETGQVTDCVRSVCRGKGKILVGTRNSEIIE-VGEKNAACNILVNGHVDGPIWGLA---THPS--------------RD------FFLSAA--EDGTVRLWDIADKKMLNKVNLGHAARTVCYS-----PEGDMVAIGMKNGEFIILLVSSL 1775          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Mouse
Match: Eml5 (echinoderm microtubule associated protein like 5 [Source:MGI Symbol;Acc:MGI:2442513])

HSP 1 Score: 93.9745 bits (232), Expect = 1.888e-18
Identity = 102/448 (22.77%), Postives = 188/448 (41.96%), Query Frame = 1
Query:  547 IGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGK--TEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            I C+A+HP K Y+A G+   D  P   +++  ++K   IL+   +       F+  G+ LA+VG D    + +W+WK  + +  ++     I+ V  +  +   L TAG  H++FW+ A     +  +G +G  GK  T +  + G+    +    SG+  G++ +W D  L+K           H G +  +   E   +T G DG +  WD ++ +       +   ++ P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   + A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   + N            + TL ++     +  H K I S    +   GK L   S D  V  +++  S+   +G  K     I H++W
Sbjct:  691 ILCLAIHPLKDYVATGQVGRD--PSIHVWDTETIKPLSILKGYHQYGICAVDFSADGKRLASVGIDDSHTIVLWDWKKGEKLSVTRGSKDKIFVVKMNPYVPDKLITAGIKHMKFWRRAGGGL-IGKKGYVGTLGKNDTMMCAVYGWT---EEMAFSGTSTGDVCIWRDVFLVKTV-------KAHDGPVFSMHALEKGFVTGGKDGMVALWD-DSFERCLKTYAIKRADLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRC----CCFSPDGKALAVGLNDGSFLMAN------------ADTLEDL----VSFHHRKDIISDIRFSPGSGKYLAVASHDSFVDIYNVTSSK--RVGVCKGATSYITHIDW 1094          

HSP 2 Score: 88.1965 bits (217), Expect = 1.230e-16
Identity = 78/323 (24.15%), Postives = 137/323 (42.41%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNEL--LVSNDAKLMHVVKSPETESSIWYAQD 1326
            PS  ++L   +GY   Q R+NL     + + Y         +  +    + R  S + I  +A+HP ++ +A G+   +  P   +++  +++   +L+D      +   F+  G+ L +VG D    + VW+WK  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  WD  F+ I   ++ E    ++     EL  L  +  K + V  S +    IW   D
Sbjct:    7 PSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFFRGHSDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSVLKDVHTHGIACLAFDLDGQRLVSVGLDSKNAVCVWDWKRGRMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC----GNALTPKRGVFGKTGDLQTILCLACARDELTYSGALNGDIYVWKG----INLIRTIQGAHTAGIFSMNSCEEG-FATGGRDGCIRLWDLTFKPITVIDLRETEQGYKGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVD 317          

HSP 3 Score: 75.8702 bits (185), Expect = 6.009e-13
Identity = 89/436 (20.41%), Postives = 182/436 (41.74%), Query Frame = 1
Query:  403 SFGYNCQK-RDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKM-YLAVGEKK-----SDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQV 1641
            +FGY  +  R+N+  L D   + Y + +     N++  + S+ +    + I C+ V  HP  +  +A G+       + + P   I++  + +   ILR    K      F+ +G+LL +VG DP+  +T+W W+    +      +Q I+   +  D +    + G  H++FW +A    G  L    G     E + ++  + +  G      +G+  G++ VW   ++   + R +  P    ++   + +I+  G+       G +  WD E        ++T +V + + +        L+ + +++++  V       +I      +G IW L    +H S              RD       +LSA+   DG++R++D A +K++ ++        + ++     P+G  V  G  +G   IL  S +
Sbjct: 1329 AFGYRGRDCRNNVHYLNDGDDIIYHTASIGILHNVATGTQSFYQE-HNDDILCLTVNQHPKFINIVATGQVGIFYLCAATAPSVHIWDAVNKQTLSILRCSHSKGVCSVSFSATGKLLLSVGLDPEHTVTIWRWQEGAKIASRGGHNQRIFVAEFRPDSDTQFVSVGIKHVKFWTLA----GRALLSKKGLLSSLEDARMQTMLAVAFGANNLTFTGTISGDVCVWKDHILCRVVARAHNGPVFAMYTTLRDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETGQVTDCVRSVCRGKGKILVGTRNSEIIE-VGEKNAACNILVNGHVDGPIWGLA---THPS--------------RD------FFLSAA--EDGTVRLWDIADKKMLNKVNLGHAARTVCYS-----PEGDMVAIGMKNGEFIILLVSSL 1728          
BLAST of cilia- and flagella-associated protein 44-like vs. UniProt/SwissProt
Match: sp|E9Q5M6|CFA44_MOUSE (Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 552/1445 (38.20%), Postives = 846/1445 (58.55%), Query Frame = 1
Query:  235 PTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSK--TYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEK--PFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAK-TVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPS-------TFGVQNVFDE-VDEPGKIEDSFAKYNLKGARGMRVARQL---KKLDDNRRKRSF----RKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIE-LCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXX------XAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKV 4482
            P+Q EPPVE  +  + + + K V+ E FYYDY E +S P++S E  +P   + L HSFGY+C+KR NL LLD  TL Y++GN +  ++  D +  YL+S SG+GIG + VHP K Y AV EK   S P   IYEYPSLK YRILRDG EKAY+Y  FN  G LLA+VG  PD+ +T+W WK EQ +LR+KAFSQD+++V ++ D +  LTT+G+GHI+FW+MA TFTGLKLQG +G+FGKT  SDIEG+  LPDGKVLSGSEWGN+L+W+G LIKV++ R   K CHSG+INQI+++EGE++T G+DG +  WDFETIDTA+V ++    E++P+NEL +     L  ++K  E  ++ W AQD NG IWKLDLSFS+ +  PE L +FHSG I    VSPL+YL A+   D S+RV+DF+++  +  MKF   G+ ++WAP  V      ++ GF DGV+R+L     + L     +K     E+HL    KPHT ++T+L+ +  G IL TGSED+TVFFF +   EY PIGF     PI  + W       P++    +++    G + E +CP    VD     T+ +  +  +  + F S+KS +    E++++  ++  ++K   + R +  E      EE+  + E  E+   EE    E ++P  P   SPIL GF   ++  KFW+S+G YDAG+LY C+FPS    +  +  E  NEP +   L N+ D P+ ++ +S+    +  G  NG+IR+  L +  PF L ++   W ++VHDNNYGSI S+  S+D+++L++ G DGN FV++I  E +  K I   +A++PS +  ++S+   +DIEDP AYSIE  ++K E+D+ ++  +E KA   ++I  L+ +F  L + N +LP  +Q     F +  K+  ++ +    KI+ V K++A++ +KH + L KL+ RFREPLE D IV++A +S+H +++ +    S       S L+R  Q  S +  SK   +  + P        T G  ++ +E V E GK      K+  +    + V  Q+   KKL     +  F    RK +W+ LY  KP +++EDP+D+ AI+EA+  MGDF LK++ DY + E  R NA K  +EL  ++      +   N  IL LR+ K  +IE I+   ++++ + +++   +  P+     IYP+E PE++F+Y +ETL+ F+++ ++R+      ++      ++      F K S+ + G   T+      S+   L E P  V  E   P    SD + E     ++K +Y+ + + N   +    FD +L LLRH+K      ++ + L  LT+F+E  LLK +EK E  L E+      E+ D+  K+ E   +++ KK +I +L ++++  +  F+ +LGENNKFA +L KV
Sbjct:   73 PSQ-EPPVE--VKEEPEADVKKVLSETFYYDYPELVSIPYVSSEERIPLYFLTLNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEK--GSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTGMKSCHSGSINQIMLDEGEVITAGSDGSVRIWDFETIDTADVIDDTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQDGVVRVLELFDPKGLTVYAGRKKIPDAELHLKYVFKPHTDEVTALAYERDGDILATGSEDKTVFFFDVE-KEYKPIGFFNTPGPICQLMWSPA--SHPEKT---LLIICENGYILESLCPTIKDVDDQNVITFAIPNVF-LRCFHFTSVKSKILRFLEVQRREQQKMLKEKEKLERRMKLAEEREAFGEEEIPEEETSEEGEEEEPPLPEIFMPPTP---SPILCGFY--SEPGKFWVSLGNYDAGFLYHCQFPSYLHNSDFQKQE--NEPFDFRVLENTEDNPIRNITFSNDQTMMFCGMTNGAIRVYVLSENDPF-LVSLQHYWHFNVHDNNYGSIKSITSSFDDQYLLTAGEDGNIFVFDIFSEFIVPKGI---KAKVPSPRFGIESEAAPEDIEDPKAYSIENARKKREHDKLMKKVEELKAHKREQIKILRNEFWKLLELNKELPAHMQFQRTDFNIDAKIHAEIHKKTSLKIEQVEKELAWEKQKHELGLKKLQDRFREPLESDTIVVYATQSDHQIASYRLVKPSK-----YSKLKRPSQ--SERRQSKMERLEKEGPGKKESQRDTGGSISLQEESVLEKGK------KFRPRTLSEIMVENQIEKTKKLIQQAERAQFKILQRKKEWEELYKSKPDDDYEDPKDVQAIKEAQTYMGDFNLKTAPDYKIPEHMRINAAKKEEELGYLDTMAHGKKRYMNKCILSLRDLKLAVIEEIQCLVQELKNIQSSIPASKHMPIPQVPQIYPEEVPERRFQYDEETLLRFQRKQKKRQDKSSSKQSGTGSGGSAGGGLVGFLKLSSGKEGDLTTRDSLSRSSKASALLELPKPVEFEKAEP----SDAELEIMKRDEVKHLYMQQFLCNRINELTVTFDAELHLLRHQKLKLDTKMKLSDLHHLTLFQEMLLLKNFEKQENILQERVNSLDKEEQDMQWKINETLKEMEEKKNEITKLQDQEKALYAGFQAALGENNKFANFLMKV 1477          

HSP 2 Score: 124.405 bits (311), Expect = 8.693e-27
Identity = 114/309 (36.89%), Postives = 178/309 (57.61%), Query Frame = 1
Query: 4660 VYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMN 5586
            V+D  +CP  C   L++   QLRE  LDIEE + EEKK+ + LKKE + ++KK KVV   L  A++ LEA+Q EKQQ+LN+L  ++ LKLHQI   E G +P D+   L+F   +   L+ RI +LQ+E  KQ    K+ + R   L + ++   + IS+ +    E+M +KFG++ +LE ++ + +N  +EEL  K L  +     E   WE++I   +   + + K +T  L  + +L  EK+ L+ +LN+ Q   G  FQ    A      K+ +LV  Q +++ ALKEEI +L +KGG +LPP+ 
Sbjct: 1523 VFDDSICPTNCDVSLFELALQLREKRLDIEEALVEEKKIVDNLKKEYDTISKKVKVVATNLNAAEEALEAYQREKQQRLNELLVVIPLKLHQIEYMEFGEVPEDLSGTLVFSNHSLDRLQERIVQLQEENAKQQKLNKECRERRKLLIREKREMAKTISKMEETVRELMISKFGRVIDLEALQTLSVNTTLEELKIKKLRKELSNAKELRMWEEKIAQVRWDLMMKTKEHTKKLHQMNDLCLEKKKLDSRLNTLQNQQGNAFQGLRKADIVAKQKVTELVQTQLEKITALKEEIELLRKKGGLLLPPIT 1831          
BLAST of cilia- and flagella-associated protein 44-like vs. UniProt/SwissProt
Match: sp|Q96MT7|CFA44_HUMAN (Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 551/1414 (38.97%), Postives = 842/1414 (59.55%), Query Frame = 1
Query:  304 IPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPN--PSSVDHS-KTYELREIEPINSYKFVSIKS-VXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNL-EKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAK-TVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSD-EYFQILSDLER--IRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLK-------KLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIK---KTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEE--NSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAED-PTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYL 4473
            I E F+YDY E  S PF++ +S +P +++ L HSFGY+C+KR NL LLD     YI+GN + F+NL      YLRS SGEGIG + VHP K Y  V EK   S P   IYEYPSL+ YR+LRDGTEK Y+Y  FN SG LLA+VGS+PD+ LT+W WK EQ +LR+KAFSQ++++V ++ D E  LTT+G+GHI+FW+MA TFTGLKLQG +G+FGKT  +DIEG++ LPDGKVLSGSEWGNML+W+G LIKV++ R   K CH+G INQI++ EGE++T+G+DG +  WDFETIDTA+V +E    E++P+NEL V  +  L  ++K  ET ++ W AQD NG IWKLDLSFS+ +  PE L +FHSG I    VSPL+YL A+   D S+R++DFA++  +A+MKF   G+ ++W P  V+  G  +I GF DGV+RIL     + L     +K     +I L Q  KPHT  +T+L+ +  G+IL TGS+D+TVFFF +   +Y PIG++    P+  + W       P+     +++    G + E   P       DH   +YE++++  I  + F S+KS +LR  E  +++R  E + +    +  K   E G + E+E  ++ EE E+   EE    E ++P  P   SPIL GF   ++  KFW+S+G YD+G+LY CEFP  D+ +  K  E+ +EPI+   L ++ D P+ ++ ++ +   +  G +NG+IR+  L +    L ++   W +++HDNNYG I S+  S+D++FLV+ G DGN FV+ I  E +  K +   +A++PS +  ++++   +DIEDP AYSIE  ++K E+D+ ++   E KA   ++I  L+ +F NL + N+KLPK +Q     F++  ++R ++ R    KIQ V K++A++ EKH + L KL+ RFR+PLE D IV+HAI S+H +S+ +    S    F+  S  ER   + D   K+          A  +  +Q   + + E GK      K+  K    + V  Q++       K +  + K   RK +W+ LY  KP +++EDP+D+ AI+EA+  MGDF LK++ DY + E  R NA K  +EL  +++ +   +   N  IL LR+ K  ++E I+   +  K I+   ++ K    P +P   I+P+E PEK+F+Y +ETL+ FK++  + K     G E   S      F K S+ + G   T+      S+  T + D P  +  E   P  V  ++ +      ++K +Y+ + ++N   + +  FD +L+LLRH+K      ++ + L  +T+F+E  LLK +EK E  L E+      E+  +  K+ E   +++ KK +I +L E+++  +  F+ ++GENNKFA +L
Sbjct:  105 ISESFFYDYMELASMPFVTLDSNIPLDLLTLVHSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEK--GSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRGTSKSCHNGPINQIMLYEGEVITVGSDGYVRIWDFETIDTADVIDETGLLEIEPINELQVDKNVNLFSMIKMNETGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGAIEAVAVSPLTYLMATTALDCSVRIYDFASKTPLAQMKFKQGGTALVWVPRMVNFTGAQIIVGFEDGVVRILELYDPKGLTIFAGRKKILDADIQLKQVFKPHTACVTALAYERDGEILATGSKDQTVFFFEVE-RDYKPIGYINTPGPVCQLMWSPM--SHPE---STLLIICENGYILEAPLPTIKQEEDDHDVVSYEIKDM-CIKCFHFSSVKSKILRLIEIEKRERQRELKEKIREERRNKLAAEMGEDGEKEFQEEEEEKEEEEEEEEPLPEIFIPSTP---SPILCGFY--SEPGKFWVSLGGYDSGFLYHCEFPPCDESSDFK--EQKDEPIDVRYLADTEDNPIQTITFNINKVMMFCGMKNGAIRVYVLNQNDPSLTSLVDYWHFNMHDNNYGCIKSIANSFDDRFLVTAGADGNIFVFNIFSEFMLRKDM---KAKVPSPRFGIETEPIPEDIEDPKAYSIENARRKREHDKLMKEVGEIKARKREQIKALRSEFCNLLEMNEKLPKHMQFKRTDFDVDSQIRAEMHRKTAFKIQQVEKELAWEKEKHELGLMKLKNRFRDPLESDTIVVHAILSDHKISSYRLVQPSKYSKFKRASQSERKPSKLDRFEKEGPGRKDSQRDAGGSVTIQE--ESIIEKGK------KFRPKTLSEIIVENQIEKTRKLILKAERAQLKIQQRKKEWEELYKSKPGDDYEDPKDLQAIKEAQVYMGDFNLKTAPDYKIPEHMRINAAKKEEELGHLDSLVHGNKRHMNKCILSLRDLKVAVVEEIQCLVQELKNIQSTLHISKHIPIPKIPQ--IHPEEVPEKRFQYDEETLLNFKQQQMKSKDEKSPGVEQTGSGGPVGGFLKLSSRKDGDLTTRDSISRSSKASTFSLDIPKCLEFEKAEPTDVELEIMKR----DEIKHVYMQQYLVNRIKELVVTFDAELRLLRHQKLKLDTQMKLSDLHHVTLFQEILLLKNFEKQENILQERVNSLDKEEQYMQWKINETLKEMEEKKNEITKLQEQEKALYAGFQAAIGENNKFANFL 1485          

HSP 2 Score: 141.739 bits (356), Expect = 3.909e-32
Identity = 112/310 (36.13%), Postives = 182/310 (58.71%), Query Frame = 1
Query: 4660 VYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISK--LNQLVHIQAQELDALKEEIGMLSRKGGHILPPM 5583
            V+D  +CP  C   L++    LRE  LDIEE + EEKK+ + LKKE + L+KK K+V   L  A++ LEA+Q EKQQ+LN+L  ++ LKLHQI     G +PSD+   L+F     + L+ RI +LQ+E  KQ    K+ + R  +L + ++   + I + +    ++M +KFG++ NLE ++ + +N  +EEL  + L  +     E   WE++I   + + + + K +T  L  + +L  EK+ L+ +LN+ Q   G  FQ  GP   + +++  + +L+ +QA+ + ALKEEI +L RKG  ILPP+
Sbjct: 1534 VFDDSICPTNCDVALFELALHLREKRLDIEEALVEEKKIVDNLKKEYDTLSKKVKIVATNLNAAEEALEAYQREKQQRLNELLVVIPLKLHQIEYVVFGEIPSDLSGTLVFSNHALRRLQERIHELQEENSKQQKLNKEWRERRKQLIREKREMTKTIHKMEETVRQLMISKFGRVVNLEALQTLSVNTTLEELKIRKLRKELANAKEMKMWEEKIAQMRWELMMKTKEHTRKLYQMNDLCIEKKKLDSRLNTLQNQQGNAFQ--GPREADVVAREEVTELIQLQAERISALKEEIALLRRKGSLILPPI 1841          
BLAST of cilia- and flagella-associated protein 44-like vs. UniProt/SwissProt
Match: sp|A8J1V4|CFA44_CHLRE (Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 2.299e-97
Identity = 200/591 (33.84%), Postives = 303/591 (51.27%), Query Frame = 1
Query:  352 FISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSP----PVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTS-GELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEE--GELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHS---GEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKF--NFEGSKILWAPLKVDPKGK-TVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSIN------------PSEYL--PIGFVKLNKPIHHVE---WKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFV 2034
             +S+ +G    V +L    G +  +R+NL LLD+ T        +  ++LS  +  YL    G G+G +AVHP++  LAVGEK    P    P   IY YP L++ ++LR GTE+AYS   F+   G+ LA+VG  PDF+LT+W+W+ E  VLR+KAFSQD+Y VA+S   EG LTT+G GHIRFW+MA TFTGLKLQG IGKFG  E+SD+  FV LPDGKVLS +E G +L+WDG LIKV + R   +PCH G I  ++++   G +++ G DG++  WDF  ++ AE  E+  + E+ P++E++V+  A L  ++   ++    W   D  G ++ + L  +       ++    S   G +    +S  ++ +    +DG LR  D+ +  ++AE            L A     P G  T   G+ DGV+R+              ++    + L+   K H   + +L+    G  L++  ED +VFFF +             P+  L  P  F+KL      V    W+A  EG      G +++    G +  V  P P    H           ++SY+ V
Sbjct:    7 LLSQRTG---GVAQLLSVHGLDTHRRNNLVLLDEDTAASCIAGQLVLLSLSTGARRYLPGRDGGGVGAVAVHPSRTLLAVGEKARPGPASAGPAVYIYSYPGLEVVKVLRGGTERAYSALAFDGERGDTLASVGHFPDFLLTLWDWRQEAIVLRAKAFSQDVYGVAFSPYFEGQLTTSGQGHIRFWRMASTFTGLKLQGAIGKFGNVELSDVAAFVELPDGKVLSSTETGELLLWDGGLIKVVLTRPGSRPCHDGPIEALLLDRPAGRVLSAGADGRVRMWDFGAVNDAEPREDSHSLELSPLDEVVVAEGAALSALLA--DSGGRRWVVADKAGNVYTVALPPAGPVGKGAVVTRVASHPAGAVAGLQLSARTHTALVASADGCLRALDYVSGAVLAEAATPQRITAFTPLPAASPACPGGAMTAATGYRDGVVRL-------------HARCAEGLALVGVAKAHKGAVAALAVSADGGRLVSAGEDGSVFFFDLTAQPQPGTGVPGMPACGLLAPRAFIKLPSGSGTVTCGVWEAA-EG------GGVLLGTNRGTILSVPLPPPDLNTHHSYEWAAGTSAVSSYQLV 572          

HSP 2 Score: 159.073 bits (401), Expect = 1.940e-37
Identity = 119/456 (26.10%), Postives = 212/456 (46.49%), Query Frame = 1
Query: 2392 KYNEPINHPGLLNSNDVPVTSMKWSSS-GKRVIMGCENGSIRLQNLEKPFDLRTMTSC--WQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMR------------VARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIK 3714
            +  EP+  P L      PVT +  +   G+  ++G  +G +RLQ LE+PF      +   W+  +HD   G ++ L +S+D  +LV+   DG   +  +                 P         +  D+    AY++EE KQ++E D++VR A+EKK S  +++G ++ +F+ L  +N+  P+ +++     E+ P LR  +      + +V   ++A++SE+  + L KL + F + LE + +V+H++    TV+T +   LSDE           R +++    +        A +         + D  GK  D+        A   R             + +L K D  R  R  R+ +W      +P + ++ P D+AAIEEAR  +GDFKLKS  +Y V E+ER    + R  ++ +E  +  I + FN K   LR+ K +++  ++
Sbjct:  685 RMGEPLAAPLLEGFASAPVTCLAHAGPEGRLALLGSGDGLVRLQALEEPFGSAAPGALPLWEAPLHDMQSGRVSGLGLSHDGAYLVTAAADGALHLLALALPPELAPPPTTQPGDEPLPGPAALPLRPPDVLAAAAYTLEEEKQQAERDQQVREAEEKKLSVRQRLGLIRAEFEALLAENEAAPEALRLPRADLEVDPGLRALMEAEALRREEVARLELAWESERQRLGLAKLRRYFLDGLESERVVLHSLRGSSTVTTFRVAKLSDE----------TRAELAAMRQAARAAAAASAAAGGEGGAGGRDTDARGKGSDTGGGPGGDAAARARLAEATAALEEGTASGKLNKADLRRLARKRREAEWAAFNGTRPDDTYDSPADLAAIEEARRTIGDFKLKSDPNYVVPEEERLTPQRKRLAMLELEEALHDIAAAFNAKFFALRDVKRKVLADVR 1130          

HSP 3 Score: 125.561 bits (314), Expect = 3.637e-27
Identity = 96/295 (32.54%), Postives = 162/295 (54.92%), Query Frame = 1
Query: 4675 MCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRK 5559
            +CPPGC Q +Y+  C LRE  LD E+ + E  K  E L+KE+E L KK ++VE  L     ++  FQ EKQ +LNQ++ IV L++HQI    +G LP D+ A L+F AS  + L+ R+++L++E+       K+++ +H  L +++   + +++E +    ++   KFG++ +LE +++V  +   EEL   +   +     E +EW+ +I    ++ +   + NT  L+ +  L   +  LE  L + +K L  +      A  EE   L  LV+ QA ELD LK ++  L RK
Sbjct: 1464 VCPPGCDQSVYERVCDLREKRLDEEDMIAEFTKTIEVLRKEKEALAKKQRLVEQGLAAVNADMAEFQKEKQGRLNQVEVIVALRMHQIEYLLDGCLPDDLSACLVFSASQLRRLQARVDELEEEKAGLRAAHKELRRQHAALLRDKADKEARVAELEARAHDVQMLKFGQVIDLELLDRVSSSRGTEELREDLKKQELAYARELAEWDAKINARMDELVVLTRENTACLNAVSELTAAQRRLESGLTATRKGLFADPVQQRRAEVEERDALVALVNAQAAELDRLKGQLLALRRK 1758          
BLAST of cilia- and flagella-associated protein 44-like vs. UniProt/SwissProt
Match: sp|Q57WH1|CFA44_TRYB2 (Cilia- and flagella-associated protein 44 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=CFAP44 PE=3 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 4.654e-73
Identity = 179/585 (30.60%), Postives = 274/585 (46.84%), Query Frame = 1
Query:  400 HSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKK------------------PCHSGTINQIIIEEGE--LMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNT--------------FHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSI--NPSEYLPIGFVKLNKP-IHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIK 2043
            HS  YN      +  L   T+   SG ++ F+++   +   ++     G+G +AVHP++ Y  V E+K   P + A Y +PS         G  K +S C FN  G ++ATVG  PDF LTVW+W++   VLRSK  + D+Y V +S    G+L + G GHI+FW MA+TFTGLKLQG +GKFG+ EIS++ GFVVL DGKV+SGSE G +++W+G+LI+    R+  +                  PCH G IN + + EG   LMT G DG    W    ++ AE       +  + + E+LV   A +  V    + +   W   D  G +W+  + + H   P +ILN               F+ G I    +SP+ +   + G DG++R+ D+   + + +M        I     + DP+ K  +A    G + ++           K+  T     L+   +PH   +   + D     L T +   TVFFF+I  + S   PIGF K+  P    V W        D+     ++    G++  +  P    VD S +YE        +Y  V I+
Sbjct:   34 HSMRYN-----GVCALTGSTVLMASGRFVMFVDVHKGTIESMQGPENGGVGAVAVHPSRQYYVVCERKPSDPAIRA-YSWPSRTEVGEFVKGATKGFSACAFNKDGSMMATVGMYPDFFLTVWDWESRGMVLRSKCHNTDVYTVLFSPFDSGLLVSGGAGHIKFWTMANTFTGLKLQGLLGKFGRLEISNVSGFVVLSDGKVISGSESGLIILWEGDLIRCCFAREVDREDDDGTAATFMARSYDYTPCHEGAINVVELMEGGRVLMTAGDDGYFRFWRVSELEVAEGEGAPPLYVPECLGEILVHAGAFIRSVTYCKDVDE--WVVLDSAGVLWR--VPYVH---PDDILNNAVTKPKEQAVPALEFNGGSITSAALSPIDHTVVTGGEDGTIRLVDYVTPRELYKMCLPQPNVVIGLRFFQKDPEKKKFLACCKSGAVLLV-----------KRGST--AFTLLGQWRPHNDGLALFAVDAAEHRLCTIAHG-TVFFFTILDDFSSLEPIGFCKIPLPGATCVAW--------DDASSCCLIGFECGKLLAIRAPTRDMVDQSVSYEF-----TCNYALVGIR 578          

HSP 2 Score: 104.76 bits (260), Expect = 7.479e-21
Identity = 128/550 (23.27%), Postives = 242/550 (44.00%), Query Frame = 1
Query: 2284 TDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEP---INHPGL-LNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPN--AYSIEEHKQKSEYDRKVRLAQEKKAST---LKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKG--CNLSDEYFQ--------------ILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARG---MRVARQ-LKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLI 3846
             D D F +  G  +  Y Y        +K L  +P    EP   +  P + L   D    +   S SG+ +++ CE   + L+ L++   +R +      S HD   G I + C S+D+K LVSVG+DG   V +++D  +  +         PS        + ++I +P    +SI E K   + D + R   EK+      L K+ ++ +++  L  +N  L    ++S     + P++  +L     ++++   K  A +  + +I   K+  RF + L  D  ++ +   E +V++ +    + S + FQ              +  D +R    +++ + S+++       +  GV    +  +E  + E    K N             RQ L K+D+ R +R +RK  ++ L A KP    E+      +     + G+  L++   Y       P+A+   Q+LI +E  IF +R+ F+ ++LKLR+EK  +  T+  + ++I   N   KD K     ++ + P+E P K+FE +++ L+
Sbjct:  620 ADGD-FAIGAGGVELLYKYGLHVRYEGQKELPPLPPTGIEPPDYVEEPLMNLCYRDYTPEASSMSYSGRYLVVICEGSQMLLRQLDEMGRVR-LEPILVASAHDRLDGPIAAACTSFDDKMLVSVGSDG-LVVAQLLDGCIAPQP--------PSPVAQLQPLRAEEIVEPQLAPFSITEQK---DLDDRRRAEDEKRRELNLFLDKLKDVHQKYARLLRENQSLALTHRLSKEEITIHPQIYRELQEEMRQRVEESRKPTALELARENIRTRKMRNRFVDNLAHDRFLVRSFSKEFSVASFRTPYVDGSIKLFQQQIDELLGSERCSSLACDGDRGIVSVASGEASQQSPRNLSLSTAAGVVRWLNS-EERKRNEGEQQKMNAAHREAEILTTTMRQYLNKMDERREERHWRKKGYEMLLAHKPDPAVEEASLNEELRRETRRRGECILRTDPSY----HSAPSAVIKLQQLIRLEEIIFNMRNNFSNELLKLRDEKERLCGTLNVSLQRIRAINEKLKD-KSFHADDVKLTPEEMPGKRFEISRDGLV 1149          

HSP 3 Score: 74.7146 bits (182), Expect = 9.331e-12
Identity = 87/311 (27.97%), Postives = 154/311 (49.52%), Query Frame = 1
Query: 4672 DMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQI-LLHENGVLPSDI--DAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDA-------QEKCIEEIKFNTCTLDHILNLFNEKEILEDKL-NSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHI 5571
            ++CPP CS+E +    + RE+ LD  + + EE++  EA ++  E          AA+    K +E FQ EK+++LN L+T+V ++  Q+  L E G  P     +  ++        L  RI  L +E+  +    K +      LQ+ R   Q   ++++ +  E M  KFG++ NLE +E    + ++E+L       ++ +  E+  WE  +R         +EK  E +++NT  L  I +  ++++ +E  L  S QK +   +     A EE+ S L  L+  Q +E+DAL+ E+ +L  KGGH+
Sbjct: 1448 EICPPNCSEERWCEVIEKREVRLDYVDAITEERRQLEATEQRIEEHKALADKNNAAVSTCLKAIEDFQGEKRKQLNMLETLVAMRCGQVRCLDEEGRCPDTFRRNDLVVVSDKVITGLHDRIRALAEEKHDRRGKLKSMVAEQQALQRERSEKQALHTQWEEKIYEAMLLKFGQIVNLEVLESSCGSREVEQL-------KERLRLEELSWEKELRKRDKKIAVLREKLHESLEYNTSLLQTIGDQESDRQSVERSLAQSTQKVVSKMYDSINVATEEDRSNLRLLIAAQQEEIDALRTEVALLRTKGGHV 1751          
BLAST of cilia- and flagella-associated protein 44-like vs. UniProt/SwissProt
Match: sp|Q6ZMW3|EMAL6_HUMAN (Echinoderm microtubule-associated protein-like 6 OS=Homo sapiens OX=9606 GN=EML6 PE=2 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 1.164e-21
Identity = 138/593 (23.27%), Postives = 248/593 (41.82%), Query Frame = 1
Query:  130 INNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLA--HSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMA-DTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            ++N M + A   +GG+  + ++EE+  DS +  V     +   E +IN+ RQ  KE+   +P+      E+  + PF+  E   P + +KL   H + GY+C  R+NL       + Y I+   + +         YL     + I  + +HP K Y+A G+   D+     +++  +LK   +L+   ++      F+  G+ L +VG D    +  W+WK  + +  ++     I+ V  +      L T G  HI+FW+ A   FT  +  G  G  GK E      +  + D  V SG+  G++ +W   L+   +        H G +  +   +   +T G DG +  WD  FE       A + +         LL  N +     +++             NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A+  M  ++   +G +         P GK +  G +DG   ++N   V         + +   H       H K++ S    + D GK L   S D  V  +++  S+   +G  K  +  I H++W
Sbjct:  598 VSNGMLETAPQ-EGGA--DSYSEES--DSDLSDVPELDSDIEQEAQINYDRQVYKED---LPQLKQQSKEKNHAVPFLKREKA-PEDSLKLQFIHGYRGYDC--RNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGH--DDDILSLTIHPVKDYVATGQVGRDAA--IHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKR--GTFGSVGKLETMMCVSYGRMED-LVFSGAATGDIFIWKDILLLKTV------KAHDGPVFAMYALDKGFVTGGKDGIVELWDDMFERC-LKTYAIKRSALSTSSKGLLLEDNPS-----IRAITLGHGHILVGTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSAQHRMLAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVNADTV---------EDMVSFH-------HRKEMISDIKFSKDTGKYLAVASHDNFVDIYNVLTSK--RVGICKGASSYITHIDW 1133          

HSP 2 Score: 96.2857 bits (238), Expect = 3.037e-18
Identity = 115/508 (22.64%), Postives = 203/508 (39.96%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEW 1869
            P   ++L   +GY   Q R+NL     + + Y         N  + S  +    + + I  +A+HP K  +A G+   +  P   I++  +++   +L+D      +   F++ G+ LA+VG D    + +W+W+  + +  +   S  I+ ++W       + + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG I  W  DF+ I   ++ E    ++   +  +    D +L+   +  E    I   +D                 P  IL     GE+    + P   L+ +   D S+R++  A   L+A  + N E +      +   P G  +  G  DG   V+R+ + ++V              +H+    K   + I  +     G  L  GS D  V  +++    Y  IG   K    I H++W
Sbjct:    7 PRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGVVYNTREHSQKFFLGHNDDIIS-LALHPDKTLVATGQVGKE--PYICIWDSYNVQTVSLLKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFW----TLCGNALTAKRGIFGKT--GDLQTILCLACAKEDITYSGALNGDIYVWKG----LNLVRTIQGAHSAGIFSMYACEEG-FATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWKAD-RLLAGTQDSEIFEVIVRERD----------------KPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIA--RCNMEEAV---RSVAFSPDGSQLALGMKDGSFIVLRVRDMTEV--------------VHI----KDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAV-AQRYKKIGECSKSLSFITHIDW 459          

HSP 3 Score: 93.9745 bits (232), Expect = 1.491e-17
Identity = 111/497 (22.33%), Postives = 197/497 (39.64%), Query Frame = 1
Query:  388 VKLAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG--VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVK 1839
            + L H FGY   +C  R+NL  L D   + + +       NLS  S S+    + + I C+ V  HP K    V   +  + P   I++  +     +LR    K  +Y  F+ +G+LL +VG DP+  +TVW W+    V       + I+ V +  D +    + G  H++FW +A +   L  +G IG  G  ++  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++           +L+  V+S             +G+I    +     +A   IL   H  GEI      P   L  S  +DG+ R++D A +KL+ ++          ++     P G+ V  G  +G  VI ++N  +V      +KS                  I  +      + L  GS + TV F+ +     L  IG+ K
Sbjct: 1363 LALDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAGIVQNLSTGSQSFYLEHTDD-ILCLTVNQHP-KYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHSKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSAL-LYKKGVIGSLGAAKMQTMLSVAFGANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLET---------GQLVECVRSVCRGKGKILVGTKDGEI----IEVGEKNAASNILIDGHMEGEIWGLATHPSKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYS-----PDGEMVAIGMKNGEFVILLVNSLKVWGKKRDRKS-----------------AIQDIRISPDNRFLAVGSSEHTVDFYDLTQGTNLNRIGYCK 1812          
BLAST of cilia- and flagella-associated protein 44-like vs. TrEMBL
Match: A0A1I8J1G7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1543.1 bits (3994), Expect = 0.000e+0
Identity = 860/1814 (47.41%), Postives = 1247/1814 (68.74%), Query Frame = 1
Query:  229 VQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVK---------SPETE-SSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILIT-GSEDE---------TVFFFSINPSEYLPIGFVKLNKPIHHVEWKAT-VEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIM-DENLQEKQIEEYRAR---LPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCN-NVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMN 5586
            + P  +E    +E N   Q  +E+K  IP DF+Y+  EF+SKP ++E+SGLP+++++L +S+GY+C KRDNL +LD+Q +C+++GN ++ +NL+    ++LRS SG G+G ++VHPT+ YLAV EK     P   +YEYPSL+LYRILR GTE+AY YC+F+ SG+ LATVGS+PDFMLT+W+W +E+TVLRSKAFSQD+YRV+WS DLEG LTTAGTGH+RFWKMA TFTGLKLQG IGKFGKTEISDIEGFV LPDGKVLSG EWGNMLVWDG LIKV+I +K K+P H+G I Q++++ GELMT+G DG I TWDFE IDTAE  +E    EMDPMN   V N+ +L H+VK         + E E SS W AQD NG IW+LDLSFSHT+ PPE L + H+G I  C  SPLSYL A++G+DGS+RV DF A++ + E +F+  G+KILWAP  VDPKG+T++AGF DGV+R+L+F +  +TD ++K+K + E+ L+ A KPHT ++  +  D  G +L+T G E E         ++FFFS++ S+Y P+GF++       + W ++  + +PD+    + V+  +G V +  CP+P+ VD S TYEL   +    + F S+KS LR  EELE+    E E  K  A+ERK +LERG++TEEEQ K++E++EK  A+  A+E++W P+ PE  SPIL G +     + FWLSMG +D+GYLY+CE+P+   K+         EP++   + +S+DVPV+ + +S SG+R  +G ++GS+R+Q L+ PFD+ +MTS W   +HDN+YG++T +C S+D+ +L+SVG DGN+FVY IM +E +QE+Q    +A+   LPSAK +   ++ DDI+DP AYSIEE KQKSE+DR+V+LA+EKKA   +++ EL+ +F+ LK+ N  LP+RIQ+    FE++P+L+ D+   +++K+ +V +++A++SE+  IAL+KL KRF + LECDL+V+ AIES+H V++I+   LS+ + ++  ++ER R   S KD +++ T+      T    +   E D P        K NLKGARG R+ RQL+K+++ +RKR+ R+ +   L   KP ++++DP D+ AI+EAR+ MGDFKLKS+ DY V    R ++ KARQ+LI ++ K ++ + +FN +++ LR+ K ++++ +    +Q+E     +  D ++P+ P +T++  E PEKK+EYT+ETL+EFK E+E +   A+ GE++    F+ F K + + S L P        S Q+T A D   V   D + + + S+LQ ER    +++ +Y    ++ E    +R FD +++LLRHEK+     L+RA LRQ+T+FEE++LL+ +E SE +L  + E++  EK+D+ NKV E   K++SKKKDI+R+ E+DR+ ++ FKESLGE NKF EYL KVY+K+IKR+K E EG +          + + ++                 EE ESD E V YDLD+CP GC Q LYD+TC LRE  LD+EEE+ EE+K  EAL+KE E L KK + VE AL QA+KELEAFQLEKQ KLN+L+T+V+L+LHQIL HENG LP DI   L+FE S    LK RI +LQ+E+ +Q    K  K ++++L ++R+L+Q  I +  ++CD+MM  KFGK++++EK+EQ+++NPKIEEL  KM + Q+ M  E ++W+D+IR+A+++ I + + NT  L  +L L+ ++  LE+++ S+QK+LG E+Q    A  EEI KL QLV IQAQEL+ALKEEIGMLSRKGGHILPP+ 
Sbjct:  228 ISPRDNEGEGGDETNSDNQPAEEDKPAIPADFFYEVGEFMSKPRVTEDSGLPADLLQLVYSYGYDCTKRDNLHILDEQHVCFVAGNLVKVVNLATKRQTFLRSSSGGGVGFVSVHPTRRYLAVAEK--GEAPNVLVYEYPSLRLYRILRGGTERAYCYCKFDPSGKYLATVGSEPDFMLTIWDWLSERTVLRSKAFSQDVYRVSWSQDLEGFLTTAGTGHVRFWKMASTFTGLKLQGAIGKFGKTEISDIEGFVELPDGKVLSGCEWGNMLVWDGGLIKVEISKKGKRPAHNGPIFQVVMDAGELMTVGIDGLIQTWDFEMIDTAEAGDESGLIEMDPMNAYEVGNNVRLAHIVKQVTPADATTTAEDEGSSEWLAQDSNGGIWRLDLSFSHTAQPPERLLSCHAGAIAGCAASPLSYLVATLGADGSVRVTDFVAQRTLVESRFSGSGTKILWAPQTVDPKGRTILAGFADGVLRVLSFGENPETDPTRKAKQVAELTLVDALKPHTGRVVDIVLDKMGDMLVTAGIEHESSHAEEQLSSIFFFSVSASKYTPVGFIRFQGYPAQLAWLSSGSDQQPDQ----VRVFFTDGRVCDFDCPDPAKVDASVTYELAGFDVKQRFAFASVKSKLRRAEELEEIHRLEAEEMKRRAEERKRKLERGLQTEEEQAKEVEDEEKEIAKRRAEEQQWEPYYPEEPSPILCGLVPDNQQNAFWLSMGGFDSGYLYRCEYPAEAPKDF---EAAKREPVHSVTVKDSSDVPVSVISFSKSGRRAYLGMQDGSVRVQLLDTPFDIGSMTSQWCLPMHDNDYGAVTGICPSHDDAYLISVGRDGNYFVYNIMPEEEMQERQAAAAKAKAAVLPSAKRI---QRGDDIDDPGAYSIEEDKQKSEHDRRVKLAEEKKAGIRRRVNELRVEFRKLKELNQALPERIQLRQREFEMVPQLKLDMQEQRKQKVHLVERELAWESERCQIALNKLRKRFLDELECDLVVVRAIESDHEVASIRTSKLSEAFNRLKEEMERKRTLASQKDATRDATLLSAKEVTLEA-SAEKEEDSP------LFKSNLKGARGERILRQLRKVEEKKRKRAQRRQERQELEQSKPSDDYDDPEDVRAIQEARDNMGDFKLKSAGDYVVPPHLRLSSDKARQKLIDLDEKAYQQKCDFNRRLVALRDRKKQLVQELNAKLQQLEAIQLRLRPDDRKPLPPKLTMHSTETPEKKYEYTQETLMEFKAEMEAKAAVAVTGEDDQG--FSAFKKAAGI-SSLAPPGGAPGASSSQLTDAADAASVAGTDKSTSAL-SELQSERLAAENLRNLYAQNQLLREFQSAVRNFDCEVRLLRHEKFDLDAKLKRAELRQITLFEEFQLLQQFEISESTLANRVEQRGEEKIDVQNKVVECTSKIESKKKDIERVQEKDRLLFDTFKESLGEGNKFTEYLTKVYRKRIKRKKVEKEGEDADEDDESDSDDDSDFE----------------SEEEESDGEGVRYDLDICPAGCDQNLYDNTCALREKRLDLEEELAEERKTMEALRKELEGLQKKARAVETALAQAEKELEAFQLEKQSKLNELETVVVLRLHQILHHENGHLPQDISNCLVFERSALLQLKRRISELQEEKHQQNKEQKDAKRKNIQLNKDRRLYQAHIDDMMVKCDKMMVDKFGKVEDMEKLEQIVVNPKIEELTVKMFEQQEKMLDEMNQWDDKIREAKDQLISQTRDNTKKLSQMLMLYTDQFELEEQIESRQKNLGSEYQGAREADIEEIEKLMQLVQIQAQELNALKEEIGMLSRKGGHILPPVQ 2002          
BLAST of cilia- and flagella-associated protein 44-like vs. TrEMBL
Match: A0A267EFC8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015103g1 PE=4 SV=1)

HSP 1 Score: 1530.38 bits (3961), Expect = 0.000e+0
Identity = 860/1814 (47.41%), Postives = 1247/1814 (68.74%), Query Frame = 1
Query:  229 VQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVK---------SPETE-SSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILIT-GSEDE---------TVFFFSINPSEYLPIGFVKLNKPIHHVEWKAT-VEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIM-DENLQEKQIEEYRAR---LPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCN-NVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMN 5586
            + P  +E    +E N   Q  +E+K  IP DF+Y+  EF+SKP ++E+SGLP+++++L +S+GY+C KRDNL +LD+Q +C+++GN ++ +NL+    ++LRS SG G+G ++VHPT+ YLAV EK     P   +YEYPSL+LYRILR GTE+AY YC+F+ SG+ LATVGS+PDFMLT+W+W +E+TVLRSKAFSQD+YRV+WS DLEG LTTAGTGH+RFWKMA TFTGLKLQG IGKFGKTEISDIEGFV LPDGKVLSG EWGNMLVWDG LIKV+I +K K+P H+G I Q++++ GELMT+G DG I TWDFE IDTAE  +E    EMDPMN   V N+ +L H+VK         + E E SS W AQD NG IW+LDLSFSHT+ PPE L + H+G I  C  SPLSYL A++G+DGS+RV DF A++ + E +F+  G+KILWAP  VDPKG+T++AGF DGV+R+L+F +  +TD ++K+K + E+ L+ A KPHT ++  +  D  G +L+T G E E         ++FFFS++ S+Y P+GF++       + W ++  + +PD+    + V+  +G V +  CP+P+ VD S TYEL   +    + F S+KS LR  EELE+    E E  K  A+ERK +LERG++TEEEQ K++E++EK  A+  A+E++W P+ PE  SPIL G +     + FWLSMG +D+GYLY+CE+P+   K+         EP++   + +S+DVPV+ + +S SG+R  +G ++GS+R+Q L+ PFD+ +MTS W   +HDN+YG++T +C S+D+ +L+SVG DGN+FVY IM +E +QE+Q    +A+   LPSAK +   ++ DDI+DP AYSIEE KQKSE+DR+V+LA+EKKA   +++ EL+ +F+ LK+ N  LP+RIQ+    FE++P+L+ D+   +++K+ +V +++A++SE+  IAL+KL KRF + LECDL+V+ AIES+H V++I+   LS+ + ++  ++E+ R   S KD +++ T+      T    +   E D P        K NLKGARG R+ RQL+K+++ +RKR+ R+ +   L   KP ++++DP D+ AI+EAR+ MGDFKLKS+ DY V    R ++ KARQ+LI ++ K ++ + +FN +++ LR+ K ++++ +    +Q+E     +  D ++P+ P +T++  E PEKK+EYT+ETL+EFK E+E +   A+ GE++    F+ F K + + S L P        S Q+T A D   V   D + + + S+LQ ER    +++ +Y    ++ E    +R FD +++LLRHEK+     L+RA LRQ+T+FEE++LL+ +E SE +L  + E++  EK+D+ NKV E   K++SKKKDI+R+ E+DR+ ++ FKESLGE NKF EYL KVY+K+IKR+K E EG +          + + ++                 EE ESD E V YDLD+CP GC Q LYD+TC LRE  LD+EEE+ EE+K  EAL+KE E L KK + VE AL QA+KELEAFQLEKQ KLN+L+T+V+L+LHQIL HENG LP DI   L+FE S    LK RI +LQ+E+ +Q    K  K ++++L ++R+L+Q  I +  ++CD+MM  KFGK++++EK+EQ++INPKIEEL  KM + Q+ M  E ++W+D+IR+A+++ I + + NT  L  +L L+ ++  LE+++ S+QK+LG E+Q    A  EEI KL QLV IQAQEL+ALKEEIGMLSRKGGHILPP+ 
Sbjct:  224 ISPRDNEGEGGDETNSDNQPAEEDKPAIPADFFYEVGEFMSKPRVTEDSGLPADLLQLVYSYGYDCTKRDNLHILDEQHVCFVAGNLVKVVNLATKRQTFLRSSSGGGVGFVSVHPTRRYLAVAEK--GEAPNVLVYEYPSLRLYRILRGGTERAYCYCKFDPSGKYLATVGSEPDFMLTIWDWLSERTVLRSKAFSQDVYRVSWSQDLEGFLTTAGTGHVRFWKMASTFTGLKLQGAIGKFGKTEISDIEGFVELPDGKVLSGCEWGNMLVWDGGLIKVEISKKGKRPAHNGPIFQVVMDAGELMTVGIDGLIQTWDFEMIDTAEAGDESGLIEMDPMNAYEVGNNVRLAHIVKQVTPADATTTAEDEGSSEWLAQDSNGGIWRLDLSFSHTAQPPERLLSCHAGAIAGCAASPLSYLVATLGADGSVRVTDFVAQRTLVESRFSGSGTKILWAPQTVDPKGRTILAGFADGVLRVLSFGENPETDPTRKAKQVAELTLVDALKPHTGRVVDIVLDKMGDMLVTAGIEHESSHAEEQLSSIFFFSVSASKYTPVGFIRFQGYPAQLAWLSSGSDQQPDQ----VRVFFTDGRVCDFDCPDPAKVDASVTYELAGFDVKQRFVFASVKSKLRRAEELEEIHRLEAEEMKRRAEERKRKLERGLQTEEEQAKEVEDEEKEIAKRRAEEQQWEPYYPEEPSPILCGLVPDNQQNAFWLSMGGFDSGYLYRCEYPAEAPKDF---EAAKREPVHSVTVKDSSDVPVSVISFSKSGRRAYLGMQDGSVRVQLLDTPFDIGSMTSQWCLPMHDNDYGAVTGICPSHDDAYLISVGRDGNYFVYNIMPEEEMQERQAAAAKAKAAVLPSAKRI---QRGDDIDDPGAYSIEEDKQKSEHDRRVKLAEEKKAGIRRRVNELRVEFRKLKELNQALPERIQLRQREFEMVPQLKLDMQEQRKQKVHLVERELAWESERCQIALNKLRKRFLDELECDLVVVRAIESDHEVASIRTSKLSEAFNRLKEEMEKKRTLASQKDATRDATLLSAKEVTLEA-SAEKEEDSP------LFKSNLKGARGERILRQLRKVEEKKRKRAQRRQERQELEQSKPSDDYDDPEDVRAIQEARDNMGDFKLKSAGDYVVPPHLRLSSDKARQKLIDLDEKAYQHKCDFNRRLVALRDRKKQLVQELNAKLQQLEAIQLRLRPDDRKPLPPKLTMHSTETPEKKYEYTQETLMEFKAEMEAKAAVAVTGEDDQG--FSAFKKAAGI-SSLAPPGGAPGASSSQLTDAADAASVAGADKSTSAL-SELQSERLAAENLRNLYAQNLLLREFQSAVRNFDCEVRLLRHEKFDLDAKLKRAELRQITLFEEFQLLQQFEISESTLANRVEQRGEEKIDVQNKVVECTSKIESKKKDIERVQEKDRLLFDTFKESLGEGNKFTEYLTKVYRKRIKRKKVEKEGEDADEDDESDSDDDSDFE----------------SEEEESDGEGVRYDLDICPAGCDQNLYDNTCALREKRLDLEEELAEERKTMEALRKELEGLQKKARAVETALAQAEKELEAFQLEKQSKLNELETVVVLRLHQILHHENGHLPQDISNCLVFERSALLQLKRRISELQEEKHQQNKEQKDAKRKNIQLNKDRRLYQAHIDDMMVKCDKMMVDKFGKVEDIEKLEQIVINPKIEELTVKMFEQQEKMLDEMNQWDDKIREAKDQLISQTRDNTKKLSQMLMLYTDQFELEEQIESRQKNLGSEYQGAREADIEEIEKLMQLVQIQAQELNALKEEIGMLSRKGGHILPPVQ 1998          
BLAST of cilia- and flagella-associated protein 44-like vs. TrEMBL
Match: A0A1I8JLC0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1471.06 bits (3807), Expect = 0.000e+0
Identity = 840/1814 (46.31%), Postives = 1217/1814 (67.09%), Query Frame = 1
Query:  229 VQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVK---------SPETE-SSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILIT-GSEDE---------TVFFFSINPSEYLPIGFVKLNKPIHHVEWKAT-VEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIM-DENLQEKQIEEYRAR---LPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCN-NVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMN 5586
            + P  +E    +E N   Q  +E+K  IP DF+Y+  EF+SKP ++E+SGLP+++++L +S+GY+C KRDNL +LD+Q +C+++GN ++ +NL+    ++LRS SG G+G ++VHPT+ YLAV EK     P   +YEYPSL+LYRILR GTE+AY YC+F+ SG+ LATVGS+PDFMLT+W+W +E+TVLRSKAFSQD+YRV+WS DLEG LTTAGTGH+RFWKMA TFTGLKLQG IGKFGKTEISDIEGFV LPDGKVLSG EWGNMLVWDG LIKV+I +K K+P H+G I Q++++ GELMT+G DG I TWDFE IDTAE  +E    EMDPMN   V N+ +L H+VK         + E E SS W AQD NG IW+LDLSFSHT+ PPE L + H+G I  C  SPLSYL A++G+DGS+RV DF A++ + E +F+  G+KILWAP  VDPKG+T++AGF DGV+R+L+F +  +TD ++K+K + E+ L+ A KPHT ++  +  D  G +L+T G E E         ++FFFS++ S+Y P+GF++       + W ++  + +PD+    + V+  +G V +  CP+P+ VD S TYEL   +    + F S+KS LR  EELE+    E E  K  A+ERK +LERG++TEEEQ K++E++EK  A+  A+E++W P+ PE  SPIL G +     + FWLSMG +D+GYLY+CE+P+   K+         EP++   + +S+DVPV+ + +S SG+R  +G ++GS+R+Q L+ PFD+ +MTS W   +HDN+YG++T +C S+D+ +L+SVG DGN+FVY IM +E +QE+Q    +A+   LPSAK +   ++ DDI+DP AYSIEE KQKSE+DR+V+LA+EKKA   +++ EL+ +F+ LK+ N  LP+RIQ+    FE++P+L+ D+   +++K+ +V +++A++SE+  IAL+KL KRF + LECDL+V+ AIES+H V++I+   LS+ + ++  ++ER R   S KD +++ T+      T    +   E D P        K NLKGARG R+ RQL+K+++ +RKR+ R+ +   L   KP ++++DPR  A                           P+   A Q            + +FN +++ LR+ K ++++ +    +Q+E     +  D ++P+ P +T++  E PEKK+EYT+ETL+EFK E+E +   A+ GE++    F+ F K + + S L P        S Q+T A D   V   D + + + S+LQ ER    +++ +Y    ++ E    +R FD +++LLRHEK+     L+RA LRQ+T+FEE++LL+ +E SE +L  + E++  EK+D+ NKV E   K++SKKKDI+R+ E+DR+ ++ FKESLGE NKF EYL KVY+K+IKR+K E EG +          + + ++                 EE ESD E V YDLD+CP GC Q LYD+TC LRE  LD+EEE+ EE+K  EAL+KE E L KK + VE AL QA+KELEAFQLEKQ KLN+L+T+V+L+LHQIL HENG LP DI   L+FE S    LK RI +LQ+E+ +Q    K  K ++++L ++R+L+Q  I +  ++CD+MM  KFGK++++EK+EQ+++NPKIEEL  KM + Q+ M  E ++W+D+IR+A+++ I + + NT  L  +L L+ ++  LE+++ S+QK+LG E+Q    A  EEI KL QLV IQAQEL+ALKEEIGMLSRKGGHILPP+ 
Sbjct:  228 ISPRDNEGEGGDETNSDNQPAEEDKPAIPADFFYEVGEFMSKPRVTEDSGLPADLLQLVYSYGYDCTKRDNLHILDEQHVCFVAGNLVKVVNLATKRQTFLRSSSGGGVGFVSVHPTRRYLAVAEK--GEAPNVLVYEYPSLRLYRILRGGTERAYCYCKFDPSGKYLATVGSEPDFMLTIWDWLSERTVLRSKAFSQDVYRVSWSQDLEGFLTTAGTGHVRFWKMASTFTGLKLQGAIGKFGKTEISDIEGFVELPDGKVLSGCEWGNMLVWDGGLIKVEISKKGKRPAHNGPIFQVVMDAGELMTVGIDGLIQTWDFEMIDTAEAGDESGLIEMDPMNAYEVGNNVRLAHIVKQVTPADATTTAEDEGSSEWLAQDSNGGIWRLDLSFSHTAQPPERLLSCHAGAIAGCAASPLSYLVATLGADGSVRVTDFVAQRTLVESRFSGSGTKILWAPQTVDPKGRTILAGFADGVLRVLSFGENPETDPTRKAKQVAELTLVDALKPHTGRVVDIVLDKMGDMLVTAGIEHESSHAEEQLSSIFFFSVSASKYTPVGFIRFQGYPAQLAWLSSGSDQQPDQ----VRVFFTDGRVCDFDCPDPAKVDASVTYELAGFDVKQRFAFASVKSKLRRAEELEEIHRLEAEEMKRRAEERKRKLERGLQTEEEQAKEVEDEEKEIAKRRAEEQQWEPYYPEEPSPILCGLVPDNQQNAFWLSMGGFDSGYLYRCEYPAEAPKDF---EAAKREPVHSVTVKDSSDVPVSVISFSKSGRRAYLGMQDGSVRVQLLDTPFDIGSMTSQWCLPMHDNDYGAVTGICPSHDDAYLISVGRDGNYFVYNIMPEEEMQERQAAAAKAKAAVLPSAKRI---QRGDDIDDPGAYSIEEDKQKSEHDRRVKLAEEKKAGIRRRVNELRVEFRKLKELNQALPERIQLRQREFEMVPQLKLDMQEQRKQKVHLVERELAWESERCQIALNKLRKRFLDELECDLVVVRAIESDHEVASIRTSKLSEAFNRLKEEMERKRTLASQKDATRDATLLSAKEVTLEA-SAEKEEDSP------LFKSNLKGARGERILRQLRKVEEKKRKRAQRRQERQELEQSKPSDDYDDPRTFA---------------------------PSRRLAYQH-----------KCDFNRRLVALRDRKKQLVQELNAKLQQLEAIQLRLRPDDRKPLPPKLTMHSTETPEKKYEYTQETLMEFKAEMEAKAAVAVTGEDDQG--FSAFKKAAGI-SSLAPPGGAPGASSSQLTDAADAASVAGADKSTSAL-SELQSERLAAENLRNLYAQNQLLREFQSAVRNFDCEVRLLRHEKFDLDAKLKRAELRQITLFEEFQLLQQFEISESTLANRVEQRGEEKIDVQNKVVECTSKIESKKKDIERVQEKDRLLFDTFKESLGEGNKFTEYLTKVYRKRIKRKKVEKEGEDADEDDESDSDDDSDFE----------------SEEEESDGEGVRYDLDICPAGCDQNLYDNTCALREKRLDLEEELAEERKTMEALRKELEGLQKKARAVETALAQAEKELEAFQLEKQSKLNELETVVVLRLHQILHHENGHLPQDISNCLVFERSALLQLKRRISELQEEKHQQNKEQKDAKRKNIQLNKDRRLYQAHIDDMMVKCDKMMVDKFGKVEDMEKLEQIVVNPKIEELTVKMFEQQEKMLDEMNQWDDKIREAKDQLISQTRDNTKKLSQMLMLYTDQFELEEQIESRQKNLGSEYQGAREADIEEIEKLMQLVQIQAQELNALKEEIGMLSRKGGHILPPVQ 1964          
BLAST of cilia- and flagella-associated protein 44-like vs. TrEMBL
Match: A0A0L8H091 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024886mg PE=4 SV=1)

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 690/1817 (37.97%), Postives = 1062/1817 (58.45%), Query Frame = 1
Query:  172 GSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVS--NDAKLMHVVKSPETE---SSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL-PIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGK---IEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQI-ELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTL---------AEDP------TLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRI-FDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVY-XXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEI 5541
            GS NE    E  E+S +     ++DE   E     K +K  K VIPEDF+YDYEE   +PF++E+SGLP +++   +S GY+C +R NL LLD  T+ + +GN I  +N+     S+LR  S  GI  + +HP K + AVGEK++   P   I+E PS KLYRILR+GT   YS+  F+  G LLA+ G +PD+MLT+W W  EQ VLR KAFSQ+IYRV++SADLEG LTTAG GHIRFWKMA+TFTGLKLQG +GKFGKTE+SDIEG+V LPDGKV+S  EWGN+LVWDG LIKVQIGRKN K CH G I QI ++EGELMT+G DG I  WDFET+DTA+  +E   F M+PMNEL V    + +L ++ +  E E   + +WYAQD NG IW+LDL+FSHTS  P+ L +FH+G I+  D SP++ L A+ G D ++R+FD  + K ++E +F   G+ ++W   K+ PKG  +IAGF DGV+R+    + +    ++K K   ++ L Q  K H  +I S+  + +  IL T  ED  VFF     +  L PIGFV+       + W           + +I++      V E   P  +  D   TY L E++P   Y F SIKSV+ HEEELE +R  EEER K   +E + R E G E++ E  +  E++E +        E ++P IP   SPIL G    +D   FWL++G+YDAGY+Y+C FP                PI    ++N+N+  +T MK+  S  ++++G  +G IR+ +L  P  ++ +   W++ +HD++YG +T L V++ + +L+S G DGN F++  M  +  E++I    A  P       K  +DD+EDP AYSIE+ KQK+EYDR +  A +KK    + I  L++ +K+L +QN  LP+ +++S   FE+   ++E++    ++KIQ    ++++ +EKHS++L KL K +++ ++ + IV++A  S + VST +   L ++++Q  SDL+       +K   K  T+ D       V+      D  GK     +S    +LKG  G R+ + + K+++ +++R  RK QWD LY EKP +++EDP D+AAI+EA+  MGD+KLK++ DY V +  R N  KAR +L  +   I +  S+FN K+L+LRNEK ++++ I   + +I  + +N+ ++ +  +L    +  +E PE+K+++  E L+ FK +L     + + G            ++   E    PT +  P  + + +L           +P       ++ +E    +T  + ++  +     ++  Y  + ++ + ++QM+  FD +L LLRHEK+   + +++  LR++T FEE  LLK YEK E  + EK EE+  EKLD+  KV E Q K+D+K KDID+L+ER+R        ++GE NKFA+YL KV+ KK  + +KKE EG ++ S G+ +  +                     D +  S+ E+  +DLD+CP GC Q LYD+TC +RE  LDIE+++ EE+K  E  KK+ + LNKK KV+  +L +A+ +LEAFQLEKQ+KLN+L   V L L QI        P DI  AL+F  +   +L  RI++LQ E+ +Q  + ++ +L+H +L ++++ F++ I + +  C++M++ KFG+L ++E +E V ++    EL  +    +  +   + +  + I   +       K NT     +  L  E+ +LE +L S+QK+LG EF+       +E+ +L QL  +Q QE+  LK+E+
Sbjct:   38 GSSNE----EDDEESTVYFSSSSRDESDFELSEPEKEEKVVKRVIPEDFFYDYEELKYRPFVTEDSGLPEDMLDFKYSLGYDCTRRCNLCLLDNDTVLFATGNVITVINVKTGERSFLRGTSAGGISAIQLHPKKTFCAVGEKQN--FPNLNIFEVPSFKLYRILREGTTHLYSFLDFSPDGALLASQGGEPDYMLTLWNWSQEQIVLRCKAFSQEIYRVSFSADLEGYLTTAGMGHIRFWKMANTFTGLKLQGYLGKFGKTEMSDIEGYVELPDGKVVSSCEWGNLLVWDGGLIKVQIGRKNNKTCHVGHIQQIFLDEGELMTIGQDGYIRVWDFETMDTADSVDESGMFIMEPMNELKVGAQQNVQLYYMRRQEENEEQDTMLWYAQDANGGIWELDLTFSHTSRAPKKLFSFHAGSIKAIDCSPVANLLATTGVDHTIRIFDIDSNKQLSEKRFVAGGTCLIWISEKLCPKGSHIIAGFEDGVVRLFEICKPVDEGTTRKGKNTCDLQLYQVIKLHKMRINSMEFNAEETILATTGEDRAVFFSRFTQNLTLEPIGFVESPHHPKKLLWFPN-------SLNKILIICERNSVVEFETPEEAVFDTEHTYFLGELKP-RIYTFKSIKSVILHEEELEVQRKLEEERLKQEEEEHQRRRELGEESDSEPEETEEKEESKEEVVEDTWEPYIPEIP---SPILCGMY-SSDGRSFWLTLGDYDAGYIYECAFPGEGDPQRAISDSDPATPIRAVAVVNNNNAGITIMKFCKSQTQLLLGTTDGKIRVHHLPVPGSIKELGPYWEFGIHDSDYGYLTGLVVNFQDNYLISSGADGNIFIFSYMSLDKIEEKIA---AAEPYIFLAKEKLYVDDLEDPTAYSIEDAKQKAEYDRIMAEANQKKEEVHQHIALLRRDYKHLIEQNACLPENLRLSPKEFEIDTTIKEEVFSQIDKKIQEAKMKVSWITEKHSLSLMKLRKFYKDYVKWNRIVVYAFNSPYKVSTTRLPCLPNDFYQKKSDLD-------HKKNGKRFTLNDLQQKESEVRKDAKAGDAEGKSSGTRESVTASSLKGVAGERILKAIHKVEEIKQRRIKRKEQWDKLYNEKPADDYEDPNDLAAIKEAKENMGDYKLKTAEDYVVPDLLRMNTNKARLKLFQLVEHISQYISDFNEKVLELRNEKKKLVDIIASLHDEISSIQSNMPEELRIYLLDPPKMVLEETPEQKYDFETEDLLYFKNKLLSMDNSLVLG----------LKERMLQELETPPTNVPPPKYTSRGSLILMKSSNMGVFEPKEEFFNQMIDNESFQRSTAITKVEIMQAKELGIRNEYKRDDLLRK-IEQMKADFDARLCLLRHEKFLLDVVIKKGNLREITAFEELVLLKEYEKYENIIAEKVEERFKEKLDMERKVQECQAKIDNKIKDIDKLLERERALHGTLVSTIGE-NKFADYLIKVFKKKIKRSKKKETEGTDEDSDGSSSEDSDI------------------TDTDEGSESESAAFDLDVCPSGCDQALYDTTCTMREKRLDIEDQLMEERKNQETFKKDIDALNKKAKVINTSLEKAQNDLEAFQLEKQRKLNELDVTVTLLLQQIQYTVGKKFPHDISKALVFRNNQILNLNSRIKELQAEKNQQKRNKQEERLKHCQLLRDKRQFEQIIGQLEDTCNKMIEDKFGRLVDMETVETVTVHRTNAELEERAHQTEHQLRANRCKERENIMQLKRDISAVTKENTDLTGQLRILLEEQHLLEARLGSRQKNLGEEFRGESQQTIDELERLEQLCDLQTQEIFNLKKEL 1796          
BLAST of cilia- and flagella-associated protein 44-like vs. TrEMBL
Match: A0A0X3P4B7 (WD_REPEATS_REGION domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR144040 PE=4 SV=1)

HSP 1 Score: 1019.22 bits (2634), Expect = 0.000e+0
Identity = 526/1244 (42.28%), Postives = 802/1244 (64.47%), Query Frame = 1
Query:  232 QPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEF----PSPD--------------------KKN----------LLKIPEKYN--EPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIY---PDENPEKKFEYTKETLI 3846
            QP   E P  EE+  + ++ + + IP+DFYYD +E +S+PFI EE GLP N+VKL HSFGY+  +RDNL +LD+  +C+ISGNY+E + LS     Y+RSLSG GIG   VHP K ++A+ EK ++  P T IYEYPSLKL+RILR+GT+ AY+Y QF   G L+ATVG DPDF+LT+W+W+ E+ VLR+KAFSQDI+RV WSADL G+LTTAGTGHI+FWKMA+TFTGLKLQG+IGKFGK E+SDIEGFV +PDGKVLSGSEWGN++VW+G+LIKVQI RK ++PCH+G I QIII+EGELMT+GTDG I TW+FE +DTAE   E A FE++PMNEL V  DAKLM + K  + E++ WY QD NG +WKLDLSFSHTSA P+ + ++H+G I DCDVSP SYL+ ++G+DGS+RV+D   R ++ E +F   GS ++W P K+DPK KT+IAGF DGV+RIL   Q  + D  ++   L ++ LIQ  KPH+  + +++ D++GK   +  +D T+F F ++ +   PIGF +L      + W+     KP +    ++++M    V EV CPN  + +   T+EL ++EP++ ++  S+   +R  EE   KR + E+ +K  A++ +E    G  T+E+  +   E+++   +   +    +P +PE  SPI+   ID  D+   W+S+ ++DAGYLY+C      P P                     KK           L K+ ++    +P     + +S   P+ S K++++GKRVI G +NG++R+Q L++P++  +    W  +  DN+ G +  + +S+D+ FL+SVG DG FFV E+M E LQE  +E +RARLPS  T++   + +DI+DP A SIE  ++K+E+ + V   +EK+  T +K+ EL+ +FK LK+QN+KLP+ ++I    +E++P++R+ L++ +  K+ +++++ AF+S ++ +AL K+  R+R+ L C+L+V+ +  ++H+V+T++   L   Y  +L +  R   +   K  +++     +     G Q    +  +P  +++   ++ +KGARG+R+ RQL+ +   + KR  R+ +WD LYA+KP  N+EDP D+AAI+  R  MGD+KLKSS +Y V E ER  A K R  L++   ++   +++FN ++L+LR++K  II+ ++  ++  EL    D   +  ++  + I     +E PE+ F+ T E LI
Sbjct:   47 QPADVEAPANEEVIEEEEEGDPLHIPDDFYYDIDEEVSRPFIQEECGLPENLVKLYHSFGYDMHRRDNLHVLDKDRICFISGNYLELLTLSTGEKVYIRSLSGCGIGACTVHPQKTHIALAEKGTE--PNTCIYEYPSLKLFRILRNGTQLAYAYTQFTPDGTLIATVGLDPDFLLTIWDWREERIVLRNKAFSQDIFRVLWSADLPGILTTAGTGHIKFWKMANTFTGLKLQGNIGKFGKVELSDIEGFVTMPDGKVLSGSEWGNLIVWEGDLIKVQICRKGQRPCHTGLIMQIIIDEGELMTIGTDGYIRTWEFEAVDTAECPYEGALFELEPMNELQVDADAKLMFLQKVVDDETTFWYCQDANGAVWKLDLSFSHTSAAPQKILSYHAGAIVDCDVSPSSYLATTVGADGSIRVYDLPKRSVLVEKRFCAPGSAVIWVPKKIDPKSKTIIAGFGDGVVRILQVGQSKRNDDYQQPAILADLELIQVLKPHSDAVRAMAYDERGKFFASSGDDLTLFTFHVDGTRLEPIGFARLPAVARKLIWRY---AKPTDPEPTLLLFMDNSCVIEVKCPNRKAKEKG-TFELFDVEPLSGFQMQSVAGEMRVREEAADKRAKYEQEKKARAEKLEEARRNGQVTDEDILQAESEEKRILQKLEEEIAMMVPIVPEVPSPIIQCMIDTKDNTSVWISLDDFDAGYLYKCPLTKLDPPPPMTAEEKAEEEARKEEIARRRKKGEVDFDLPHSALEKVLQRLKLLKPTQVARVRDSGYSPLRSWKFTNNGKRVIFGFKNGTVRVQLLKRPYEFSSFAGYWIMAFQDNDRGMVNRVQLSFDDSFLLSVGEDGTFFVAELMSEALQEVAVERFRARLPS--TLEGPIETEDIDDPKADSIEGARKKAEWAKLVEQGEEKRRDTRRKVAELRMKFKRLKEQNEKLPEHMRIDLREYEILPRIRDHLMKERAAKLDLLYRETAFESRRYELALRKIIARYRDQLACELLVLKSFGTDHSVATMRANTLPS-YHNLLLNCLRKEAEEEAKREAEKKRRAAEEDKEAGTQ----KKKQPSVVQEDTDRHKIKGARGLRLDRQLQFMQAAKAKREKRQAEWDALYAKKPPNNYEDPSDVAAIKYVRENMGDYKLKSSPNYTVPEHERRTAKKTRLVLLSTMRQLSERQADFNHRVLRLRDKKANIIQQLRLLDE--ELAKLADTLPESAIIVRLKISDLDDEEFPERLFDITDEKLI 1275          

HSP 2 Score: 186.037 bits (471), Expect = 3.653e-43
Identity = 131/300 (43.67%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 4669 LDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGH 5568
            LDMCPPGC Q+ YD+T   RE  LD+E++  E+K++ +  KK  E L KK + VE AL QA K+L+AFQ+EKQ KLN L+ +VIL+L QI  +++  LPSD  +ALIFE  N  +L+ RI++L+DE++ Q    K  K +H+ LQ+++K+FQ +I     +CD MM  KFG++DNLEK+E + INPKIEE+  ++L LQ  +   + + ED +R+A++  I E++ NT  +   + LF+E + L   L+ +QK++ G+ +  G   + EIS L ++   QA+EL+ L  EI  LSRK G+
Sbjct: 1652 LDMCPPGCDQQDYDATIAFRERRLDVEDDTAEQKRLLDEQKKNAETLAKKQRAVEYALEQAVKDLQAFQIEKQSKLNVLERVVILRLDQITFYQDKGLPSDFGSALIFERENIHNLRHRIQELEDEKKGQRKAKKDAKAKHIMLQKHKKIFQLEIENMMKKCDLMMIDKFGRVDNLEKMETIRINPKIEEITARVLSLQAHIKAAEEKAEDELREARDCYIAEMRENTKLISKTVLLFHELQNLHGVLDKQQKNM-GKGRPAGLTEKTEISNLLRVAASQAEELNKLTLEISNLSRKAGN 1950          

HSP 3 Score: 95.1301 bits (235), Expect = 2.056e-15
Identity = 50/140 (35.71%), Postives = 87/140 (62.14%), Query Frame = 1
Query: 4057 SSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLN 4476
            ++ L+  +QL    + +Y    ++ +  + +R F+  L+ LRH+K      L+RA L  LT++EEY+LLK +EKSE+ L E  +++  E+ ++  KV E+   LD  KK I++L E++   +E+FK  LG+N+KF ++LN
Sbjct: 1464 TTSLEHAQQLRRQEQALYTRNFLLADAARLVRCFNADLRALRHQKVHLQFLLKRADLNLLTLYEEYKLLKDFEKSERGLAETYDQRLKERREVNAKVQEMNANLDGTKKVIEKLAEKETEIFEEFKAYLGDNHKFGDFLN 1603          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Cavefish
Match: ENSAMXT00000015124.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:22307665:22331761:1 gene:ENSAMXG00000014682.2 transcript:ENSAMXT00000015124.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 509/1414 (36.00%), Postives = 773/1414 (54.67%), Query Frame = 1
Query:  292 EKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF--SQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXWLP-FIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEK-PFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKT-VDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIE-LCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSK-----------TVFATFNKQSNVESGLKPTKI-FRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLN 4476
            EK  I ED YYDYEE  S+ F +E S LP N+++L+HSFGY+C++R NL LLD+ TL +++GN +  +++      Y+RS SG GIG +  HP+K Y+AV EK     P   IYEYPSL+ YRILR GT +AYSY  FN  G LLA+VGS PD++LT+W+W+ EQ +LRSKAFSQD+YRV++S D    LTT+G+GHIRFWKMA+T TGLKLQG +G+FGKT ++DIEG+V LPDGKV+SGSEWGNML+WDG LIKV+I RK  + CH GTI Q  ++EGELMT+G DG + TWDFE+IDTA+  ++   FE++PMNE+++       + + SP          D N  ++ L L    T   PE L +FH+G I   DVS  S+L A+   D ++R++DF +++ +   +F   G+ + WAP  V      ++ GF DGV+R+L       L +   +      E+ L QA KPH+  +T++S +  G I+ TGS D TVFFF++   +Y PIGF+ +  P+  ++W      +       ++V    G V EV  P P + + S T+ L+ + PI  + F SIKS         + + E E  ++  AKE+K +       + ++  +   +E     E+  +EEE LP +IP   SP+ Y F  +  +  FWLSMG YDAGYLY C+F     ++   + E+ ++P +   + N+   P+ ++ +SS  + ++ G ++GSIRL  LE       +M + W  SVHDN YGSI  L  S+D +F++S G DGN F + ++D    ++++E ++A++PS +  ++ +    DIEDP AYSIE  KQK E +   + A+ +K    KK+ ELQ QF+ L  +N  LP+  Q+   +   I           + +++ V +++A+D E+H I L KL++RF + + CD + + AIES+H VST +  +LSD++ Q+                 KE + T + P T                                   Q + L   R K SF        YA KP EN EDP D+ AI  A   MGDFKLK++ D+ V E  R N  K R +L  +E +IF+ + E N ++L LR+ K  +I  ++   ++++ L  ++  +++RP+    T+ P+E PE+K  Y+                A LQG    +              A +  QS  E  LK   +  + HI    +  E+     D +L        L R+ +L  D+               QM++ D                     L+ +T+F+E +LLK +EK E +L E+   +  E+ ++ +K+ E + +LD KK+++ +L E+++     F  SLGENNKF ++L 
Sbjct:    4 EKRRITEDLYYDYEELYSRAFTTEGSNLPQNLLQLSHSFGYDCKRRANLQLLDESTLAFVAGNMLVLLDIHTKEQRYIRSCSGGGIGIIMSHPSKKYVAVAEKGEQ--PNIIIYEYPSLRPYRILRGGTGQAYSYLDFNRDGTLLASVGSAPDYLLTLWDWRQEQVMLRSKAFSQDVYRVSFSPDNPEQLTTSGSGHIRFWKMANTLTGLKLQGILGRFGKTALTDIEGYVALPDGKVVSGSEWGNMLLWDGGLIKVEICRKEGRSCHLGTIQQFALDEGELMTIGADGAVRTWDFESIDTADSVDDSGLFEIEPMNEMIIGPQC---NTLLSP----------DQN--VYHLCLCVLQTQ-DPECLFSFHAGSIEGMDVSGSSHLMATTALDRTVRIYDFLSKEELTTTRFTMGGTSLTWAPHVVSSSESVLVVGFEDGVVRLLELYNPHSLHSIAGRTLSGNAELRLQQALKPHSAPVTAISYERSGTIMATGSVDCTVFFFAVG-EKYEPIGFINVPGPVQCLQWAPQSHER-----NTLLVACQTGHVVEVEAPGPEAQNESSTFHLQNL-PIKYFCFNSIKS---------RIKREAEMARRQAAKEKKRQERMERLQKLKEKGKELSEEDLCGEEKEDEEEELLPLYIPNPPSPLHYAFYSQPGA--FWLSMGGYDAGYLYHCKFAEQQAED---VSEQRDDPFSVIPVQNTEHNPILTICFSSERQMLLCGMQDGSIRLFPLEAGELPPGSMQNYWALSVHDNQYGSIRQLRFSHDGRFVLSAGADGNIFTFRLLD----QEEMERHQAKVPSPRIGLEVEPAAPDIEDPAAYSIEMAKQKLELECVQKEAELRKQERRKKLTELQSQFQTLLLRNQSLPEHAQLQRTTHRQIH---------SKSQLREVRRELAWDEERHRIGLQKLQERFVKSVVCDTVTVSAIESDHKVSTYRLLSLSDKFHQM-----------------KEHSRTLQQPGT---------------------------------TTQERWLCVYRLKYSFSFCS----YAAKPKENCEDPEDVRAIRLATENMGDFKLKTAKDFTVPEHLRVNTEKKRMQLAILEEQIFQRKDEMNARVLALRDSKVALISQLRSLLRRLQTLQKHLPSEKRRPLPTLPTLLPEETPERKLNYS---------------YAHLQGHTTHRDQVGRPFQEEGQCLACWTTQSPPEFNLKEQALDAKYHIPVSFSQMEESVWRFDAELR-------LLRDEKLRMDV---------------QMKLAD---------------------LQHVTLFQELQLLKEFEKRENTLQERLNTRVQEERELRSKLEECKQQLDLKKREVAKLQEKEKSLTAAFLSSLGENNKFTDFLT 1253          

HSP 2 Score: 131.339 bits (329), Expect = 5.946e-30
Identity = 114/306 (37.25%), Postives = 179/306 (58.50%), Query Frame = 1
Query: 4666 DLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDE-ERKQLN-HGKQ--VKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHI 5571
            D  +CPP C  EL+  T  LRE  LD EE + EEKK  ++LKKE ++L KK KVV+++L  A+ ELE F  EK QKL++L  +V L LHQI    N  +PS + +AL+ +A   + L+ RI +LQ E + ++L+ H +Q   +L H       K+  +  S        +M  KFGKL +LE ++ +  N  +EE+  +    +     E   W+D++ +A++    + K +T  +  + +L  ++++LEDKLN +QK++G +FQ    A EEE  +L  L+  Q  E+ +L++EI +LSRKGGHI
Sbjct: 1305 DDSVCPPNCDPELFKKTLHLREQRLDNEELLLEEKKTTDSLKKEYDSLVKKEKVVQSSLKAAEGELELFNREKHQKLSELVVVVPLILHQIEYLINSEVPSKMGSALVMKAEAVERLQERINELQQENQMRELSIHSRQQYTQLSHELTSMKTKIRGQTPSP-------LMMMKFGKLVDLEALQTLSGNSTLEEMRQESRVREAEYLKELKLWQDKVSEARQALTVDTKQHTERMLTLNSLLTQQKLLEDKLNIRQKNMGTQFQGQSQAKEEEYRRLQTLIQSQKDEVMSLRQEISVLSRKGGHI 1603          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Cavefish
Match: EML6 (EMAP like 6 [Source:NCBI gene;Acc:103028254])

HSP 1 Score: 105.145 bits (261), Expect = 6.631e-22
Identity = 128/562 (22.78%), Postives = 224/562 (39.86%), Query Frame = 1
Query:  211 DSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYN-CQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKL-QGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            DS +  V     +   E ++N++RQ     V  ED     ++ +      +    P   ++L    GY  C  R+NL       + Y         N    +  +      + I  +  HP K Y+A G+   D  P   +++  +LK   +LR   ++     +F   G+ L +VG D    + +W+WK  + + +++     I+ V  +      L T G  HI+FW+   T  GL   +G  G  GK E + +       +  V SG+  G++ +W D  LIK           H G +  +   +   +T G DG +  WD  FE        +  A   + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +A   M  ++   +G +         P GK +  G +DG   ++N            + TL ++     T  H K+I S    + D GK L   S D  V  +++  S+   +G  K     I H++W
Sbjct:  619 DSDLSDVPELDSDIEQEAQMNYERQ-----VYKEDLPQLKKKLVGSL---KRQKAPDEGLRLQFVHGYRGCDCRNNLFYTQTGEVVYHVAAVGVVYNRQQHTQRFYLG-HDDDILSLTAHPLKDYVATGQVGRD--PAIHVWDIQTLKCLSLLRGQHQRGVCALEFTADGKSLVSVGIDEGHSIVMWDWKKGEKLAKARGHKDKIFVVKGNPFRMDKLVTVGIKHIKFWQ--HTGGGLTFKRGIFGNLGKQE-TMMSACYGRSEDLVFSGATTGDVYIWKDTSLIKTI-------KAHDGPVFAMCSLDKGFVTGGKDGIVELWDDMFERCLKTYAIKRAA---LSPSSKGLLLEDNPSIRAITLGHGHILV---GTKNGEILEID-----KSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSANHRMVAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVN------------ADTLEDM----VTFHHRKEIISDLKFSQDAGKYLAVASHDSFVDIYNVLTSK--RVGICKGATSYITHIDW 1126          

HSP 2 Score: 97.4413 bits (241), Expect = 1.239e-19
Identity = 120/545 (22.02%), Postives = 207/545 (37.98%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAE---------MKFNFEGSKILWA----------------------------PLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATV 1881
            P   ++L    GY   Q R+NL     + + Y         N  + S  +      + I  +A+HP K+ +A G+   D  P   +++  +L    ILRD      +   F+  G+ L +VG D    ++VW+WK  + +  +   S  I+ ++W   L   L + G  HI+FW    T  G  L    G FGKT   D++  + L   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG +  W  DF+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  ++     GE+   D+ P   ++ +   D S+R++  A   L+A          + FN +GS++                                LK  P G  +  G +DG++ I   +Q        + K +GE +           IT L      + L T       FF+ +   ++LP    +  K IH + W + +
Sbjct:    7 PRCQLRLEWIHGYRGHQCRNNLFYTAGKEIVYFVAGVGVVYNTREHSQKFYLG-HNDDIISLALHPDKIQVATGQVGKD--PYICVWDSYTLITVSILRDVHTHGVACLAFDADGQRLVSVGLDAKNTVSVWDWKKGRVLATATGHSDRIFDISWDPFLPHRLVSCGVKHIKFW----TLCGNALTPKRGIFGKT--GDLQTILCLATAKEEVTYSGALNGDIYVWKG----LNLVRTVQAAHGAGIFSMHACEEG-FATGGRDGCVRLWDVDFKPITKIDLREAEQGYKGLSIRSVCWKADRIL-----AGTQDSEI------------FEVMVRDRDKPLLVMQGHSEGELWALDLHPKQPIAVTGSDDRSVRLWSLADHTLIARCNMEEAVRSVSFNNDGSQLALGMKDGSFTVLRVRDMTEVVHIKDRKEVIHELKFSPDGSYLAVGSNDGLVDIYAVAQ--------RYKKVGECN------KSACFITHLDWSVDSRFLQTNDGAGERFFYRMPAGKFLP---KEEAKGIHWMTWTSVL 503          

HSP 3 Score: 81.6481 bits (200), Expect = 7.710e-15
Identity = 105/484 (21.69%), Postives = 193/484 (39.88%), Query Frame = 1
Query:  274 HKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVK--------------LAHSFGY---NCQKRDNLALL-DQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFET-------IDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            H++QKE  +++ E           +P +S  + LP  ++K              L H FGY   +C  R+NL  L D   + + +       NLS  + S+    + + I C+ V  HP K    +   +    P   +++  S +   +LR    K   Y  F+ +G+LL +VG DP+  +TVW W+    V      S  I+ V +  D +    + G  HI+FW    T  G  L    G  G  E   ++  + +  G      +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        ++T    E + +        L+ + D +++ V +     +++       G+IW               L+T  S +I         ++SAS   DG++R++D A +KL+ ++          ++     P G  V  G  +G   +L
Sbjct: 1314 HQQQKE--ILVDE-----------RPPVSRAAPLPEKLLKNNVTKKKKLVEELALDHVFGYRGFDC--RNNLHYLNDGADIIFHTAAAAVIQNLSAGTQSFYLEHTDD-ILCLTVNQHP-KYQNIIATGQIGLAPSIHVWDAMSKQTLSVLRCSHAKGVGYVNFSATGKLLLSVGVDPEHTITVWRWQEGSKVSSKAGHSDRIFVVEFRPDSDTQFVSVGIKHIKFW----TLVGGSLLYKKGVIGAVEEGRMQTMLSVAFGANNLTFTGAINGDVYVWRDHFLVRVVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMRRCRAFQLETGLPVESVRSVCRGKGKILVGTKDGEIIEVGEKNAASNTMINGHT-QGRIWG--------------LSTHPSKDI---------FISAS--DDGTIRIWDLADKKLLNKVSLGHPAKCTAFS-----PNGDMVSIGMENGEFIVL 1745          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Cavefish
Match: ENSAMXT00000009461.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:19953646:20019083:-1 gene:ENSAMXG00000009201.2 transcript:ENSAMXT00000009461.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 1.095e-21
Identity = 127/544 (23.35%), Postives = 218/544 (40.07%), Query Frame = 1
Query:  388 VKLAHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQV-----------LQTDISKKSKTLGEIHLIQATKPH-------------------TKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWK--ATVEGKPDEGIGRI 1914
            ++  H + GY+C  R+NL       + Y ++   I +         YL     + I  + VHP K Y A G+   D  P   +++  SLK   +LR   ++      F+  G+ L +VG D +  + VW+WK  + +  ++     ++ V  S  L   L T G  HIRFW++A      K +G  G  G+ E      F    D  V SG+  G++ +W    +   I        H G +  +   E   +T G DG +  WD +T +       +    + P ++ L+  D   +  +        +      NG++ ++D      S P  +L   H  GE+      PL  + A++  D +LR+++ +    M  ++   +G +         P GK +  G +DG   ++N   +           L +DI K S+  G+ +L  A+  H                   T  IT +  D +GK+L   S  +   FF     +   I   ++ K    +EW    +V G   EGI +I
Sbjct:  646 LQFVHGYRGYDC--RNNLFYTQTGEVVYHVAAVGIVYNRQQHTQRFYLGH--DDDIISLTVHPIKDYAATGQVGRD--PAVHVWDVQSLKCLSLLRGFHQRGVCALDFSADGKSLVSVGVDDNHTIIVWDWKKGEKLATARGHKDKLFVVKCSPFLMDKLVTVGMKHIRFWQLAGGGLTFK-RGVFGNLGRPETMMSVCFGHAHD-LVFSGAANGDIYIWKEPTLLKTI------KAHDGPVFAMFSLEKGFVTGGKDGVVELWD-DTFERCLKTYAIKRSTLSPGSKGLLLEDNPSIRAITLGHGHILV---GTKNGEVLEID-----KSGPITLLVQGHMEGEVWGLAAHPLQPVCATVSDDRTLRIWETSTNHRMVAVRKLKKGGRC----CAFSPDGKALAVGLNDGSFLVVNADTLEDMVSFHHRKELISDI-KFSRDAGK-YLAVASHDHFVDIYNVLSSKRVGICKGATGYITHIDWDTRGKLLQVNSGAKEQLFFEAPRGKRQTIRTTEIEK----IEWATWTSVLGPTCEGIWQI 1156          

HSP 2 Score: 84.3445 bits (207), Expect = 1.291e-15
Identity = 117/546 (21.43%), Postives = 204/546 (37.36%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDG-ELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAE---------MKFNFEGSKI----------------------------LWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATV 1881
            P   ++L   +GY   Q R+NL     + + Y         N  + +  +  + + + I  +A+HP +  +A G+   D  P   +++  +++   IL+D      +   F+     L +VG D    + VW+WK  + +  +   S  I+ + W    +  + + G  HI+FW M     G  L    G FGKT   D++  + +   K     SG+  G++ VW G  LI+   G        +G  +    EEG   T G DG I  WD  F+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  I+     GE+    V P   L+ +   D S+R++  A   L+A          + F+ +GS++                            +   LK  P G  +  G +DG++ +   +Q        + K +GE             IT L     GK L T       FF+ +   ++L     +  K IH V W   +
Sbjct:    7 PRCRLRLEWIYGYRGHQCRNNLFYTAGKEVVYFVAGVGVVYNTREHTQRFYLAHTDDIIS-LALHPERSLVATGQVGKD--PYICVWDTFNIQTVSILKDAHSHGVACLAFSR----LVSVGLDAKNTVCVWDWKRGKVIATATGHSDRIFDITWDPFQQNRMVSCGVKHIKFWSMC----GNALTPKRGIFGKT--GDLQTILCVSAAKDEITYSGALNGDIYVWKGLNLIRTVQGAHG-----AGIFSMYSCEEG-FATGGRDGCIRLWDSEFKPITKIDLRETEQGYKGLSIRSVCWRADRIL-----AGTQDSEI------------FEVMVRERDKPLLIMQGHSEGELWALGVHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSHDGSQLSLGMKDGSFTVLRVRDMTEIVHIKDRKEVIHELKYSPDGAYLAVGSNDGLVDVYAVAQ--------RYKKVGE------CSRSCSFITHLDWSIDGKFLQTNDGAGERFFYRMPTGKHLTSK--EEIKGIHWVSWTCVI 500          

HSP 3 Score: 75.0998 bits (183), Expect = 7.368e-13
Identity = 89/441 (20.18%), Postives = 181/441 (41.04%), Query Frame = 1
Query:  334 EFISKPFISEESGLPSNVVKLAHSFGY---NCQKRDNLALLDQQT-LCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPT-KMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            E + K  +S++  L  ++V L H FG+   +C  R+NL  L+  T + + +       +L+  + S+    + + I C+ V  HP  K  +A G+    + P   +++  S +   ILR    K   Y  F+ +G+LL +VG + +  +TVW W+    V         I+ V +  D +    + G  H++FW +A      K +G +G      +  +       +    +G+  G++ VW    +   + + +  P    ++   + +I+  G+       G +  WD E        +    F+++           +++  V+S             +G+I ++       +A   ++N+   GEI      P   +  +   DG++R++D   +KL+ ++          ++     P G+ V  G  +G   IL
Sbjct: 1313 EKLQKNNVSKKKKLVEDLV-LDHVFGFRGFDC--RNNLHYLNDGTDIIFHTAATAVVQSLTLGTQSFYLEHTDD-ILCLTVNQHPKYKNIIATGQ--IGTTPSIHVWDAMSKQTLSILRCCHAKGVGYVNFSATGKLLVSVGIESEHTITVWRWQEGTKVTSKGGHPDRIFVVEFRPDSDSQFVSVGIKHVKFWTLAGNSLVYK-KGVVGSVEDARMQTMLSVAFGANNLTFTGAINGDVYVWRDHFLLRMVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEM-------KRCRAFQLET---------GQVLDCVRSVCRGKGKILVGTKDGEIIEVG---EKNAASNILINSHMQGEIWGLATHPAKDVFITASDDGTIRIWDLVDKKLLNKVSLGHSAKCASYS-----PDGEMVGIGMKNGEFVIL 1722          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Cavefish
Match: si:dkey-1f12.3 (EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197])

HSP 1 Score: 103.605 bits (257), Expect = 1.741e-21
Identity = 132/574 (23.00%), Postives = 238/574 (41.46%), Query Frame = 1
Query:  181 NEVFTEETREDSKMDSVQPTQDEPPVEEEINHK-RQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKL--AHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTE--ISDIEGFVVLPDGKVLSGSEWGNMLVW-DGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITS--LSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEW 1869
             E+  +   E+S  D     + +  +E+E  H  R++  K  +P+     Y+E      + +    P++  +L   H + GY+C  R NL       + Y ++   + +    +    YL     + I C+A+HP K Y+A G+   DS     ++E   LK   +L+   +       F+  G+ LA+VG D +  + +W+W+  + +   +     I+ V  +  +   L TAG  H++FW  A    G  L G  G  GKTE  +  + G+    +  V SG+  G++ +W D  L+K           H G +  +   E   +T G DG +  WD +T +       +    + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N            + TL ++     +  H K I S    +   GK L   S D  V  +++  S+ + +    +N  I H++W
Sbjct:  615 QEMLADSNSEESDSDQSDVPEMDSEIEQETQHTYRRQVYKEDLPQ-LKEQYKEKHRAAAMKKRERAPASGARLHFIHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGH--DDDILCLAIHPLKDYVATGQVGRDSS--IHVWETEFLKPLSVLKGFHQFGVCTLDFSADGKRLASVGLDDNHTIVLWDWRKGEKLSAFRGSKDKIFVVKINPYMPDKLITAGVKHMKFWHKA----GGGLIGKKGSMGKTETMMCAVYGWT---EEMVFSGTCTGDICIWRDMFLVKTV-------KAHDGPVFSMHALEKGFVTGGKDGIVALWD-DTFERCLKTYAIKRSVLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLKKGGRC----CCFSPDGKALAVGLNDGSFLIVN------------ADTLEDL----VSFHHRKDIISDIRFSPGAGKYLAVASGDSFVDIYNVMSSKRVGVCKGSMNY-ITHLDW 1137          

HSP 2 Score: 94.3597 bits (233), Expect = 1.230e-18
Identity = 118/526 (22.43%), Postives = 210/526 (39.92%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHS-GEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEG-KPDEGIGRIMVY 1923
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   IL+D      +   F+  G+ L +VG D    + VW+W+  + +  +   +  I+ ++W    +  L + G  HI+FW +     G  L    G FG+T E+  I       D    SG+  G++ VW G    V + R  +    SG  +    EEG   T G DG I  WD  F+ I   ++ E    ++   +  +    D  L+    S   E  +                  H    P ++   H  GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS D +V  +S+    Y  +G  V     I H++W    +  + ++G G+ + Y
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILKDTHTHGIACLAFDLDGQCLVSVGLDSKNTICVWDWRRGKVLAAAPGHTDRIFDISWDLYQQSKLVSCGVKHIKFWSLC----GNALTPKRGVFGRTGELQTILCVACARDEVTYSGALNGDIYVWKG----VNLIRTIQGAHGSGIFSMNACEEG-FATGGRDGCIRLWDLSFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEVVV------------------HDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIA--RCNME-EPIRCAAVSTD--GIHLSLGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGSHLAVGSNDNSVDIYSV-VQRYKKVGECVGSLSFITHMDWSTDSKYLQTNDGSGKRLFY 478          

HSP 3 Score: 69.707 bits (169), Expect = 3.708e-11
Identity = 115/548 (20.99%), Postives = 225/548 (41.06%), Query Frame = 1
Query:  106 EMADDEKEINNDMNDEANTIDGG---------SVNEVFTEETREDSKMDSVQP--TQDEPPVEEEINHKRQKEEKVV-IPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSF-GYNCQKRDNLALLDQQT-LCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPT-KMYLAVGEKKSDSPPVTA------IYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQI--IIEEGELMTLGTD------GKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            E   + ++ +++ +D  +  DGG          +N V    +     M  V+P   Q EP V+E     R    + + +PE    +      +P       +   V++L   + G +C  R+N+  L++   + Y + +    +NL+    S+    S + I C+ +  HP     +A G+    S  +TA      +++  + +   +LR    +      F+ +G+LL +VG DP+  +T+W+W+    V      +Q I+   +  D +    + G  H+RFW +A    G  L    G     E + ++  + +  G      +G+  G++ VW  E I V+I  K     H+G +  +   + +G ++T G +      G +  WD E        ++T ++ + + +        L+ + +A+++  V       +I      +G IW L        A P           RD       +LSA+   DG++R++D   RK++ ++        + ++     P+G  V  G  +G   IL
Sbjct: 1275 EGCREVRQCDSEESDIQSEDDGGYDSDVTRENEINYVIKALSTNMRSMTGVKPHLQQKEPSVDERQGVVRPPVSRALPVPEKLQTNNVGKKKRP-------IEDLVLELVFGYRGNDC--RNNVHYLNEGADIIYHTASVGVVLNLTTGITSFYVEHSDD-ILCLTINQHPKFPNVVATGQVGIFSICLTATSPSIHVWDAMNKQTLSVLRCYHSRGICSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVASRSGHTQRIFVAEFRPDSDTQFVSVGIKHVRFWTLA----GRALLSKKGVLSSIEDARMQTMLSVAFGANNLTFTGTISGDVCVWK-EHILVRIVAK----AHTGPVFTMYTTLRDGLIVTGGKERPSKEGGALKLWDQELKRCRAFRLETGQIIDCVRSVCRGKGKILVGTRNAEIIE-VGEKNAACNILVNGHMDGPIWGL-------GAHP----------TRDV------FLSAA--EDGTVRLWDIPERKMLNKVNLGHPARTVSYS-----PEGDMVAIGMKNGEFIIL 1772          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 85.5001 bits (210), Expect = 4.001e-16
Identity = 74/311 (23.79%), Postives = 131/311 (42.12%), Query Frame = 1
Query:  322 YDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSG--EGIGCMAVHPTKMYLAVGEKKSDS------PPVTAIYEYPSLKLYRILRDGT-EKAYSYCQFNTS--GELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLP-DGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAE 1209
            Y  ++ +    +  ++ LP   +KL   +GY  +  R NL LL      Y   + +   N+ +      R  +G  + I C+AVHP K+ +A G+    S       P   +++  SL    +L  G  ++A     F+ S  G  L  V    D +L+VW+W+ E+ +   K  ++ ++   +       + T G  H+ FW +        L    G F K E       V    +G  ++G   GN+LVW     ++ +  +      S  +   ++  G L++ G D +I  WD  ++ I T E+ E
Sbjct:  216 YLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDE---QLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSSDGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKN----SLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAH--ESSVLALCMLRNGTLLSGGKDRRITAWDGNYQKIQTVEIPE 517          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001632.1 (pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-1 gene:ENSPMAG00000001473.1 transcript:ENSPMAT00000001632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.098e-15
Identity = 84/319 (26.33%), Postives = 133/319 (41.69%), Query Frame = 1
Query:  280 RQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNL-SDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGE---KKSDS---PPVTAIYEYPSLKLYRILRDGTEKAYSYC-QFNTSGE--LLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEI-SDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAE 1200
            R +   + +P+D    Y+       I  +  LP+  + L  ++GY  +  R N+ LL    L +         ++ S     YL     + I CMAVHP K+ +A G+   K  D    P    ++   SL+   ++  G       C  F+ +G   LL  V    + M++VW WK E  V  SK  ++ +Y   +    E V+ T G  +I FW +     G  L    G F K E    +   + L +G  +SG   GN+ VW G+    +I R       SG +      +G  ++ G DG +  WD +   T E
Sbjct:   25 RGRPITMFMPQDAVEGYK-------IGAKLELPAEKLSLEWAYGYRGKDCRANVELLPSGELVFFVAAVGVLQHVESGVQRHYLGH--DDDIKCMAVHPDKVIVATGQVVGKSKDGKVLPAHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENVIVTCGKNNINFWAL----DGRNLSKKQGIFEKHEKPKHVLCLIYLDNGDAVSGDSSGNIYVW-GKAGGYRITRAITGVHASGVMALCERADGTFISGGRDGHVVFWDSKMEKTGE 329          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009420.1 (pep scaffold:Pmarinus_7.0:GL476782:177851:212676:1 gene:ENSPMAG00000008506.1 transcript:ENSPMAT00000009420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 7.121e-13
Identity = 97/522 (18.58%), Postives = 194/522 (37.16%), Query Frame = 1
Query:  289 EEKVVIPEDFYYDYEEFI-----SKPFISEESGLPSNVVKLAHSFGYNCQKRDNLAL-LDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKF-GKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFE----TIDTAEVAEEMATFEMD-PMNELLVS---NDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMK-FNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSIN 1806
            +E + +P      Y  F+     S P           +++L+   G+N   R N+    D     Y  G+ +   +L   +  +L++ + E     + H  ++  +    + D+     +++       R+L     +  +   F+    +L +VG   + M+ +W+ +    +  +++    I  V       G     G+G I F +  +      LQ            S++   V+ PD  + + S  G +  WD +  +  +         +  I  +      L++  +  +I  W  E    TI     A E  + E +  ++  +VS   +D   M +V +     ++WY        W        T      L + H G++ D   SP      S   DG LRV+     +L+ + +  +   + + W P    P    V AGF DG +R+   +          ++TL ++      +PH   I  ++    G++++TG  D  V   S++
Sbjct: 1058 DEHMAVPCAQPKSYRHFVPHLKTSAPSKRRRGATGGALLRLSMVVGFNGNARGNVIWNPDSGLFAYTCGSLLVLEDLHTGAQRHLQAHTEEISTLASSHDAEVLASASGGRGDTGSQICVWDARRGSCERVLSRHRHEVQAM-AFSADNSVLLSVGDYREMMVVLWDTRTYAVIAATRSVF-PINDVCPDPSAAGAFLCVGSGAIAFCRAQNLGETAVLQLSAAPLPNGAGASELSAAVMGPDSLLFTASACGRVAAWDADRRRCLLSWDAD----TADIGVLCCHGNRLLSGSSSKRIRLWCVESVSATICVTSTASEFVSMEGEMVLDGAVVSAAFDDVMEMGIVGT--AAGTLWYIN------W--------TERACVRLVSGHRGKVNDIAFSPDGSQLVSGSEDGLLRVWSVPEMELVVQFQVLHRSCTCVAWRPSGAAP--SQVAAGFGDGTLRLFGVA---------SARTLHKL------QPHGAAIRCVAFSSDGEVMLTGGADGRVALNSVS 1540          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Sea Lamprey
Match: wdr90 (WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-070424-67])

HSP 1 Score: 64.6994 bits (156), Expect = 2.171e-10
Identity = 79/384 (20.57%), Postives = 148/384 (38.54%), Query Frame = 1
Query:  703 FNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDI----GKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCH------SGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNF---EGSKILWA--PLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLS-TDDKGKILITGSEDETVFFFSIN 1806
            F+     L ++G   D  L +W  + + ++L S       + +A+     G    A +GHI F  +        L  D+     + G  E++ +        G V +G+  G +  WD E          +K C       S  +  +      L+T G   ++  W   ++D A V E         + E  +  DA  +      + +  +       G +W +  +   +      L + H+ ++     SP   L AS  +DGSLRV+D  AR L   ++F         + W+  P +     + V AG+ DG +R+                +L  + ++   + H   +T+L+ + D G+ L++G+ D  V   S++
Sbjct: 1297 FSRDDRFLLSLGDGRDGSLALWAVQQDVSLLASVRCPVPAHALAFRPGRAGEFVCAASGHIAFGLVEQRGREFGLSLDMVAVPPELGGAEVTCV---CYGAGGVVFAGTSSGLVSAWDSE----------RKSCFLTWEADSLALGVLECRGHSLVTAGAGRRLRRWSVASVDAARVQERGTRGADCVVLEAELRLDASAVSAAFDDDLDMGV--VGTAVGTVWFIGWAECSSMR----LVSGHAEQVTGLAFSPDEALFASSAADGSLRVWD--ARSLELSVQFQVLQQTCECVAWSRVPARRSRFSRLVAAGYGDGAVRLF---------------SLRSVEMVLKMRSHGSAVTALAFSTDAGEFLVSGARDGLVVVSSLH 1644          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Sea Lamprey
Match: wdr90 (WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-070424-67])

HSP 1 Score: 61.6178 bits (148), Expect = 2.279e-9
Identity = 78/386 (20.21%), Postives = 150/386 (38.86%), Query Frame = 1
Query:  703 FNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDI----GKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCH------SGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGN--GKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNF---EGSKILWA--PLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLS-TDDKGKILITGSEDETVFFFSIN 1806
            F+     L ++G   D  L +W  + + ++L S       + +A+     G    A +GHI F  +        L  D+     + G  E++ +        G V +G+  G +  WD E          +K C       S  +  +      L+T G   ++  W   ++D A V       +    + +++  + +L     S   +  +     G   G +W +  +   +      L + H+ ++     SP   L AS  +DGSLRV+D  AR L   ++F         + W+  P +     + V AG+ DG +R+                +L  + ++   + H   +T+L+ + D G+ L++G+ D  V   S++
Sbjct: 1238 FSRDDRFLLSLGDGRDGSLALWAVQQDVSLLASVRCPVPAHALAFRPGRAGEFVCAASGHIAFGLVEQRGREFGLSLDMVAVPPELGGAEVTCV---CYGAGGVVFAGTSSGLVSAWDSE----------RKSCFLTWEADSLALGVLECRGHSLVTAGAGRRLRRWSVASVDAARV-------QCTSADCVVLEAELRLDASAVSAAFDDDLDMGVVGTAVGTVWFIGWAECSSMR----LVSGHAEQVTGLAFSPDEALFASSAADGSLRVWD--ARSLELSVQFQVLQQTCECVAWSRVPARRSRFSRLVAAGYGDGAVRLF---------------SLRSVEMVLKMRSHGSAVTALAFSTDAGEFLVSGARDGLVVVSSLH 1582          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006636.1 (pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1 gene:ENSPMAG00000005975.1 transcript:ENSPMAT00000006636.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.226e-7
Identity = 56/267 (20.97%), Postives = 108/267 (40.45%), Query Frame = 1
Query:  280 RQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSF----GYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDS------PPVTAIYEYPSLKLYRILRDGT-EKAYSYCQFN-TSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLP-DGKVLSGSEWGNMLVW 1041
            R +   + +P+D   DY        +  +   P+  +KL   +    G +C  R+NL LL    + Y   + +   +  + +  +      + + C+A+HP ++ +A G+           P    +++  SLK   ++  G  E+      F+ T+  LL  V    + +L+VW+W+    +   K  ++ ++   +       + T G  H+ FW    T  G  L    G F K +       V    +G  ++G   GN+ VW
Sbjct:  185 RGRPITMYLPQDMVEDYR-------LDTKLEPPAEKLKLNWVYYGYRGKDC--RNNLYLLPTGEMVYFIASVVVLYSPEEGNQRHYLE-HNDDVKCLAIHPDRITIATGQVVGTGKDGKTLPAHVRVWDSVSLKTLHVIGTGVFERGILCLAFSKTNCGLLCAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMDPRAIVTCGKSHVHFW----TLEGNSLSKKQGIFEKHDKPKYVLCVTFAENGDAITGDSSGNIFVW 437          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Nematostella
Match: EDO32311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVF3])

HSP 1 Score: 112.849 bits (281), Expect = 1.331e-28
Identity = 65/150 (43.33%), Postives = 91/150 (60.67%), Query Frame = 1
Query: 5131 ISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPP 5580
            I E + +   MM  KFG+L +LEK+E V +N  +EEL  K+   +     + ++W+ +I   ++K  +  + NT  LD    L  EK+ LE  L+S+QK LG EF     A   E  +L QLV +QAQE+DALK+EI +LSRKGGHILPP
Sbjct:    1 IDELEEKVRNMMMLKFGRLVDLEKLETVTVNRTVEELKEKLRQAESESARDVAKWDSKIDSYKQKSTQLTRENTQRLDTFTVLLQEKKELEHMLDSRQKSLGTEFTGARKADLRERQRLVQLVQLQAQEIDALKDEITLLSRKGGHILPP 150          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Nematostella
Match: EDO48487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ6])

HSP 1 Score: 91.2781 bits (225), Expect = 1.851e-18
Identity = 109/483 (22.57%), Postives = 185/483 (38.30%), Query Frame = 1
Query:  364 ESGLPSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFE--------TIDTAEVAEEMATFEMDPMNE-LLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSED 1779
            E   PS+ ++L   +GY   Q R+NL     + + Y         N  + +  +      + I  +A+HP K+ +A G+   D  P   +++  S +   IL+D  ++  +   FN SG  L +VG +   M+ VW+WK  + +  ++  +  I+ + ++   E VL + G  HI FW    T  G  L    G FGKT EI          D    SG+  G +  W G+ +   I        H+G +  I        +   DG +  WD E         I+T    E ++   +  + E +LV  +A  +  V + + +                         P  I+     GE+      P   + A+   D S+R++  A + L+A    +    K+       D  G  +  G  DG   IL            K++ L E+  I   K   + +  +     G+ L  GS D
Sbjct:    3 ERTAPSSQIRLEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLG-HDDDIISLALHPEKVLVATGQVGKD--PYICVWDSHSTETVSILKDAHQRGITCLAFNPSGNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQFNPYKENVLVSCGVKHIIFW----TLRGNSLNPKKGIFGKTGEIQTNLCLAFGSDDVTYSGTLSGEIYKWKGQNLAGAI-----PNAHTGAVFSIFGGADGFASGSKDGTVVLWDAEFKPIAKLDLINTRVGYEGLSIRSVCWLGEKILVGTNAGEVFEVMATDKDK------------------------PRTIVQGHAEGELWALAAHPKKGIFATGSDDKSVRLWSMADKSLLARTDVD---QKVRSVAFNAD--GTHLAVGLSDGSFMIL------------KARDLSEVTRINDRK---EVLHEMKYSPDGQFLAVGSND 429          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Nematostella
Match: EDO42783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0R4])

HSP 1 Score: 73.559 bits (179), Expect = 3.257e-13
Identity = 45/153 (29.41%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  445 LDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYR-ILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKM 900
            +++ T+C++ GN I+F+N  D S ++L S  G+GI  +  +P     A  E+KSD  P   +Y +P     R IL+ G + +YS   F  +  +LA     PDF LTVW W ++  +       Q    ++++      L T G   +  W +
Sbjct:   23 INKHTVCFVCGNSIKFINTKDNSEAFLPS-PGDGIVHLVTNPGYDLYAFTERKSD--PRIFVYMFPDFSEPRAILKGGAQLSYSSIAFAHNSTVLAAFSGLPDFQLTVWNWTDQVPLCSISVVHQTCTNMSFNPLNWRQLCTIGPEMLTVWNI 172          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Nematostella
Match: EDO36068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM7])

HSP 1 Score: 70.4774 bits (171), Expect = 5.620e-12
Identity = 84/405 (20.74%), Postives = 167/405 (41.23%), Query Frame = 1
Query:  544 GIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQ--FNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQD---IYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFG--KTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTD-------------------GKINTWDFETIDTAEVAEEMATFE-----------MDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTS----APPEILN-TFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNF 1632
            G+  MAV P + Y+A+ EK   +     IY+  +L+  ++L     ++  +    F+   + L +    PD+ L  W W+  + +  +K+ +Q    +Y+V+++      L   G G  + ++ ++        G++ +F   K E  +      + D ++++G++ G +L+++   +K +       P   GT  Q+         +G D                   G I +    T+   E AEE   ++            +P  +++ S + K + V  S ET            +++ + LS +       A  E+L+ +FH G I   DV     L A+   D S+R++++    L A  +F  E   I      + P G  ++ GF D  +R++N 
Sbjct:   31 GMTAMAVSPNRRYVAIAEKGEKA--TITIYDLHTLRKKKVLSHPEVQSAEFVSLAFSPDSKYLVSQSGRPDWTLLYWTWEKAKVMAFTKSSNQQDSAVYQVSFNPQDNTQLCVVGNGIFKLFRYSE--------GNLKQFAFQKMEPQNFLCHAWVSDERIITGTDTGRLLLFESGELKNEFSVFGGGPSAPGTARQL-----STAAIGADPSPTQTAYPQVTCIAAFSKGFICSGGAGTVHLFEKAEEKDAYKKSREIRIPTDTTNPDPQMIESQEIKDLTVSPSEET----LVCSTSTSQLYSITLSTADLGKGDLATFELLSQSFHHGVITGMDVCIRKPLIATCSLDRSVRIWNYETCSLEAYKEFQEECYSI-----ALHPSGLYILVGFSDK-LRLMNL 410          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Nematostella
Match: EDO49877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY9])

HSP 1 Score: 68.5514 bits (166), Expect = 1.770e-11
Identity = 66/270 (24.44%), Postives = 120/270 (44.44%), Query Frame = 1
Query:  406 FGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKS---DSPPVTAIYEYPS---LKLYRILRDGTEKAYSYCQFNT--SGELLATVGSDPD-FMLTVWEWKNEQTVLRSKAFSQD-IYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISD-IEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQI-IIEEGELMTL-GTDGKINTWD 1176
            +GY   +R+   L   + L +IS   + +   S+    Y  +   + I CMAVHP + Y+A G+      D   ++ I  + +   + L  +  D    +     F+   +G+ L  + S+ D F L +WEW++   + +SK   Q  +  +A+  D    + + G  HI FW+  +     KL+   G F K  +   +      P+G + +G   G + VW     K++   +N    H  +I  + ++  G L+T  G DG++  WD
Sbjct:    1 YGYQGTQRNLHVLPSGEILYFISRIVVIYNKKSNIQRHY--TGHADDIKCMAVHPNQWYIATGQASGLSLDQNEMSHIRLWDAETLITLVVLPLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSKTIVSCGKEHIYFWRWHNG----KLERKNGYFEKYPVPQYLTCMDFAPNGDICTGDSSGTVTVWGKVSKKIKFVVRNA---HEKSIFCLRVLPNGTLLTAGGVDGRVCAWD 261          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Medaka
Match: ENSORLT00000018745.2 (cilia and flagella associated protein 44 [Source:NCBI gene;Acc:101160927])

HSP 1 Score: 447.203 bits (1149), Expect = 1.430e-130
Identity = 242/589 (41.09%), Postives = 356/589 (60.44%), Query Frame = 1
Query:  322 YDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHT-------------SAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIG-RIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKS 2046
            Y YEE  S+  +S    +P +++ L+HSFG++ ++R NL +LD  TL +I+GN +  +++      +LRS  G GIG +AVHP++ + AV EK +   P   +YEYPSL+  RILR GT   YS   FN  G LLA+VG +PDF+LT+W+W+ E+ V   +A SQ+++RV++S   + +LTTAG  HI FWK++ TFTG KL+   G FG +  SDIEG + LPDG+V+SG+EWGN+L+WDG  IK +I  K+ + CHSGT     +E G+L+T G+DG + +WDFE I +       +  E++P+NEL+V     L  VVKS    SS+W+AQD NG IW LDLSFS +             +A P  L +  SG I+  DVS  S+L A+   D S+RVFD  A++ +    FN  G+ + WAPL V+ KG  ++ GF DGV+R+L     L+ D    ++    +HL QA KPH+  +T+++    G IL TGSED+TVFFF++  + + P+GF+ +  P+  +EW       PD   G R+++    G   EV  P+  +    +++ L E+ P   + F SI S
Sbjct:   25 YKYEELRSRASVSPGLDIPEDLLHLSHSFGFDSRRRANLGVLDDSTLIFIAGNLMVLLDVHAQEQRFLRSSGGGGIGAIAVHPSREFFAVAEKGTS--PDIIVYEYPSLRPGRILRGGTRHRYSCVSFNHDGSLLASVGGEPDFLLTLWDWRREE-VQSFQATSQEVHRVSFSHYDQELLTTAGCRHINFWKLSTTFTGFKLEKLAGHFGNSVASDIEGVLELPDGEVVSGTEWGNLLLWDGNSIKAEICCKDGRSCHSGTAQPFALEGGKLLTFGSDGAVRSWDFERISSFTCDGGGSRLEVEPINELVVGRHVCLSSVVKSSLPGSSVWFAQDSNGGIWNLDLSFSPSVKFFRLCVFCILQAADPRRLLSCPSGPIKGLDVSKTSHLMATTALDCSVRVFDLLAKREVTSSCFNQGGTALSWAPLTVNQKGGLLVTGFEDGVVRLLE----LRADSGVSAEEHTRLHLKQALKPHSAAVTAVAFQPDGHILATGSEDQTVFFFTVGEACH-PLGFIHVPGPVQALEW------SPDSHNGRRLLILCRSGHALEVESPDLEAERSPQSFHLPEL-PRRCFGFSSITS 598          

HSP 2 Score: 105.916 bits (263), Expect = 3.092e-22
Identity = 55/170 (32.35%), Postives = 98/170 (57.65%), Query Frame = 1
Query: 2242 PETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRT--MTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKT 2745
            P+   P+L GF   ++  +FWLSMG +D+GYLY C+F     +   +   + +EP +   +  ++D P+ SM +S   + ++ G  +G+IR+  L +P DL    M + W  SVHDN+YG +  +  S+D+ F+++ G+DGN F +  +     ++ ++  RAR+PS + 
Sbjct:  628 PQPPGPLLCGFY--SEPGQFWLSMGGFDSGYLYHCKFSEDQSEEPCR---RQDEPFDFLLVSGADDDPICSMTFSR--QLLLCGMHSGTIRVYPL-RPGDLAPADMQAYWALSVHDNHYGHLRHIRCSFDDLFVLTAGDDGNIFSFSRVPPEESQRGLQRQRARIPSPRV 789          

HSP 3 Score: 87.0409 bits (214), Expect = 1.676e-16
Identity = 136/476 (28.57%), Postives = 235/476 (49.37%), Query Frame = 1
Query: 4156 FDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENL-NKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPP 5580
            FD++L LLR +K    + L++A L  LT+F+E  +L  +E+ E SL EK+        +I  +    QLK   +++ I+ L E +      F+ S+ EN+ + + L K++KKK  R+KKE    + S +  ++  ++  + G    +  E D S                D  +CP GC  +L+    QLRE   D+EE + E  K  +ALKKE + L  K  KV++++  + ++E+E    +K QK+ Q++ +V  +LHQI    NG +PSD+  AL+ + S    L+ R+++LQ E+  +     + +L   + Q++R + + K    + +C+E+M  K+G+L ++E +  +    K+++L  + L L+     E   W+   R  +    ++ K      D     F +   LED+                    E+I KL +LV  Q Q+  AL   I +LS K G +LPP
Sbjct:  966 FDSELLLLRQQKVRLDIHLKQADLHLLTLFQETVILGSFEEREASLQEKS--------NISKETWTEQLK--QRRRVIEELQEDEEALAADFQASVAENHHYEDLLTKIFKKKAARKKKEKRAGSPSEE--DSDDSLEDWDGCIDSDMEEEDGSS--------------VDDKVCPTGCDPDLFRKILQLRERRWDLEEMLVEAGKSADALKKESDGLITKVGKVLKSSQQRIEEEVELINKDKLQKMKQVEVVVPFRLHQIQFLSNGSVPSDLSEALVLDKSEMDRLRRRVQQLQVEKEAE-----EGRLLQAQRQRSRLIRENKEMTLEKQCNELMMLKYGRLLDVEALLSMSGQKKLDKLKEEKLLLEAEHAKELKRWKVCQRGERRFVCDQRKCGAAETDRRCLQFQDHRRLEDR--------------------EDIRKLQELVQAQEQQAQALLRRIHLLSSKEGCVLPP 1390          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Medaka
Match: si:dkey-1f12.3 (EMAP like 5 [Source:NCBI gene;Acc:101166098])

HSP 1 Score: 98.9821 bits (245), Expect = 4.500e-20
Identity = 113/490 (23.06%), Postives = 204/490 (41.63%), Query Frame = 1
Query:  196 EETREDSKMDSVQPTQ-DEPPVEEEINHKRQ-KEEKVVIPEDFYYDYEEFISK---PFISEESGLPSNVVKL--AHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTE--ISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILN 1629
            +ET  DS  +     Q D P ++ EI  + Q    + V  ED     E+   K     + +    P++ +KL   H + GY+C  R NL       + Y ++   + +    +    Y+     + I C+A+HP K ++A G+   DS     +++  +LK   +L+   +       F+  G  L ++G D +  + +W+W+  +T+   +     I+ V  +  L   L TAG  H++FW  A    G  L G  G  GKTE  +  + G+    +  V SG+  G++ +W    +   +        H G +  +   E   +T G DG +  WD +T +       +    + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N
Sbjct:  608 QETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKVKHRATAMKKRERAPASGIKLHFIHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNGQQNTQRFYMGH--DDDILCLAIHPLKDFVATGQVGRDSS--VHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKA----GGGLIGRKGNMGKTETMMCAVYGW---SEEMVFSGTCTGDICIWRDMFLMKTV------KAHDGPVFSMHALEKGFVTGGKDGIVALWD-DTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLRKGGRC----CCFSPDGKALAVGLNDGSFIIVN 1065          

HSP 2 Score: 92.0485 bits (227), Expect = 5.229e-18
Identity = 116/525 (22.10%), Postives = 210/525 (40.00%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEG-KPDEGIGRIMVY 1923
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   IL+D      +   F+  G+ L +VG D    + VW+W+  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    SG  +    EEG   T G DG +  WD  F+ I   ++ E    ++   +  +    D  L   V + ++E       D N               P  I+     GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS + +V  + +    Y  +G  +  N  I H++W    +  + ++G GR + Y
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQPSKLVSCGVKHIKFWSLC----GNALTPKRGVFGKTGDLQTILCLACAKDEITYSGALNGDIYVWKG----INLLRTIQGAHGSGIFSMNACEEG-FATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHIL---VGTQDSEIFEVVVHDRN--------------KPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIA--RCNME-EPIRCAAVSTD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGAHLAVGSNENSVDIYGV-VQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFY 478          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Medaka
Match: si:dkey-1f12.3 (EMAP like 5 [Source:NCBI gene;Acc:101166098])

HSP 1 Score: 98.9821 bits (245), Expect = 5.230e-20
Identity = 113/490 (23.06%), Postives = 204/490 (41.63%), Query Frame = 1
Query:  196 EETREDSKMDSVQPTQ-DEPPVEEEINHKRQ-KEEKVVIPEDFYYDYEEFISK---PFISEESGLPSNVVKL--AHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTE--ISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILN 1629
            +ET  DS  +     Q D P ++ EI  + Q    + V  ED     E+   K     + +    P++ +KL   H + GY+C  R NL       + Y ++   + +    +    Y+     + I C+A+HP K ++A G+   DS     +++  +LK   +L+   +       F+  G  L ++G D +  + +W+W+  +T+   +     I+ V  +  L   L TAG  H++FW  A    G  L G  G  GKTE  +  + G+    +  V SG+  G++ +W    +   +        H G +  +   E   +T G DG +  WD +T +       +    + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N
Sbjct:  608 QETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKVKHRATAMKKRERAPASGIKLHFIHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNGQQNTQRFYMGH--DDDILCLAIHPLKDFVATGQVGRDSS--VHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKA----GGGLIGRKGNMGKTETMMCAVYGW---SEEMVFSGTCTGDICIWRDMFLMKTV------KAHDGPVFSMHALEKGFVTGGKDGIVALWD-DTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLRKGGRC----CCFSPDGKALAVGLNDGSFIIVN 1065          

HSP 2 Score: 91.6633 bits (226), Expect = 7.583e-18
Identity = 116/525 (22.10%), Postives = 210/525 (40.00%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEG-KPDEGIGRIMVY 1923
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   IL+D      +   F+  G+ L +VG D    + VW+W+  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    SG  +    EEG   T G DG +  WD  F+ I   ++ E    ++   +  +    D  L   V + ++E       D N               P  I+     GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS + +V  + +    Y  +G  +  N  I H++W    +  + ++G GR + Y
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQPSKLVSCGVKHIKFWSLC----GNALTPKRGVFGKTGDLQTILCLACAKDEITYSGALNGDIYVWKG----INLLRTIQGAHGSGIFSMNACEEG-FATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHIL---VGTQDSEIFEVVVHDRN--------------KPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIA--RCNME-EPIRCAAVSTD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGAHLAVGSNENSVDIYGV-VQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFY 478          

HSP 3 Score: 70.8626 bits (172), Expect = 1.800e-11
Identity = 95/436 (21.79%), Postives = 182/436 (41.74%), Query Frame = 1
Query:  406 FGYNCQK-RDNLALLDQQT-LCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HP-------TKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQI--IIEEGELMTLGTD------GKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            FGY     R+N+  L++   + Y + +    +NL+    S+    S + I C+ +  HP       T      G+  + SP +  +++  + +   +LR           F+ +G+LL +VG DP+  +T+W+W+    V      SQ I+   +  D +    + G  H+RFW +A    G  L    G     E + ++  + +  G      +G+  G++ VW  E I V+I  K     H+G +  +   + +G ++T G +      G +  WD E        ++T ++ + + +        L+ + +A+++  V       +I      +G IW L    +H S              RD       +LSA+   DG++R++D   +K++ ++        I ++     P+G  V  G  +G   IL
Sbjct: 1366 FGYRGSDCRNNVHYLNEGADIIYHTASVAIVLNLTTSCQSFYLEHSDD-ILCLTINQHPKFPNVVATGQVGDAGDMAATSPSI-HVWDAMTKQTLSVLRCFHSSGVCSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVANRIGHSQRIFVAEFRPDSDTHFVSVGIKHVRFWTLA----GRALLSKKGVLSSIEDARMQTMLSVAFGANNLTFTGTISGDVCVWK-EHILVRIVAK----AHTGPVFTMYTTLRDGLIVTGGKERPSKDGGALKLWDQELKRCRAFRLETGQIIDCVRSVCRGKGKILVGTRNAEIIE-VGEKNAACNILVNGHMDGPIWGL---CTHPS--------------RDV------FLSAA--EDGTVRLWDIPEKKMLNKVNLGHPAHAISYS-----PEGDMVAIGMKNGEFIIL 1759          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Medaka
Match: si:dkey-1f12.3 (EMAP like 5 [Source:NCBI gene;Acc:101166098])

HSP 1 Score: 98.9821 bits (245), Expect = 5.314e-20
Identity = 113/490 (23.06%), Postives = 204/490 (41.63%), Query Frame = 1
Query:  196 EETREDSKMDSVQPTQ-DEPPVEEEINHKRQ-KEEKVVIPEDFYYDYEEFISK---PFISEESGLPSNVVKL--AHSF-GYNCQKRDNLALLDQQTLCY-ISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTE--ISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILN 1629
            +ET  DS  +     Q D P ++ EI  + Q    + V  ED     E+   K     + +    P++ +KL   H + GY+C  R NL       + Y ++   + +    +    Y+     + I C+A+HP K ++A G+   DS     +++  +LK   +L+   +       F+  G  L ++G D +  + +W+W+  +T+   +     I+ V  +  L   L TAG  H++FW  A    G  L G  G  GKTE  +  + G+    +  V SG+  G++ +W    +   +        H G +  +   E   +T G DG +  WD +T +       +    + P ++ L+  D   +  +        +      NG+I ++D      S P  +L   H  GE+      P   L A++  D +LR++D +    M  ++   +G +         P GK +  G +DG   I+N
Sbjct:  608 QETLADSNSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKVKHRATAMKKRERAPASGIKLHFIHGYRGYDC--RSNLFYTQTGEIVYHVAAVGVVYNGQQNTQRFYMGH--DDDILCLAIHPLKDFVATGQVGRDSS--VHVWDTETLKPISVLKGSHQLGVCALDFSADGRRLVSIGLDDNHTIVLWDWRKGETLSAMRGSKDKIFVVKINPYLPDKLITAGVKHMKFWHKA----GGGLIGRKGNMGKTETMMCAVYGW---SEEMVFSGTCTGDICIWRDMFLMKTV------KAHDGPVFSMHALEKGFVTGGKDGIVALWD-DTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGHILV---GTKNGEILEVD-----KSGPITLLVQGHMEGEVWGLASHPHLPLCATVSDDKTLRIWDLSPSHCMLAVRKLRKGGRC----CCFSPDGKALAVGLNDGSFIIVN 1065          

HSP 2 Score: 91.6633 bits (226), Expect = 7.082e-18
Identity = 116/525 (22.10%), Postives = 210/525 (40.00%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKT-EISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWD--FETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEG-KPDEGIGRIMVY 1923
            P+  ++L   +GY   Q R+NL     + + Y         N  +    +    + + I  +A+HP ++ +A G+   +  P   +++  +++   IL+D      +   F+  G+ L +VG D    + VW+W+  + +  +   +  I+ ++W       L + G  HI+FW +     G  L    G FGKT ++  I       D    SG+  G++ VW G    + + R  +    SG  +    EEG   T G DG +  WD  F+ I   ++ E    ++   +  +    D  L   V + ++E       D N               P  I+     GE+    V P   L+ +   D S+R++      L+A  + N E   I  A +  D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  L     G  L  GS + +V  + +    Y  +G  +  N  I H++W    +  + ++G GR + Y
Sbjct:    7 PNCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYNTREHKQKFYLGHNDDIIS-LALHPERVLVATGQVGKE--PYICVWDSYTVQTVSILKDVHTHGIACLAFDLEGQCLVSVGLDSKNTICVWDWRRGKVLAVAPGHTDRIFDISWDLYQPSKLVSCGVKHIKFWSLC----GNALTPKRGVFGKTGDLQTILCLACAKDEITYSGALNGDIYVWKG----INLLRTIQGAHGSGIFSMNACEEG-FATGGRDGCVRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHIL---VGTQDSEIFEVVVHDRN--------------KPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLIDHALIA--RCNME-EPIRCAAVSTD--GIHLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEAIHELKYSPDGAHLAVGSNENSVDIYGV-VQRYKKVGECMGSNSFITHMDWSTDSKYLQTNDGSGRRLFY 478          

HSP 3 Score: 73.1738 bits (178), Expect = 3.486e-12
Identity = 94/429 (21.91%), Postives = 180/429 (41.96%), Query Frame = 1
Query:  406 FGYNCQK-RDNLALLDQQT-LCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQI--IIEEGELMTLGTD------GKINTWDFE-------TIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRIL 1626
            FGY     R+N+  L++   + Y + +    +NL+    S+    S + I C+ +  HP K    V   +  + P   +++  + +   +LR           F+ +G+LL +VG DP+  +T+W+W+    V      SQ I+   +  D +    + G  H+RFW +A    G  L    G     E + ++  + +  G      +G+  G++ VW  E I V+I  K     H+G +  +   + +G ++T G +      G +  WD E        ++T ++ + + +        L+ + +A+++  V       +I      +G IW L    +H S              RD       +LSA+   DG++R++D   +K++ ++        I ++     P+G  V  G  +G   IL
Sbjct: 1366 FGYRGSDCRNNVHYLNEGADIIYHTASVAIVLNLTTSCQSFYLEHSDD-ILCLTINQHP-KFPNVVATGQVATSPSIHVWDAMTKQTLSVLRCFHSSGVCSVSFSATGKLLLSVGLDPEHTITIWKWQEGAKVANRIGHSQRIFVAEFRPDSDTHFVSVGIKHVRFWTLA----GRALLSKKGVLSSIEDARMQTMLSVAFGANNLTFTGTISGDVCVWK-EHILVRIVAK----AHTGPVFTMYTTLRDGLIVTGGKERPSKDGGALKLWDQELKRCRAFRLETGQIIDCVRSVCRGKGKILVGTRNAEIIE-VGEKNAACNILVNGHMDGPIWGL---CTHPS--------------RDV------FLSAA--EDGTVRLWDIPEKKMLNKVNLGHPAHAISYS-----PEGDMVAIGMKNGEFIIL 1752          
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Medaka
Match: EML6 (echinoderm microtubule-associated protein-like 6 [Source:NCBI gene;Acc:101159527])

HSP 1 Score: 96.6709 bits (239), Expect = 1.870e-19
Identity = 116/529 (21.93%), Postives = 212/529 (40.08%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNC-QKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGK---VLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTW--DFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDG---VIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIG-FVKLNKPIHHVEWKATVEGK---PDEGIGRIMVY 1923
            P   ++L   +GY   Q R+NL     + + Y         N  + S  +      + I  +A+HP +  +A G+   D  P   +++  +++   +LRDG     +   F+  G+ LA+VG D    + +WEW+  + +  +   S  I+ + W    +  L + G  HI+FW +     G  L    G FGK    D++  + +   K     SG+  G++ VW G    + + R  +    +G  +    EEG   T G DG +  W  DF+ I   ++ E    ++   +  +    D  L     +   +S I             ++       P  I+     GE+   D+ P   L+ +   D S+R++      L+A  + N E   +      +D  G  +  G  DG   V+R+ + ++V              +H+    K   + I  +     G  L  GS D  V  +++    Y  +G   K +  I H++W  +++GK    ++G G  + Y
Sbjct:    7 PGCRLRLDWVYGYRGHQCRNNLFYTAGKEVVYFVAGVGVVYNTREHSQRFYMG-HNDDIISLALHPERSLVATGQVGKD--PYVCVWDSFTVQTVSLLRDGHTHGIACLTFSADGQRLASVGLDAKNTVCIWEWRRGKILASATGHSDRIFDICWDPFQQDRLVSCGVKHIKFWALC----GNALTPKRGIFGKA--GDLQTILCVASAKDDITYSGALNGDVYVWKG----LNLIRTVQSAHGAGIFSMFSCEEG-FATGGRDGCVRLWDGDFKPITKIDLREAEQGYKGLSIRSVCWRADRIL-----AGTQDSEI------------FEVMVRERDKPLLIMQGHSEGELWALDIHPKKPLAVTGSDDRSVRLWSLVDHALIA--RCNME-EAVRSVAFSMD--GSQLALGMKDGSFTVLRVRDMTEV--------------VHI----KDRKEVIHEMKFSPDGAYLAVGSNDGLVDVYAV-AQRYKKVGECSKSSSFITHMDW--SLDGKILQTNDGAGEHLFY 478          

HSP 2 Score: 88.9669 bits (219), Expect = 4.371e-17
Identity = 119/563 (21.14%), Postives = 229/563 (40.67%), Query Frame = 1
Query:  211 DSKMDSVQPTQDEPPVEEEINHKRQ--KEEKVVIPEDFYYDYEEFISKPFISEESGLPSNV-VKLAHSF-GYNCQKRDNLALLDQ-QTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTE--ISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFH-SGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLS-TDDKGKILITGSEDETVFFFSINPSEYLPIGFVK-LNKPIHHVEW 1869
            DS    V     +   E +IN+ RQ  KE+   +P+      E+      +  + G    + ++  H + GY+C  R+NL      + L +++   + +         YL     + I  +++HP K + A G+   D  P   +++  +LK   +L+   ++      F+  G+ L +VG D D  + +W+WK  + +  ++   + I+ V  +  L   L T G  HI+FW+ A      K +G     G+ E  +S   G     +  V SG+  G++ +W   L+   +        H G +  +   +   +T G DG +  WD +  D       +    + P ++ L+  D   +  +        +      NG++ ++D      + P  +L   H  GE+      PL  + A++  D +LR+++ +    M  ++    G +         P GK +  G  DG + ++N            + TL ++      +     I+ L  T D GK L   S D  V  +++  ++   +G  K  +  I H++W
Sbjct:  617 DSDASDVPELDSDIEQETQINYDRQVYKED---LPQLRQQSREKKQQVGSLKRQKGPEQGLRLRFVHGYRGYDC--RNNLFYTQSGEVLFHVAAVGVVYNRQLHSQRFYLGH--DDDILSLSIHPLKDFAATGQVGRD--PAIHVWDIQTLKCLSLLKGFHQRGVCALDFSADGKSLVSVGLDDDHSIILWDWKRGEKLATARGHKEKIFVVKCNPMLMDKLVTVGIKHIKFWQHAGGGLIFK-RGAFRSSGRHETMMSVCYG---RNEALVFSGAATGDVYIWKEPLLLKTV------KAHDGPVFAMFSLDKGFVTGGKDGVVALWD-DMFDRCLKTYAIKRAALSPASKGLLLEDNPSIRAITLGHGHILV---GTKNGEVLEID-----KTGPMTLLVQGHMEGEVWGLAPHPLLPICATVSDDKTLRLWETSTSHRMVAVRKLKRGGRC----CAFSPDGKVLAVGLSDGGVLVVN------------ADTLEDLLSFHHRR---DAISDLRFTPDSGKYLAVASHDTFVDIYNVLTTK--RVGICKGASSYITHIDW 1130          
BLAST of cilia- and flagella-associated protein 44-like vs. Planmine SMEST
Match: SMESG000022927.1 (SMESG000022927.1)

HSP 1 Score: 3472.56 bits (9003), Expect = 0.000e+0
Identity = 1835/1866 (98.34%), Postives = 1838/1866 (98.50%), Query Frame = 1
Query:  109 MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLGQDAFQDKLAALEEVTQ 5706
            MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVLRHEEELEKKRIEEEERQKILAKERKERLERGVETEEEQYKQIEEDEKRRAEEAAKEEEWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIEFKKELEERKKAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYKKKIKRRKKEAEG  + S  +    +                   LDDEEGESDEETVVYDLDMCPPGCSQELYDSTCQLRELHLDIEEEMFEEKKVFEALKKEQENLNKKTKVVEAALLQAKKELEAFQLEKQQKLNQLKTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLGQDAFQDKLAALEEVTQ
Sbjct:    1 MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVLRHEEELEKKRIEEEERQKILAKERKERLERGVETEEEQYKQIEEDEKRRAEEAAKEEEWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIEFKKELEERKKAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYKKKIKRRKKEAEGEGEDSDESSESDDSD-----------------LDDEEGESDEETVVYDLDMCPPGCSQELYDSTCQLRELHLDIEEEMFEEKKVFEALKKEQENLNKKTKVVEAALLQAKKELEAFQLEKQQKLNQLKTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLGQDAFQDKLAALEEVTQ 1849          
BLAST of cilia- and flagella-associated protein 44-like vs. Planmine SMEST
Match: SMESG000022927.1 (SMESG000022927.1)

HSP 1 Score: 3454.07 bits (8955), Expect = 0.000e+0
Identity = 1829/1866 (98.02%), Postives = 1832/1866 (98.18%), Query Frame = 1
Query:  109 MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVXXXXXXXXXXXXXXXXXXXXXAKERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIXXXXXXXXXXXAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYXXXXXXXXXEAEGVNKSSKGNETRKNITFYKGXXXXXXXXXXXXXXXXXXXXXXXXTVVYDLDMCPPGCSQELYDSTCQLRELHLDIXXXXXXXXXXXXALKKEQENLNKKTKVVXXXXXXXXXXXXXFXXXXXXXXXXXXTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLGQDAFQDKLAALEEVTQ 5706
            MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVLRHEEELEKKRIEEEERQKILAKERKERLERGVETEEEQYKQIEEDEKRRAEEAAKEEEWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDK      VQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIEFKKELEERKKAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYKKKIKRRKKEAEG  + S  +    +                   LDDEEGESDEETVVYDLDMCPPGCSQELYDSTCQLRELHLDIEEEMFEEKKVFEALKKEQENLNKKTKVVEAALLQAKKELEAFQLEKQQKLNQLKTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLGQDAFQDKLAALEEVTQ
Sbjct:    1 MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPVEEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSFGYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIGRIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVLRHEEELEKKRIEEEERQKILAKERKERLERGVETEEEQYKQIEEDEKRRAEEAAKEEEWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPSPDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGSIRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDGNFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEHKQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISANSFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLECDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKETTVTDK------VQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLDDNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSADYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIETIKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIEFKKELEERKKAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLAEDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIFDTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTEEKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNKFAEYLNKVYKKKIKRRKKEAEGEGEDSDESSESDDSD-----------------LDDEEGESDEETVVYDLDMCPPGCSQELYDSTCQLRELHLDIEEEMFEEKKVFEALKKEQENLNKKTKVVEAALLQAKKELEAFQLEKQQKLNQLKTIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQLNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIEQVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCTLDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQAQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLGQDAFQDKLAALEEVTQ 1843          
BLAST of cilia- and flagella-associated protein 44-like vs. Planmine SMEST
Match: SMESG000027261.1 (SMESG000027261.1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.199e-18
Identity = 113/505 (22.38%), Postives = 200/505 (39.60%), Query Frame = 1
Query:  376 PSNVVKL--AHSF-GYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFW-KMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHS-GEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTK-KITSLS-TDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEW 1869
            PS  ++L   H + GY+C  R+N+  L    + +        MN++  +  +  S   + I C+ +HP K  +A GE   +  P   +++  ++K   IL+   E+      F++ G+ LA+VG D + +L VW+W+  + +  ++A    I+ + W       L   G   IRFW ++   FT    +G  G   K +      +     G   +GS  G + +W   +++  +        H G    I   +   +T G DG I   D ET      + +++   + P   L     +     ++S         A   +G+I +L      T     IL   H  GE+    V P   + A++  D  L +++              +G         +   G  V  GF DG   +L+ +            +LGEI    A+  H K +I+ +  +   GK L  GS D  V  +S    + L +     +  I H++W
Sbjct:  669 PSQGLQLEWVHGYRGYDC--RNNIFYLQSGEIVFHVAAVGIVMNIASKTQRFYAS-HNDDILCLGLHPLKDLIATGEVGRE--PTIHVWDTQTMKSVSILKGEHERGVCAVDFSSDGKKLASVGLDDNHLLVVWDWRKGEKLASTRAHKDKIFMIKWDPHNNNQLVAVGMKFIRFWTQVGGGFT--TKRGTFGNVAKLDTQLCAAYNPNKPGVCYTGSPSGLVYIWKDNILQSAV------MMHEGGCYAIDALDKGFVTGGKDGTIKLCD-ETFTKVHKSYKLSPENLQPQQML-----SSACPTIRSVVLGKGKILASTSSGEIMELS-----TDGTINILVQGHGEGELWGLAVHPSKNICATVSDDCYLMIWEVEPSNHKLIKLKKLKGPA---RCCDISCDGSAVAVGFKDGSFLVLSLT------------SLGEI----ASSHHRKEEISDIKFSPAPGKYLAVGSHDNFVDIYSAISHQRLSV-CKGCSSYITHLDW 1129          

HSP 2 Score: 67.781 bits (164), Expect = 9.740e-11
Identity = 96/446 (21.52%), Postives = 174/446 (39.01%), Query Frame = 1
Query:  616 PVTAIYEYPSLKLYRILRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWS-ADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAEVAEEMATFEMDPMN--ELLVSNDAKLMHVVKSPE-TESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYLPIGFVKLNKP-IHHVEWKA-TVEGKPDEGIGRIMVYMAEG 1935
            P   I+   SL+   IL+D      S   F+ +G  L +VG DP+  L VW+WK  + +  ++A S  ++   +  +D      T G  HI+FW +       K +G  GK G+ +        +  +    SG+  G++ +W    ++  I        HSG +  I       +T G D  +   D                E  PM   +L ++N      +V+S     +++     G+  I   ++  S  + P  ++    +GE+    V P   + A+   D SLR++    R+ +  ++ +    KI       D  G  +  G  DG   ++            +++ + E+H  Q  K   + +  L     G  L  GS D  V  +    S +   G  K N   I H++W   +   + + G   ++++ A G
Sbjct:   85 PFICIWNSNSLETKSILKDQHTHGISSVAFSKNGMYLLSVGLDPNATLNVWDWKKGKVLSSTRAHSDRVFDARFMVSDGPIKFVTCGIKHIKFWSLCGNTLSSK-KGIYGKKGEIQTILTVCMSISDNAVCYSGTLNGDVYIWRENNLERVIA-----TVHSGALYSIESCASGYVTGGKDSCVVLHD---------------PEFQPMTRIDLKLTNIGYPNLIVRSVHWLSNNVLVGTQGSDII---EIPVSTPNKPKSLMMGHAAGELWALGVHPKKSIFATGSDDCSLRIWQMNEREPLTTLRID---KKIRSCGFNHD--GSLIAIGIMDGSFSVI------------RTRDMIEVHNAQDRK---EVLHELKFSPDGHWLAVGSNDNFVDIYDATAS-FKRTGVCKGNSSFITHLDWSLDSTYIRTNSGAAELLIFKAPG 485          

HSP 3 Score: 63.929 bits (154), Expect = 1.604e-9
Identity = 99/517 (19.15%), Postives = 204/517 (39.46%), Query Frame = 1
Query:  388 VKLAHSF-GYNCQKRDNLALLDQQ--TLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAV--HPT-KMYLAVGEKKSDSPPVTAIYEYPSLKLYRI--LRDGTEKAYSYCQFNTSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKF-----GKTEISDIEGFVVLPDGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPC---HSGTINQIIIEEGELMTLGTDGKINTWDFETIDTAE--VAEEMATFEMDPMNELLVSNDAKLMHVVKS-PETESSIWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSASIGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHDGVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKILITGSEDETVFFFSINPSEYL--------PIGFVKLNKPIH 1857
            +K  H + G++C  R+NL  LD +  ++ Y +       NL     S+      + I C+ V  HP  +  +A G+  +    + +I+ + SL   ++  L+           F+++G LL +VG D D  + VW+W+    + ++   +Q I+   +  D + +    G  H++FW +A    G +L    G+       +  ++ +       +    +G+  G++ VW   ++   + + +  P     +  ++ +I+  G+     T G I  WD E I      +AE++    +   +E     + K M V++S    +  I      N  +  L+           ++     G +    V P     +S   DG++R++D   + L+  +             +   P G  ++ G   G   +L+ +Q  +  I KK +               K+IT +       ++  GS D  V  + ++ +  +        P   V L++P +
Sbjct: 1400 LKHVHGYRGFDC--RNNLHYLDAEGSSIVYHAAAVGIVHNLQSGQQSFFLE-HNDDILCLTVNRHPKYRNVVATGQIGA----IPSIHVWNSLDCTKLSTLKGVHINGICSLDFSSTGTLLLSVGIDNDHTIAVWKWETGTLLAKANGHTQRIFLAEFRPDSDSIFVNVGVKHVKFWTLA----GSELIAKRGRIPSDFVNQPRMTTMLSVAFCTNDTTYTGAMNGSVWVWKSGVLTRIVEKAHSGPVFVLFTTLVDGLIVSGGKEKGKDT-GSIKLWDQEMIRNKPFYLAEDI---NVRGSSETAKPLEDKSMEVIRSISRVKGKILLGTQDNDILEILE----KQGTVKYLMQAHGEGVLCGLAVHPFLPQYSSASEDGTVRIWDLETKMLIQSLTTGPA------TCVDYSPNGNYLVIGLKSGAFVVLS-AQSYRLLIRKKDR--------------GKQITDIKFSPNSSLIAVGSNDNVVDIYKLDSTGGITSPSPCQSPNSVVTLSRPTY 1876          
BLAST of cilia- and flagella-associated protein 44-like vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.944e-14
Identity = 71/285 (24.91%), Postives = 124/285 (43.51%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGE----KKSDSPPVTAIYEYPSLK-LYRILRDGTEKAYSYCQFNTS--GELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLP-DGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEE-GELMT-LGTDGKINTWDFETIDTA 1197
            P   +++   +GY  +  R NL  L    + Y     +   NL++ +  +    + + I CMA+HP K+  A G+     K +  P   I+   +L+ L+ I     E+A +   F+ S  G+LL TV    D  +T+W W   +++  SK+ ++ +    ++     V+ T G  H+ FW +        L   +  F K E       V    +G++++G   GN+  W  E   +          H+G I  ++I E G L++  G D  I  WD  T + A
Sbjct:  290 PDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDD-IKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKN----ALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQ---AHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKA 566          
BLAST of cilia- and flagella-associated protein 44-like vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.127e-13
Identity = 71/285 (24.91%), Postives = 124/285 (43.51%), Query Frame = 1
Query:  376 PSNVVKLAHSFGYNCQK-RDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCMAVHPTKMYLAVGE----KKSDSPPVTAIYEYPSLK-LYRILRDGTEKAYSYCQFNTS--GELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGVLTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLP-DGKVLSGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEE-GELMT-LGTDGKINTWDFETIDTA 1197
            P   +++   +GY  +  R NL  L    + Y     +   NL++ +  +    + + I CMA+HP K+  A G+     K +  P   I+   +L+ L+ I     E+A +   F+ S  G+LL TV    D  +T+W W   +++  SK+ ++ +    ++     V+ T G  H+ FW +        L   +  F K E       V    +G++++G   GN+  W  E   +          H+G I  ++I E G L++  G D  I  WD  T + A
Sbjct:  147 PDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDD-IKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKN----ALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQ---AHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKA 423          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP448.139e-3338.97cilia and flagella associated protein 44 [Source:H... [more]
CFAP440.000e+044.00cilia and flagella associated protein 44 [Source:H... [more]
EML61.500e-2223.27EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412][more]
EML62.424e-2223.27EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412][more]
EML62.424e-2223.27EMAP like 6 [Source:HGNC Symbol;Acc:HGNC:35412][more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
elp-13.943e-1321.85Echinoderm microtubule-associated protein-like elp... [more]
elp-13.943e-1321.85Echinoderm microtubule-associated protein-like elp... [more]
elp-14.321e-1321.85Echinoderm microtubule-associated protein-like elp... [more]
elp-14.321e-1321.85Echinoderm microtubule-associated protein-like elp... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG341241.610e-9834.04gene:FBgn0083960 transcript:FBtr0110838[more]
DCX-EMAP1.134e-724.30gene:FBgn0259099 transcript:FBtr0330139[more]
DCX-EMAP1.234e-724.30gene:FBgn0259099 transcript:FBtr0299509[more]
DCX-EMAP1.311e-724.55gene:FBgn0259099 transcript:FBtr0331181[more]
DCX-EMAP1.405e-724.30gene:FBgn0259099 transcript:FBtr0299510[more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML62.215e-2124.50EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
EML62.478e-2124.50EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
EML62.851e-2124.50EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
EML63.128e-2124.50EMAP like 6 [Source:NCBI gene;Acc:100000931][more]
EML55.759e-2022.74si:dkey-1f12.3 [Source:ZFIN;Acc:ZDB-GENE-030131-16... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML65.740e-2222.83echinoderm microtubule associated protein like 6 [... [more]
EML66.241e-2222.83echinoderm microtubule associated protein like 6 [... [more]
EML63.487e-2123.03echinoderm microtubule associated protein like 6 [... [more]
EML54.219e-1822.30echinoderm microtubule associated protein like 5 [... [more]
EML54.368e-1822.30echinoderm microtubule associated protein like 5 [... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap441.243e-2738.20cilia and flagella associated protein 44 [Source:M... [more]
Cfap441.243e-2738.20cilia and flagella associated protein 44 [Source:M... [more]
Eml65.645e-2223.06echinoderm microtubule associated protein like 6 [... [more]
Eml56.521e-1922.12echinoderm microtubule associated protein like 5 [... [more]
Eml51.888e-1822.77echinoderm microtubule associated protein like 5 [... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E9Q5M6|CFA44_MOUSE8.693e-2738.20Cilia- and flagella-associated protein 44 OS=Mus m... [more]
sp|Q96MT7|CFA44_HUMAN3.909e-3238.97Cilia- and flagella-associated protein 44 OS=Homo ... [more]
sp|A8J1V4|CFA44_CHLRE2.299e-9733.84Cilia- and flagella-associated protein 44 OS=Chlam... [more]
sp|Q57WH1|CFA44_TRYB24.654e-7330.60Cilia- and flagella-associated protein 44 OS=Trypa... [more]
sp|Q6ZMW3|EMAL6_HUMAN1.164e-2123.27Echinoderm microtubule-associated protein-like 6 O... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J1G70.000e+047.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EFC80.000e+047.41Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8JLC00.000e+046.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8H0910.000e+037.97WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A0X3P4B73.653e-4342.28WD_REPEATS_REGION domain-containing protein OS=Sch... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015124.25.946e-3036.00pep primary_assembly:Astyanax_mexicanus-2.0:3:2230... [more]
EML66.631e-2222.78EMAP like 6 [Source:NCBI gene;Acc:103028254][more]
ENSAMXT00000009461.21.095e-2123.35pep primary_assembly:Astyanax_mexicanus-2.0:21:199... [more]
si:dkey-1f12.31.741e-2123.00EMAP like 5 [Source:HGNC Symbol;Acc:HGNC:18197][more]
eml14.001e-1623.79EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001632.11.098e-1526.33pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-... [more]
ENSPMAT00000009420.17.121e-1318.58pep scaffold:Pmarinus_7.0:GL476782:177851:212676:1... [more]
wdr902.171e-1020.57WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-0704... [more]
wdr902.279e-920.21WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-0704... [more]
ENSPMAT00000006636.11.226e-720.97pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO323111.331e-2843.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484871.851e-1822.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427833.257e-1329.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360685.620e-1220.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498771.770e-1124.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018745.21.430e-13041.09cilia and flagella associated protein 44 [Source:N... [more]
si:dkey-1f12.34.500e-2023.06EMAP like 5 [Source:NCBI gene;Acc:101166098][more]
si:dkey-1f12.35.230e-2023.06EMAP like 5 [Source:NCBI gene;Acc:101166098][more]
si:dkey-1f12.35.314e-2023.06EMAP like 5 [Source:NCBI gene;Acc:101166098][more]
EML61.870e-1921.93echinoderm microtubule-associated protein-like 6 [... [more]
back to top
BLAST of cilia- and flagella-associated protein 44-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022927.10.000e+098.34SMESG000022927.1[more]
SMESG000022927.10.000e+098.02SMESG000022927.1[more]
SMESG000027261.12.199e-1822.38SMESG000027261.1[more]
SMESG000021391.14.944e-1424.91SMESG000021391.1[more]
SMESG000021391.11.127e-1324.91SMESG000021391.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001116 ID=SMED30001116|Name=cilia- and flagella-associated protein 44-like|organism=Schmidtea mediterranea sexual|type=transcript|length=5778bp
CTCAGCAACCAAAGAGCGGTTAATATTTATTGAAATAAAATTAGTTAAAA
TACTAATATATTAAAATTATAATTAAAATAATTTTAAAAATTTATTTCAC
ATTTTGAAATGGCCGATGATGAAAAAGAGATTAATAATGATATGAACGAT
GAAGCGAATACAATTGACGGAGGTTCTGTTAATGAAGTTTTTACAGAAGA
AACCAGAGAAGATTCGAAAATGGATTCTGTTCAGCCAACACAAGATGAAC
CACCAGTTGAGGAAGAAATAAATCATAAACGTCAAAAAGAAGAAAAAGTC
GTCATTCCAGAGGATTTTTACTATGATTACGAGGAATTTATTTCTAAACC
TTTTATTTCAGAAGAATCTGGTCTACCTTCTAACGTTGTTAAATTAGCTC
ATTCTTTTGGATATAACTGTCAAAAACGAGACAACCTTGCATTATTAGAC
CAACAAACTCTTTGCTATATTTCTGGAAATTATATTGAATTCATGAATTT
ATCTGATTTTTCTCATTCGTATTTGAGATCTTTGTCAGGTGAAGGGATTG
GATGCATGGCTGTCCACCCAACTAAAATGTACTTGGCAGTCGGAGAAAAG
AAATCTGATTCTCCACCGGTAACAGCAATTTATGAATATCCATCTCTAAA
ACTGTATCGCATTCTTCGTGATGGAACAGAGAAAGCTTATTCATATTGCC
AATTCAATACTTCGGGAGAATTGCTTGCTACAGTTGGCTCTGATCCTGAC
TTCATGCTAACGGTATGGGAATGGAAAAACGAACAAACTGTTTTAAGAAG
CAAAGCTTTTTCTCAAGACATTTATAGAGTTGCTTGGTCTGCAGACTTGG
AAGGTGTCCTTACAACGGCAGGTACTGGACACATTCGGTTTTGGAAAATG
GCTGATACTTTTACTGGACTAAAATTACAAGGGGATATTGGCAAATTTGG
CAAAACGGAAATTTCAGACATTGAAGGTTTTGTTGTATTACCAGATGGCA
AAGTATTGAGTGGTAGTGAATGGGGTAATATGCTTGTCTGGGATGGTGAA
CTTATCAAGGTTCAAATTGGAAGAAAAAATAAAAAACCATGCCATAGTGG
AACTATAAATCAGATTATTATTGAAGAAGGTGAATTAATGACCTTGGGAA
CTGATGGGAAAATAAATACTTGGGACTTTGAAACTATCGATACAGCTGAA
GTTGCTGAAGAAATGGCTACATTTGAAATGGACCCAATGAATGAGTTGCT
GGTTTCAAATGATGCCAAATTAATGCACGTTGTAAAAAGTCCGGAGACTG
AATCGTCAATATGGTACGCCCAGGATGGAAATGGAAAAATTTGGAAATTG
GACTTGTCTTTTTCACACACTTCCGCACCTCCTGAGATATTGAATACGTT
TCATTCTGGAGAAATTCGAGATTGCGACGTATCACCTCTTTCATATCTGT
CAGCTTCAATCGGATCAGATGGCTCTTTGAGAGTTTTCGATTTTGCTGCT
CGCAAACTAATGGCGGAAATGAAATTCAACTTTGAAGGATCAAAAATATT
ATGGGCCCCCCTTAAAGTCGATCCAAAAGGGAAAACTGTAATTGCAGGAT
TTCACGATGGGGTTATACGAATACTAAATTTTTCCCAAGTATTACAGACA
GATATTAGTAAAAAATCTAAAACTCTCGGTGAGATACATTTGATTCAAGC
TACCAAACCTCACACGAAAAAGATAACATCTCTTTCTACTGATGATAAAG
GAAAAATTTTGATCACGGGGAGTGAAGATGAAACTGTGTTTTTCTTTTCT
ATTAATCCTTCAGAATATTTACCCATCGGTTTCGTAAAATTAAATAAACC
AATTCATCATGTTGAATGGAAAGCTACAGTTGAAGGAAAACCAGATGAAG
GTATCGGCCGAATCATGGTGTATATGGCCGAAGGAGAAGTTGCTGAAGTC
ATTTGTCCTAATCCATCATCAGTTGATCACAGCAAAACATACGAATTGCG
AGAAATTGAACCAATTAATTCATACAAATTTGTCAGTATTAAATCGGTTC
TTAGACATGAAGAAGAGCTAGAAAAAAAACGAATTGAAGAAGAAGAAAGA
CAAAAAATATTAGCAAAGGAAAGAAAAGAACGTCTGGAAAGGGGAGTAGA
GACAGAAGAAGAGCAATATAAACAAATTGAAGAAGATGAAAAACGTAGAG
CTGAAGAAGCCGCCAAAGAAGAAGAATGGCTTCCTTTTATTCCAGAAACT
GTTTCTCCGATTTTATACGGGTTTATTGATAAAACAGATTCCGATAAATT
TTGGCTTTCAATGGGAGAATATGACGCAGGCTACTTATATCAATGCGAAT
TTCCAAGTCCCGATAAAAAGAATTTACTAAAAATTCCTGAAAAATATAAC
GAACCTATAAATCATCCGGGTTTACTAAATTCTAATGATGTTCCGGTTAC
CTCTATGAAATGGAGCTCATCTGGTAAAAGAGTGATAATGGGCTGTGAAA
ATGGAAGTATTCGTTTGCAGAATCTCGAGAAGCCTTTCGACCTTAGAACT
ATGACTTCGTGTTGGCAATATTCAGTGCACGACAATAACTATGGGTCTAT
CACATCATTGTGTGTCAGTTATGATGAAAAATTCTTAGTTTCTGTGGGAA
ATGATGGAAATTTCTTTGTGTATGAAATAATGGACGAAAACCTTCAAGAA
AAACAGATAGAAGAGTATCGCGCACGATTACCGTCAGCAAAAACGGTCGA
TTCAAAGCGACAAATAGACGATATTGAAGATCCAAATGCATACAGTATTG
AAGAACACAAACAAAAATCCGAATACGACAGAAAAGTTCGATTAGCTCAA
GAGAAAAAAGCTTCCACACTCAAGAAAATCGGTGAACTACAAAAACAATT
TAAAAATCTCAAAGATCAAAATGATAAACTACCTAAACGTATTCAAATCT
CAGCAAATTCATTTGAGCTTATTCCAAAACTCAGAGAAGATTTAATAAGA
ATTAAAGAAGAAAAGATTCAAGTGGTTCATAAACAAATGGCCTTTGATTC
AGAGAAGCATAGCATAGCGTTGGATAAATTAGAGAAACGATTCCGTGAGC
CTCTGGAGTGTGATTTAATAGTAATCCACGCTATAGAAAGTGAACACACA
GTATCAACTATAAAAGGTTGCAATCTATCGGACGAATATTTCCAAATTCT
TTCCGATTTGGAGCGCATTAGACAGGATATGTCGAATAAGGATTATAGTA
AAGAAACTACAGTAACCGATAAAGCTCCGTCTACTTTCGGTGTACAAAAT
GTATTTGATGAAGTTGATGAACCCGGTAAAATTGAAGATAGTTTTGCCAA
ATATAATTTGAAAGGTGCTCGAGGAATGAGAGTAGCAAGACAGCTGAAGA
AACTTGATGATAATAGAAGAAAACGTTCATTTAGAAAACTTCAGTGGGAT
AATCTTTACGCTGAAAAACCAATGGAGAACTTTGAAGATCCAAGAGACAT
TGCGGCAATCGAAGAAGCTAGAAATAAAATGGGAGATTTTAAATTAAAAA
GTTCAGCTGATTATTTCGTCGAAGAAAAAGAGCGACCAAATGCATTAAAA
GCTCGTCAAGAATTAATTGCTATCGAAAATAAAATCTTTCGAATTAGGTC
AGAATTCAATGGGAAAATTTTAAAGTTACGAAATGAGAAACATGAAATTA
TAGAAACAATAAAGAAAACCAACAAGCAAATTGAATTATGCAACAATGTT
GACAAAGACAGAAAACGCCCTATGTTACCGAATATTACAATATATCCTGA
TGAAAATCCGGAAAAAAAATTTGAATATACGAAAGAAACATTAATTGAGT
TTAAGAAAGAGCTGGAAGAAAGAAAGAAAGCTGCTCTTCAAGGAGAAGAA
AATTCAAAAACGGTTTTTGCTACTTTCAATAAACAAAGCAATGTTGAATC
GGGATTAAAACCGACAAAAATATTTCGACCTCACATATCCCAACAAGTGA
CTCTCGCCGAAGATCCTACATTGGTATTAGATGAAGATTTGACACCTGCC
ACGGTGTCCTCAGATCTCCAAAGAGAGCGACAACTTATCAGCGACATGAA
AACCATTTATTTAACTGAAACGATGATTAATGAAACGTTAAAACAAATGA
GAATATTTGACACGAAGCTAAAATTGCTTCGACACGAAAAATATGCAACC
GGACTGACACTTCGACGTGCAGTTCTGCGCCAATTGACGGTATTTGAAGA
ATACCGATTATTAAAAATGTATGAAAAATCAGAAAAAAGTCTCATTGAAA
AAACAGAAGAGAAAACTGCTGAGAAACTTGATATTGTTAACAAGGTGGCT
GAACTTCAATTGAAGTTAGACAGTAAAAAAAAAGATATTGATCGCTTGAT
TGAACGTGATCGGATCAATTGGGAAAAATTCAAAGAAAGTTTGGGAGAAA
ATAATAAATTTGCTGAATATTTAAATAAAGTGTATAAGAAAAAAATCAAG
CGCAGGAAAAAGGAAGCTGAAGGAGTGAACAAATCATCGAAAGGAAATGA
AACAAGAAAAAATATAACTTTTTACAAAGGAGAAGACTCTGATGAATCAT
CTGAATCTGATGATTCTGATTTGGACGATGAAGAAGGAGAAAGTGACGAG
GAAACCGTAGTTTATGATCTTGACATGTGTCCACCAGGATGCAGTCAAGA
ACTTTATGATTCAACATGTCAACTGAGAGAACTTCATCTAGACATAGAAG
AAGAAATGTTTGAAGAGAAAAAAGTTTTTGAAGCACTCAAGAAGGAGCAA
GAAAATCTCAATAAAAAAACCAAAGTTGTAGAAGCCGCTCTTCTTCAGGC
TAAAAAAGAATTAGAGGCTTTTCAACTAGAGAAACAACAAAAGTTAAATC
AGTTAAAAACCATCGTCATTTTGAAATTGCATCAAATTCTTCTCCATGAA
AATGGAGTCCTACCATCGGATATCGATGCTGCTTTGATATTTGAAGCATC
AAATTATAAAGATCTCAAATTACGAATAGAAAAACTACAAGATGAAGAAA
GAAAACAACTCAATCATGGAAAACAGGTCAAATTGAGGCATGTCAAACTC
CAACAAAACAGAAAACTATTTCAAAGGAAAATATCAGAATTCCAATTGGA
ATGCGATGAGATGATGAAAACTAAATTCGGAAAACTCGACAATTTAGAGA
AAATTGAGCAGGTTATGATTAATCCTAAAATCGAGGAATTATTCTTCAAG
ATGCTCGATTTGCAAGACGGAATGTATTGCGAACAATCGGAATGGGAGGA
TCGAATACGTGATGCCCAAGAGAAATGCATAGAGGAAATTAAATTTAACA
CATGCACATTGGATCACATACTAAATTTGTTCAACGAAAAGGAAATATTG
GAAGATAAATTAAATTCGAAACAAAAAGATCTGGGGGGTGAATTCCAATT
GACTGGACCTGCTGCAGAGGAAGAAATTTCCAAATTAAATCAATTAGTGC
ATATCCAAGCTCAAGAACTTGACGCATTGAAGGAAGAAATCGGAATGCTG
TCCAGAAAAGGTGGACATATTCTACCGCCGATGAATCAAAATAATTTTAG
TAACCAAGGCACAATCCAGCAATTAGATTTCAATCACATTAGACACTCAA
GTCTAGGACAAGATGCTTTTCAAGATAAACTAGCTGCGCTCGAAGAAGTG
ACTCAATGATAATTTTAATGGAATGTATTGTAAATTACTCAGCCGCAGTT
TTTGTGATTTATCATAAATAAATAAGAG
back to top

protein sequence of SMED30001116-orf-1

>SMED30001116-orf-1 ID=SMED30001116-orf-1|Name=SMED30001116-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1867bp
MADDEKEINNDMNDEANTIDGGSVNEVFTEETREDSKMDSVQPTQDEPPV
EEEINHKRQKEEKVVIPEDFYYDYEEFISKPFISEESGLPSNVVKLAHSF
GYNCQKRDNLALLDQQTLCYISGNYIEFMNLSDFSHSYLRSLSGEGIGCM
AVHPTKMYLAVGEKKSDSPPVTAIYEYPSLKLYRILRDGTEKAYSYCQFN
TSGELLATVGSDPDFMLTVWEWKNEQTVLRSKAFSQDIYRVAWSADLEGV
LTTAGTGHIRFWKMADTFTGLKLQGDIGKFGKTEISDIEGFVVLPDGKVL
SGSEWGNMLVWDGELIKVQIGRKNKKPCHSGTINQIIIEEGELMTLGTDG
KINTWDFETIDTAEVAEEMATFEMDPMNELLVSNDAKLMHVVKSPETESS
IWYAQDGNGKIWKLDLSFSHTSAPPEILNTFHSGEIRDCDVSPLSYLSAS
IGSDGSLRVFDFAARKLMAEMKFNFEGSKILWAPLKVDPKGKTVIAGFHD
GVIRILNFSQVLQTDISKKSKTLGEIHLIQATKPHTKKITSLSTDDKGKI
LITGSEDETVFFFSINPSEYLPIGFVKLNKPIHHVEWKATVEGKPDEGIG
RIMVYMAEGEVAEVICPNPSSVDHSKTYELREIEPINSYKFVSIKSVLRH
EEELEKKRIEEEERQKILAKERKERLERGVETEEEQYKQIEEDEKRRAEE
AAKEEEWLPFIPETVSPILYGFIDKTDSDKFWLSMGEYDAGYLYQCEFPS
PDKKNLLKIPEKYNEPINHPGLLNSNDVPVTSMKWSSSGKRVIMGCENGS
IRLQNLEKPFDLRTMTSCWQYSVHDNNYGSITSLCVSYDEKFLVSVGNDG
NFFVYEIMDENLQEKQIEEYRARLPSAKTVDSKRQIDDIEDPNAYSIEEH
KQKSEYDRKVRLAQEKKASTLKKIGELQKQFKNLKDQNDKLPKRIQISAN
SFELIPKLREDLIRIKEEKIQVVHKQMAFDSEKHSIALDKLEKRFREPLE
CDLIVIHAIESEHTVSTIKGCNLSDEYFQILSDLERIRQDMSNKDYSKET
TVTDKAPSTFGVQNVFDEVDEPGKIEDSFAKYNLKGARGMRVARQLKKLD
DNRRKRSFRKLQWDNLYAEKPMENFEDPRDIAAIEEARNKMGDFKLKSSA
DYFVEEKERPNALKARQELIAIENKIFRIRSEFNGKILKLRNEKHEIIET
IKKTNKQIELCNNVDKDRKRPMLPNITIYPDENPEKKFEYTKETLIEFKK
ELEERKKAALQGEENSKTVFATFNKQSNVESGLKPTKIFRPHISQQVTLA
EDPTLVLDEDLTPATVSSDLQRERQLISDMKTIYLTETMINETLKQMRIF
DTKLKLLRHEKYATGLTLRRAVLRQLTVFEEYRLLKMYEKSEKSLIEKTE
EKTAEKLDIVNKVAELQLKLDSKKKDIDRLIERDRINWEKFKESLGENNK
FAEYLNKVYKKKIKRRKKEAEGVNKSSKGNETRKNITFYKGEDSDESSES
DDSDLDDEEGESDEETVVYDLDMCPPGCSQELYDSTCQLRELHLDIEEEM
FEEKKVFEALKKEQENLNKKTKVVEAALLQAKKELEAFQLEKQQKLNQLK
TIVILKLHQILLHENGVLPSDIDAALIFEASNYKDLKLRIEKLQDEERKQ
LNHGKQVKLRHVKLQQNRKLFQRKISEFQLECDEMMKTKFGKLDNLEKIE
QVMINPKIEELFFKMLDLQDGMYCEQSEWEDRIRDAQEKCIEEIKFNTCT
LDHILNLFNEKEILEDKLNSKQKDLGGEFQLTGPAAEEEISKLNQLVHIQ
AQELDALKEEIGMLSRKGGHILPPMNQNNFSNQGTIQQLDFNHIRHSSLG
QDAFQDKLAALEEVTQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0060285cilium-dependent cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 453..473
NoneNo IPR availableCOILSCoilCoilcoord: 679..699
NoneNo IPR availableCOILSCoilCoilcoord: 892..919
NoneNo IPR availableCOILSCoilCoilcoord: 176..210
NoneNo IPR availableCOILSCoilCoilcoord: 823..864
NoneNo IPR availableCOILSCoilCoilcoord: 1020..1040
NoneNo IPR availableCOILSCoilCoilcoord: 1056..1076
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 761..780
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 736..780
NoneNo IPR availablePANTHERPTHR14885UNCHARACTERIZEDcoord: 94..1095
NoneNo IPR availablePANTHERPTHR14885:SF2CILIA AND FLAGELLA ASSOCIATED PROTEIN 44coord: 94..1095
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 32..71
e-value: 2.1
score: 15.0
coord: 80..122
e-value: 0.024
score: 23.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 17..205
e-value: 1.6E-11
score: 46.2
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 39..131
score: 9.046
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 12..125