SMED30001103

Overview
NameSMED30001103
Smed IDSMED30001103
Length (bp)1081
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30001103 (SMED30001103) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30001103 (SMED30001103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30001103 (SMED30001103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30001103 (SMED30001103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001103SMESG000008712.1 SmedASXL_015761SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30001103SMESG000008712.1 dd_Smed_v4_13053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001103SMESG000008712.1 dd_Smed_v4_13053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001103SMESG000008712.1 dd_Smed_v4_13053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001103SMESG000008712.1 dd_Smed_v6_13053_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30001103 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003079:24433..28740 +5364
Homology
BLAST of SMED30001103 vs. TrEMBL
Match: A0A2B4SZR9 (Major facilitator superfamily domain-containing protein 6 OS=Stylophora pistillata OX=50429 GN=MFSD6 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.794e-9
Identity = 56/186 (30.11%), Postives = 96/186 (51.61%), Query Frame = 2
Query:  155 FRSLKFVCSNVELTIFFLFV-ILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIY 709
            F+++  + S+  +  F L + I+G S  T+      L  + +       L GL +    +SE+ V+  SGK+ +   +  ++  TFV +  R++LYSF+   W  L +E +HG TFG  ++A  +Y G  +    +  +  L  +  F +G  + G  GG I D+YG   LFRS++V S I GL++
Sbjct:  263 FQNVCIILSDCCIVTFLLAILIMGASFSTIGT---FLFWFIQDMNGSHLLMGLTLCMTCVSEVPVMFFSGKLIDRIGHHGVLYLTFVCYTIRYVLYSFIHNAWYILAVEPLHGVTFGAMWAATTSYGGLISPEGMRATVMSLVMATHFGLGKLIAGFGGGAIYDSYGPRILFRSLAVTSAITGLLF 445          
BLAST of SMED30001103 vs. TrEMBL
Match: A0A2N2PKT8 (MFS domain-containing protein OS=Chloroflexi bacterium HGW-Chloroflexi-10 OX=2013724 GN=CVU39_00450 PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.587e-9
Identity = 53/166 (31.93%), Postives = 92/166 (55.42%), Query Frame = 2
Query:  197 IFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLI 694
            +FFL V   G +V + +    L I+ +   A KF  GL ++   +SE+ +L  S ++   +  + L+ A  +F   R L YSF+   W  L+++L+HG TF L + A V+Y+ K   +  +   QGLFS +   +G  +G  +GG + ++ G+ G+FR  S+++LI
Sbjct:  201 LFFLTVSFCGGMV-LSMSGNFLFIFLQDLGADKFTLGLSLTIATLSELPILFFSSRLLLRWNAQQLMGAALLFVVIRTLAYSFVVDPWLVLLIQLLHGPTFALMWVAGVSYVNKIAPTGLEATAQGLFSGVMLGVGSAIGAFLGGFLYEHIGIVGMFRVASLVALI 365          
BLAST of SMED30001103 vs. TrEMBL
Match: A0A1I8FYA3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g1 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.417e-8
Identity = 39/147 (26.53%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  155 FRSLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFF 595
             ++L  +C +  + IF++ V+L G+   +  E ++ V+ R     P +  G++ +  ++ E  +  +SG + +           F+ +  R+LL S +   W  L +  +HG +FGL F AM+ +  K +    QG +QGL S L+F
Sbjct:  315 LKALPLMCLSWRIGIFYILVLLSGAAFGI-FESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQSPEGWQGTVQGLVSGLYF 460          
BLAST of SMED30001103 vs. TrEMBL
Match: A0A1I8JJH3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g2 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.692e-8
Identity = 39/148 (26.35%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  155 FRSLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFN 598
             ++L  +C +  + IF++ V+L G+   +  E ++ V+ R     P +  G++ +  ++ E  +  +SG + +           F+ +  R+LL S +   W  L +  +HG +FGL F AM+ +  K +    QG +QGL S L+F 
Sbjct:  315 LKALPLMCLSWRIGIFYILVLLSGAAFGI-FESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQSPEGWQGTVQGLVSGLYFG 461          
BLAST of SMED30001103 vs. TrEMBL
Match: A0A3M6UMJ8 (MFS domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00011161 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.192e-8
Identity = 49/152 (32.24%), Postives = 78/152 (51.32%), Query Frame = 2
Query:  284 TAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPR 739
                 L GL +    +SE+ ++  SGK+     +  ++  TFV +  R++LYSFL   W  L +E +HG TFG  ++A  +Y G  +    +  + GL  +  F +G  + G  GG +  +YG   LFRS++V S I  L+ + L   LI R
Sbjct:  339 NGSHLLMGLTLCMTCVSEVPIMFFSGKLIKCIGHHGVLYLTFVCYTIRYVLYSFLHNAWYVLAVEPLHGVTFGAMWAATTSYGGLISPEGMRATVMGLVMATHFGLGKLIAGFGGGAMYSSYGPRILFRSLAVTSAITCLL-FALSQRLIKR 489          
BLAST of SMED30001103 vs. Ensembl Nematostella
Match: EDO38796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW5])

HSP 1 Score: 51.6026 bits (122), Expect = 2.332e-7
Identity = 47/163 (28.83%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  287 APKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKN 775
            A + L GL+   M  +E+ V   +G M     +  ++         R L+Y FL+  W  L++E ++G TF   ++  V+Y      +  Q  +QG+ SS+++N+GG  G L+GG++   YG     RSM   +  L  +  PL + L    C  S+ ++I N
Sbjct:  295 ASQTLLGLVTVVMCSAEMLVFSCTGTMIGRLGHVGVIILALACTIIRLLIYPFLENPWYVLLVEPMNGITFAAMWATCVSYASILAPNEVQSTMQGVVSSVYYNLGGGTGSLLGGMVYKAYGP----RSMFWATAGLCGVGMPLAIALY---CINSVKEKISN 450          
BLAST of SMED30001103 vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 401.364 bits (1030), Expect = 1.178e-136
Identity = 229/229 (100.00%), Postives = 229/229 (100.00%), Query Frame = 2
Query:  161 SLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNXXXXXXXXXXXXKNVESSLINNDR 847
            SLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR
Sbjct:  341 SLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR 569          
BLAST of SMED30001103 vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 338.191 bits (866), Expect = 2.912e-117
Identity = 197/197 (100.00%), Postives = 197/197 (100.00%), Query Frame = 2
Query:  257 MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNXXXXXXXXXXXXKNVESSLINNDR 847
            MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR
Sbjct:    1 MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR 197          
BLAST of SMED30001103 vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 317.775 bits (813), Expect = 2.103e-104
Identity = 196/229 (85.59%), Postives = 197/229 (86.03%), Query Frame = 2
Query:  161 SLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNXXXXXXXXXXXXKNVESSLINNDR 847
            SLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYF+                                LIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR
Sbjct:  341 SLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFK--------------------------------LIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR 537          
BLAST of SMED30001103 vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 292.352 bits (747), Expect = 1.626e-99
Identity = 174/174 (100.00%), Postives = 174/174 (100.00%), Query Frame = 2
Query:  326 MISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNXXXXXXXXXXXXKNVESSLINNDR 847
            MISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR
Sbjct:    1 MISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR 174          
BLAST of SMED30001103 vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 256.529 bits (654), Expect = 1.348e-85
Identity = 164/197 (83.25%), Postives = 165/197 (83.76%), Query Frame = 2
Query:  257 MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNXXXXXXXXXXXXXXDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNXXXXXXXXXXXXKNVESSLINNDR 847
            MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYF+                                LIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR
Sbjct:    1 MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFK--------------------------------LIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR 165          
The following BLAST results are available for this feature:
BLAST of SMED30001103 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SZR91.794e-930.11Major facilitator superfamily domain-containing pr... [more]
A0A2N2PKT82.587e-931.93MFS domain-containing protein OS=Chloroflexi bacte... [more]
A0A1I8FYA32.417e-826.53MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8JJH32.692e-826.35MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A3M6UMJ83.192e-832.24MFS domain-containing protein OS=Pocillopora damic... [more]
back to top
BLAST of SMED30001103 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO387962.332e-728.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30001103 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30001103 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008712.11.178e-136100.00SMESG000008712.1[more]
SMESG000008712.12.912e-117100.00SMESG000008712.1[more]
SMESG000008712.12.103e-10485.59SMESG000008712.1[more]
SMESG000008712.11.626e-99100.00SMESG000008712.1[more]
SMESG000008712.11.348e-8583.25SMESG000008712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001103 ID=SMED30001103|Name=SMED30001103|organism=Schmidtea mediterranea sexual|type=transcript|length=1081bp
CTAATATTTGGTAAATGAGTTAGAAAGATCACATATACTACTTATGTAAT
ATAGTTAAATTATATTAAAATTTAATTTTAAATATAGTTAAATATTTTAT
TTATAATATTTAATAATTTTAATTTATATTTTGAAGAAAAACTCTGTTTT
TAATTTCAGGTCATTGAAATTTGTATGCAGTAATGTGGAATTGACAATAT
TTTTCCTATTCGTTATTTTAGGGGGATCAGTAGTGACGGTTCATATAGAA
TATTATATGCTTGTCATATACAGAAAATTTCCTACTGCTCCTAAATTTCT
TCCTGGACTCCTAATATCTTTTATGATGATTTCTGAAATAACTGTTCTTG
GCGTATCGGGGAAAATGTTTAATTATTTCAGATATGAAATACTTGTCTCA
GCTACCTTCGTTTTTTGGTTTTTTCGCTGGCTTTTGTATTCTTTTCTCGA
TAAATATTGGCAATTTCTTATTTTAGAACTCATTCATGGAACCACTTTTG
GCTTACAGTTCTCCGCAATGGTGACATATATTGGCAAAACGACCAGTTCT
TCGGCACAGGGTCGAATCCAAGGATTATTTTCCAGTTTATTTTTCAACAT
TGGGGGTTGTTTGGGTGGACTTGTTGGAGGTATCATTTTGGATAATTATG
GTATGAATGGTTTATTTAGGTCAATGTCTGTGATATCATTGATATTGGGG
CTAATCTATTATCCACTACAAGTATGGTTAATCCCTCGTTGTTGTAAGAC
ATCGTTAAACAAACGAATAAAGAACGAAGAGGGTATACTAATATCCGAAG
AGCTAGAAATTAAGAATGTCGAATCAAGTCTCATTAACAATGATCGTTAA
ATCTAAATGAAAGTTTATCATGTGCTACACCAGTGATTGCTTTTTTTGAT
GAATATTTTGTACTTTGATTTTAGTTTTGTGTGAATTTTTGGTTTTTTTA
ATTGTTTTATTCTCTATCATGAAAATAACAGTTATCTGATTTGGTAGTTA
TATGTGATTTAGTGTCTAGAACAAAATTTCTTATTACATTTTTATTTTTC
ATTGATACGATCCAAAATTTGTCCAAAATAT
back to top

protein sequence of SMED30001103-orf-1

>SMED30001103-orf-1 ID=SMED30001103-orf-1|Name=SMED30001103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSAT
FVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSA
QGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLI
YYPLQVWLIPRCCKTSLNKRIKNEEGILISEELEIKNVESSLINNDR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR024989MFS_assoc_dom
IPR020846MFS_dom
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024989Major facilitator superfamily associated domainPFAMPF12832MFS_1_likecoord: 5..138
e-value: 3.1E-24
score: 85.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 2..171
e-value: 2.2E-31
score: 110.8
NoneNo IPR availablePANTHERPTHR16172UNCHARACTERIZEDcoord: 9..163
NoneNo IPR availableCDDcd17335MFS_MFSD6coord: 11..161
e-value: 3.62907E-18
score: 79.1649
NoneNo IPR availableTMHMMTMhelixcoord: 71..93
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 1..197
score: 11.569
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 14..158