NudC nuclear distribution protein

Overview
NameNudC nuclear distribution protein
Smed IDSMED30001081
Length (bp)1098
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NudC nuclear distribution protein (SMED30001081) t-SNE clustered cells

Violin plots show distribution of expression levels for NudC nuclear distribution protein (SMED30001081) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NudC nuclear distribution protein (SMED30001081) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NudC nuclear distribution protein (SMED30001081) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001081

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30001081SMESG000036795.1 DN303982.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30001081SMESG000036795.1 DN303982.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30001081SMESG000036795.1 DN303982.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30001081SMESG000036795.1 DN303982.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30001081SMESG000036795.1 SmedASXL_010760SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30001081SMESG000036795.1 dd_Smed_v4_1596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001081SMESG000036795.1 dd_Smed_v4_1596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30001081SMESG000036795.1 Contig5543GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NudC nuclear distribution protein vs. Ensembl Human
Match: NUDC (nuclear distribution C, dynein complex regulator [Source:HGNC Symbol;Acc:HGNC:8045])

HSP 1 Score: 315.464 bits (807), Expect = 8.185e-106
Identity = 172/325 (52.92%), Postives = 240/325 (73.85%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQK--QSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEID----AEKH----KDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G  +  A K++T  F  H +  Q   +  + ++E E ++K ++  + ++  K + + P++ ELT+EEAE++Q EID    AE H    K+  +D   +   EED +ED KDKGKLKPN GNGADLP  +W Q+L ++D+ +P  VNF +K +D++V+IQ++++ V LKG   +++G LYN++KVEES+W IEDGKV+ + LEK+N+MEWW+R+    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQ++L+KFM QHPEMDFSK KFN
Sbjct:    8 ERFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN 331          
BLAST of NudC nuclear distribution protein vs. Ensembl Human
Match: NUDCD3 (NudC domain containing 3 [Source:HGNC Symbol;Acc:HGNC:22208])

HSP 1 Score: 85.5001 bits (210), Expect = 5.956e-18
Identity = 49/158 (31.01%), Postives = 88/158 (55.70%), Query Frame = 1
Query:  472 PNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSL---KGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            P+  NGA      W Q   D+++R+P   +  VK + V V +    I V++    G + L+EG L + I  E S W++E GK + ++L KV +  WWN + + +  I+  K+N E S ++ +D E +++++++ +D  QK  G P S + K  ++L+K
Sbjct:  179 PDSYNGAVRENYTWSQDYTDLEVRVPVPKHV-VKGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLSKVGEY-WWNAILEGEEPIDIDKINKERS-MATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKK 333          
BLAST of NudC nuclear distribution protein vs. Ensembl Human
Match: NUDC (nuclear distribution C, dynein complex regulator [Source:HGNC Symbol;Acc:HGNC:8045])

HSP 1 Score: 75.8702 bits (185), Expect = 1.356e-15
Identity = 63/155 (40.65%), Postives = 92/155 (59.35%), Query Frame = 1
Query:  103 LLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEID----AEKH----KDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVD 537
            L+N FF FL R+TDFF G  +  A K++T  F  H + +     +++  +E + + K  +     K  K + + P++ ELT+EEAE++Q EID    AE H    K+  +D   +   EED +ED KDKGKLKPN GNGADLP  +W Q+L ++D
Sbjct:   32 LVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELD 186          
BLAST of NudC nuclear distribution protein vs. Ensembl Human
Match: NUDC (nuclear distribution C, dynein complex regulator [Source:HGNC Symbol;Acc:HGNC:8045])

HSP 1 Score: 54.299 bits (129), Expect = 1.446e-8
Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  319 PRVVELTNEEAEKMQAEID----AEKH----KDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVD 537
            P++ ELT+EEAE++Q EID    AE H    K+  +D   +   EED +ED KDKGKLKPN GNGADLP  +W Q+L ++D
Sbjct:   53 PQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELD 133          
BLAST of NudC nuclear distribution protein vs. Ensembl Human
Match: NUDCD2 (NudC domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30535])

HSP 1 Score: 48.521 bits (114), Expect = 2.225e-6
Identity = 37/162 (22.84%), Postives = 77/162 (47.53%), Query Frame = 1
Query:  499 PECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            P  +W Q+L++V I +  +V    +++D+   +Q +++++S+ G + +L+G L++    +E TWT+ED K++ + L K                    K +  N   S L  E+    +  + DQ Q+++             L++F  ++P  DFS  + +
Sbjct:   17 PWGQWYQTLEEVFIEV--QVPPGTRAQDIQCGLQSRHVALSVGGRE-ILKGKLFDSTIADEGTWTLEDRKMVRIVLTKT-------------------KRDAANCWTSLL--ESEYAADPWVQDQMQRKL------------TLERFQKENPGFDFSGAEIS 142          
BLAST of NudC nuclear distribution protein vs. Ensembl Celegans
Match: nud-1 (Aspergillus NUclear Division related; NUD-1 [Source:UniProtKB/TrEMBL;Acc:G5EE74])

HSP 1 Score: 279.256 bits (713), Expect = 3.508e-92
Identity = 146/317 (46.06%), Postives = 218/317 (68.77%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQD--NEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD++ LS+AQQ   GG+ E+L+  F FL R+TDF+ G   ++A  ++ + F+ H  +++ +  + KK +EE+++    ++ ++  K ++     +VVE+T+EEA   + E      +++E  +  E +  +D + + +D   +KPN GNGADL + +W Q+L++++++IP    F +KSRDV+V I+K  +SV LK   P+++G L + IKVE   W IE+GK I L+LEK+N MEWWNR  D  P INTK+V PENSKLSDLDGETR+MVEKMMYDQRQKEMGLPTS+++KK D+LQ+FM QHPEMDFS  K  
Sbjct:    5 ERFDSVLLSMAQQLS-GGVPEMLDVLFEFLSRKTDFYSGAGVDQARTLLLEKFDKHGGKAMKEAEEAKKRKEEQERKLAERRAAQKAKEEEEFRNAKVVEVTDEEAAAFEKEQAKNSVENLEKFVDNEGETSKDAEVEDEDSKLMKPNSGNGADLAKYQWTQTLQELEVKIPIAAGFAIKSRDVVVKIEKTSVSVGLKNQAPIVDGKLPHAIKVENCNWVIENGKAIVLTLEKINDMEWWNRFLDSDPPINTKEVKPENSKLSDLDGETRAMVEKMMYDQRQKEMGLPTSDEKKKHDMLQQFMKQHPEMDFSNAKIG 320          
BLAST of NudC nuclear distribution protein vs. Ensembl Fly
Match: nudC (gene:FBgn0021768 transcript:FBtr0075328)

HSP 1 Score: 259.61 bits (662), Expect = 2.631e-84
Identity = 145/329 (44.07%), Postives = 218/329 (66.26%), Query Frame = 1
Query:   43 KFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK----KIQDNEPRVVELTNEEAEKMQAEIDAEKHKDM-----------EVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            KFDN+ L++A++   GG+ E L     FL R+TDFF G  + E  K++ D F    K ++ ++ ++ K RE   +LK  K+ +E K    +I DN  ++ ++T+EEA  +  E + +K + +             D   +  E+ D + D  + GKL PN GNG  L    W Q+L++V+++IP  + F +++RD++++I KK + V +KG  P+++G L  ++K EES W ++D K + ++L+K+N+M WW+R+    PEI+T+K+NPE+SKLSDLDGETRSMVEKMMYDQRQKE+GLPTSED+KKQD+L+KF  QHPEMDFSKCKFN
Sbjct:    7 KFDNILLAVAEK-HHGGVPEFLGTLASFLRRKTDFFTGAKQTEWEKLLLDVFNKESKLAVTENYEKIKAREASQRLKAEKERAERKARKQEIDDN--KICDITDEEAAAIIKEEETKKRQQLLDSAGGEPSASNRDGISKPIEKVDDESDKSELGKLMPNAGNGCTLENYTWTQTLEEVELKIPFNLTFGLRARDLVISIGKKSLKVGIKGQTPIIDGELCGEVKTEESVWVLQDSKTVMITLDKINKMNWWSRLVTTDPEISTRKINPESSKLSDLDGETRSMVEKMMYDQRQKELGLPTSEDRKKQDILEKFKQQHPEMDFSKCKFN 332          
BLAST of NudC nuclear distribution protein vs. Ensembl Fly
Match: nudC (gene:FBgn0021768 transcript:FBtr0305912)

HSP 1 Score: 259.61 bits (662), Expect = 2.631e-84
Identity = 145/329 (44.07%), Postives = 218/329 (66.26%), Query Frame = 1
Query:   43 KFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK----KIQDNEPRVVELTNEEAEKMQAEIDAEKHKDM-----------EVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            KFDN+ L++A++   GG+ E L     FL R+TDFF G  + E  K++ D F    K ++ ++ ++ K RE   +LK  K+ +E K    +I DN  ++ ++T+EEA  +  E + +K + +             D   +  E+ D + D  + GKL PN GNG  L    W Q+L++V+++IP  + F +++RD++++I KK + V +KG  P+++G L  ++K EES W ++D K + ++L+K+N+M WW+R+    PEI+T+K+NPE+SKLSDLDGETRSMVEKMMYDQRQKE+GLPTSED+KKQD+L+KF  QHPEMDFSKCKFN
Sbjct:    7 KFDNILLAVAEK-HHGGVPEFLGTLASFLRRKTDFFTGAKQTEWEKLLLDVFNKESKLAVTENYEKIKAREASQRLKAEKERAERKARKQEIDDN--KICDITDEEAAAIIKEEETKKRQQLLDSAGGEPSASNRDGISKPIEKVDDESDKSELGKLMPNAGNGCTLENYTWTQTLEEVELKIPFNLTFGLRARDLVISIGKKSLKVGIKGQTPIIDGELCGEVKTEESVWVLQDSKTVMITLDKINKMNWWSRLVTTDPEISTRKINPESSKLSDLDGETRSMVEKMMYDQRQKELGLPTSEDRKKQDILEKFKQQHPEMDFSKCKFN 332          
BLAST of NudC nuclear distribution protein vs. Ensembl Fly
Match: CG31251 (gene:FBgn0051251 transcript:FBtr0083484)

HSP 1 Score: 67.3958 bits (163), Expect = 2.852e-12
Identity = 46/140 (32.86%), Postives = 82/140 (58.57%), Query Frame = 1
Query:  466 LKPNEGNGADLPECK-WVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQP---LLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQ 873
              P++    D+ E   W Q+LKDV+++     +    ++ + ++IQ ++I VS K H P   +LEG L   IK +E+ WTI+  ++I +S +K  ++ WW+R+ +  PEI++KK+  E   + DL  ET++ +EK+   Q
Sbjct:  124 FSPSDYKNGDVFETHCWSQTLKDVEVQALLPKDHQT-AKKLHISIQAQHIKVSSK-HSPETIILEGNLSQRIKHKEAVWTIDQNRLI-ISYDKAKEL-WWDRLFEGDPEIDSKKIECERY-IDDLPEETQATIEKLRVQQ 258          
BLAST of NudC nuclear distribution protein vs. Ensembl Zebrafish
Match: nudc (nudC nuclear distribution protein [Source:ZFIN;Acc:ZDB-GENE-040426-899])

HSP 1 Score: 320.087 bits (819), Expect = 9.504e-108
Identity = 170/330 (51.52%), Postives = 238/330 (72.12%), Query Frame = 1
Query:   37 NDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXX------XIKKIQDNEPRVVELTNEEAEKMQAEIDA--EKHKDMEV------DIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            +++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G       K+V +AF  H + ++    +++  +E++ K K  +         + +KI   EPR+ ELT+EEAE++Q+++    E+ K+ EV      D K +   + + +ED KDK K+KPN GNGADLP  +W QSL +VD+ +P  V+F +K +DV+V++Q++ + V LKGH PL++G L+N++KVEES+W IEDGKV+ +  EK+N+MEWWN++    PEINTKK+ PENSKLSDLDGETRSMVEKMMYDQRQK MGLPTSE+QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:    5 DERFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFTGGESGAPEKLVKEAFAHHNQLALQVQKEKQSRQEKERKEKAERAAKLKEEEMKKRKIDAEEPRIKELTDEEAERLQSQLQTKQEEQKNSEVAEKTDADSKDKKGSDSEGEEDEKDKDKVKPNAGNGADLPNYRWTQSLSEVDLVVPFDVSFRLKGKDVVVDVQRRTLKVGLKGHPPLIDGQLFNEVKVEESSWLIEDGKVVTIHFEKINKMEWWNKLVTTDPEINTKKICPENSKLSDLDGETRSMVEKMMYDQRQKSMGLPTSEEQKKQDILKKFMAQHPEMDFSKAKFS 333          
BLAST of NudC nuclear distribution protein vs. Ensembl Zebrafish
Match: nudcd3 (NudC domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2255])

HSP 1 Score: 86.6557 bits (213), Expect = 1.249e-18
Identity = 49/154 (31.82%), Postives = 88/154 (57.14%), Query Frame = 1
Query:  484 NGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLK---GHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            NGA   +  W Q   DV++R+  + +  +K R V V++Q   +SVS+      + LL+G   + I  E S W++E G+ + LSL K +++ WW+ V   + EI+  ++N E S ++ +D E  ++++++ +D  QK  G P S + K  D+L+K
Sbjct:  166 NGAVREKYTWSQDYTDVEVRVHVEPDI-IKGRQVCVDLQSSRVSVSVADGGSRKVLLDGEFTHRINTENSLWSLEPGRCVLLSLSKCSEV-WWSAVLKGEAEIDVNQINRERS-MATVDEEEHAVLDRLTFDYHQKLQGKPQSHEMKVHDMLKK 316          
BLAST of NudC nuclear distribution protein vs. Ensembl Zebrafish
Match: nudcd2 (NudC domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040801-49])

HSP 1 Score: 46.595 bits (109), Expect = 7.377e-6
Identity = 41/155 (26.45%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  511 WVQSLKDVDIRIPTKVNFP--VKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFS 969
            W Q++++V I    +VN P    ++++  NI  K I + +K  Q + +G L+     +E+TWT+ED K+I + L K N+                      N   S L+GE   M +  + DQ Q+++             L++F  ++P  DFS
Sbjct:   21 WYQTMEEVYI----EVNVPPGTSAKEIKCNIGSKQIELRVKDQQ-IFKGKLFGSTVCDEATWTLEDKKLIRIVLMKTNR-------------------EAGNCWQSLLEGEF--MADPWVQDQMQRKL------------TLERFQRENPGFDFS 137          
BLAST of NudC nuclear distribution protein vs. Ensembl Zebrafish
Match: nudcd2 (NudC domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040801-49])

HSP 1 Score: 46.595 bits (109), Expect = 7.377e-6
Identity = 41/155 (26.45%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  511 WVQSLKDVDIRIPTKVNFP--VKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFS 969
            W Q++++V I    +VN P    ++++  NI  K I + +K  Q + +G L+     +E+TWT+ED K+I + L K N+                      N   S L+GE   M +  + DQ Q+++             L++F  ++P  DFS
Sbjct:   21 WYQTMEEVYI----EVNVPPGTSAKEIKCNIGSKQIELRVKDQQ-IFKGKLFGSTVCDEATWTLEDKKLIRIVLMKTNR-------------------EAGNCWQSLLEGEF--MADPWVQDQMQRKL------------TLERFQRENPGFDFS 137          
BLAST of NudC nuclear distribution protein vs. Ensembl Xenopus
Match: klf11 (Kruppel-like factor 11 [Source:Xenbase;Acc:XB-GENE-956858])

HSP 1 Score: 317.775 bits (813), Expect = 8.414e-107
Identity = 171/325 (52.62%), Postives = 240/325 (73.85%), Query Frame = 1
Query:   37 NDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEV---------DIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            +++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G     A K++T AF  H K ++A   ++  +R E++ +++ ++  + K+ +  E R+ ELT+EEAE++Q EID  K K+            +   E ++EE+ ++D KDKGKLKPN GNGA+LP  +W Q+L +VD+ +P  V+F +K +DV V+I++  +++ L+G +P+L+G L+NDIKVEE +W IEDGKV+ + LEK+N MEWW+RV    PEINTKK+NPENSKLSDLDGETRSMVEKMMYDQRQK MGLPTS++QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:    7 DERFDAMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFVGGENAAAEKLITQAFNHHNKLALAAQKQKDADRLEREAVRQEREAKK-KETEAGESRITELTDEEAERLQKEIDKNKEKEKATRETEEKPEPEKDGEEEKEEEEEDDEKDKGKLKPNSGNGANLPHYRWTQTLSEVDLVVPFPVSFRLKGKDVQVDIKRHRLTIGLRGQKPVLDGELFNDIKVEECSWLIEDGKVVTVHLEKINTMEWWSRVVLTDPEINTKKINPENSKLSDLDGETRSMVEKMMYDQRQKSMGLPTSDEQKKQDILKKFMEQHPEMDFSKAKFS 329          
BLAST of NudC nuclear distribution protein vs. Ensembl Xenopus
Match: nudcd3 (NudC domain containing 3 [Source:NCBI gene;Acc:548495])

HSP 1 Score: 89.7373 bits (221), Expect = 1.821e-19
Identity = 51/158 (32.28%), Postives = 91/158 (57.59%), Query Frame = 1
Query:  472 PNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLK---GHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            P+  NGA      W Q   DV+I++P   +  +K R V V+++   I V+++   G + L+EG+  + I  E S W++E GK I +SL K  ++ WWN V + + +I+  K+N E S ++ +D E  ++++++ +D  QK  G P S + K  ++L+K
Sbjct:  164 PDSYNGAIRKNYVWSQDYTDVEIKVPVPKSV-IKGRQVSVDLRSSCIRVAVREGGGERVLVEGSFTHKINAETSLWSLEPGKCIVISLSKCGEV-WWNAVLEDEEKIDIDKINKERS-MATVDDEEHAVLDRLTFDYHQKLQGKPQSHELKVHEMLKK 318          
BLAST of NudC nuclear distribution protein vs. Ensembl Mouse
Match: Nudc (nudC nuclear distribution protein [Source:MGI Symbol;Acc:MGI:106014])

HSP 1 Score: 316.62 bits (810), Expect = 2.021e-106
Identity = 171/326 (52.45%), Postives = 237/326 (72.70%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEIDAEK-HKDMEVDIXXXX--------XXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G  +  A K++T  F  H + +     +++  +E + + K  +     K  K +   P++ ELT+EEAE++Q EID +K  +D E  +K            E+E+ +ED KDKGKLKPN GNGADLP  +W Q+L ++D+ +P +V+F +K +DV+V+IQ++++ V LKG  P+++G LYN++KVEES+W IEDGKV+ + LEK+N+MEWWNR+    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQ++L+KFM QHPEMDFSK KFN
Sbjct:    8 ERFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFNHHNQLAQKARREKRARQETERREKAERAARLAKEAKAETPGPQIKELTDEEAERLQLEIDQKKDAEDQEAQLKNGSLDSPGKQDAEDEEDEEDEKDKGKLKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN 332          
BLAST of NudC nuclear distribution protein vs. Ensembl Mouse
Match: Nudcd3 (NudC domain containing 3 [Source:MGI Symbol;Acc:MGI:2144158])

HSP 1 Score: 80.1073 bits (196), Expect = 3.100e-16
Identity = 46/158 (29.11%), Postives = 88/158 (55.70%), Query Frame = 1
Query:  472 PNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSL---KGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            P+  NGA      W Q   D+++R+P   +  +K + V V +    I V++    G + L+EG L + I  E S W++E G+ + ++L KV +  WW+ + + +  I+  K+N E S ++ +D E +++++++ +D  QK  G P S + K  ++L+K
Sbjct:  181 PDSYNGAIRENYIWSQDYTDLEVRVPVPKHV-MKGKQVSVALSSGTIRVAMVEENGERVLMEGKLTHKINTESSLWSLEPGRCVLVNLSKVGEY-WWSAILEGEEPIDIDKINKERS-MATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKK 335          
BLAST of NudC nuclear distribution protein vs. Ensembl Mouse
Match: Nudcd2 (NudC domain containing 2 [Source:MGI Symbol;Acc:MGI:1277103])

HSP 1 Score: 47.7506 bits (112), Expect = 3.248e-6
Identity = 36/157 (22.93%), Postives = 75/157 (47.77%), Query Frame = 1
Query:  499 PECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFS 969
            P  +W Q+L++V I +  +V    +++D+   +Q +++++++ G + +L+G L++    +E TWT+ED K++ + L K                    K +  N   S L  E+    +  + DQ Q+++             L++F  ++P  DFS
Sbjct:   17 PWGQWYQTLEEVFIEV--QVPPGTRAQDIQCGLQSRHVALAVGGRE-ILKGKLFDSTIADEGTWTLEDRKMVRIVLTKT-------------------KRDAANCWTSLL--ESEYAADPWVQDQMQRKL------------TLERFQKENPGFDFS 137          
BLAST of NudC nuclear distribution protein vs. UniProt/SwissProt
Match: sp|Q5ZIN1|NUDC_CHICK (Nuclear migration protein nudC OS=Gallus gallus OX=9031 GN=NUDC PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.183e-109
Identity = 175/330 (53.03%), Postives = 235/330 (71.21%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVD-------------IXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            D+FD + L++AQQ  +GG+ EL+N FF FL R+TDFF G     A K++TD+F  H K +  +  ++K  +E + + K  +     K  K + NEPR+ ELT+EEAE++Q EID +K    EV+                  +E +D ++D  DKGKLKPN GNGADLP  +W Q+L ++D+ IP KV F +K +DV+V+IQ++ + V LKGH P+++G L+N++KVEES+W IEDGK + + LEK+N+MEWWN++    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQD+L+KFM QHPEMDFSK KFN
Sbjct:   13 DRFDGILLAMAQQ-HQGGVCELVNTFFSFLRRKTDFFTGGEDGVAEKLITDSFNHHNKLAQKERKEKKARQEAERREKAERAAKLAKEAKQEANEPRIKELTDEEAERLQLEIDQKKEAQKEVNNVPVKSSEDDGDSSDSNKQETDDEEKDENDKGKLKPNAGNGADLPNYRWTQTLSELDLAIPFKVTFRLKGKDVVVDIQRRRLRVGLKGHPPVIDGELFNEVKVEESSWLIEDGKTVTVHLEKINKMEWWNKLVSTDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQDILKKFMEQHPEMDFSKAKFN 341          
BLAST of NudC nuclear distribution protein vs. UniProt/SwissProt
Match: sp|Q63525|NUDC_RAT (Nuclear migration protein nudC OS=Rattus norvegicus OX=10116 GN=Nudc PE=1 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 7.203e-106
Identity = 173/326 (53.07%), Postives = 238/326 (73.01%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEID----AEKH----KDMEVDI-XXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G  +  A K++T  F  H + +     +++  +E + + K  +     K  K +   P++ ELT+EEAE++Q EID    AE H    K+  +D    +  EEE+ +ED KDKGKLKPN GNGADLP  +W Q+L ++D+ +P +V+F +K +DV+V+IQ++++ V LKG  P+++G LYN++KVEES+W IEDGKV+ + LEK+N+MEWWNR+    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQ++L+KFM QHPEMDFSK KFN
Sbjct:    8 ERFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFNHHNQLAQKARREKRARQETERREKAERAARLAKEAKAETPGPQIKELTDEEAERLQLEIDQKKDAENHEVQLKNGSLDSPGKQDAEEEEDEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQAPVIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN 332          
BLAST of NudC nuclear distribution protein vs. UniProt/SwissProt
Match: sp|O35685|NUDC_MOUSE (Nuclear migration protein nudC OS=Mus musculus OX=10090 GN=Nudc PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.414e-105
Identity = 171/326 (52.45%), Postives = 237/326 (72.70%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEIDAEK-HKDMEVDIXXXX--------XXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G  +  A K++T  F  H + +     +++  +E + + K  +     K  K +   P++ ELT+EEAE++Q EID +K  +D E  +K            E+E+ +ED KDKGKLKPN GNGADLP  +W Q+L ++D+ +P +V+F +K +DV+V+IQ++++ V LKG  P+++G LYN++KVEES+W IEDGKV+ + LEK+N+MEWWNR+    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQ++L+KFM QHPEMDFSK KFN
Sbjct:    8 ERFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFNHHNQLAQKARREKRARQETERREKAERAARLAKEAKAETPGPQIKELTDEEAERLQLEIDQKKDAEDQEAQLKNGSLDSPGKQDAEDEEDEEDEKDKGKLKPNLGNGADLPNYRWTQTLAELDLAVPFRVSFRLKGKDVVVDIQRRHLRVGLKGQPPVVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNRLVTSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN 332          
BLAST of NudC nuclear distribution protein vs. UniProt/SwissProt
Match: sp|Q9Y266|NUDC_HUMAN (Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 3.931e-105
Identity = 172/325 (52.92%), Postives = 240/325 (73.85%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQK--QSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEID----AEKH----KDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD + L++AQQ  EGG++EL+N FF FL R+TDFF G  +  A K++T  F  H +  Q   +  + ++E E ++K ++  + ++  K + + P++ ELT+EEAE++Q EID    AE H    K+  +D   +   EED +ED KDKGKLKPN GNGADLP  +W Q+L ++D+ +P  VNF +K +D++V+IQ++++ V LKG   +++G LYN++KVEES+W IEDGKV+ + LEK+N+MEWW+R+    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQ++L+KFM QHPEMDFSK KFN
Sbjct:    8 ERFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN 331          
BLAST of NudC nuclear distribution protein vs. UniProt/SwissProt
Match: sp|Q17QG2|NUDC_BOVIN (Nuclear migration protein nudC OS=Bos taurus OX=9913 GN=NUDC PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 6.872e-104
Identity = 167/326 (51.23%), Postives = 234/326 (71.78%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEIDAEK-HKDMEVDIXXXXXXX--------XXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            D+FD + L++AQQ  EGG++EL+N FF FL R+TDFF G  +  A K++T  F  H + +     +++  +E + + K  +     K  K + + P++ ELT+EEAE++Q EID +K  ++ E  +K              E+ ++D KDKGKLKPN GNGADLP  +W Q+L ++D+ +P  VNF +K +DV+V+IQ++++ V LKG   +++G LYN++KVEES+W IEDGKV+ + LEK+N+MEWW+R+    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQ++L+KFM QHPEMDFSK +FN
Sbjct:    8 DRFDGMLLAMAQQ-HEGGVQELVNTFFSFLRRKTDFFVGGEEGMAEKLITQTFNHHNQLAQKARREKRARQETERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENQEAQLKNGSLGSPGKQEAEEEEEEDDEKDKGKLKPNLGNGADLPSYRWTQTLSELDLAVPFCVNFRLKGKDVVVDIQRRHLRVGLKGQPAIVDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKARFN 332          
BLAST of NudC nuclear distribution protein vs. TrEMBL
Match: A0A0B7AID3 (CS domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF117791 PE=4 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.212e-111
Identity = 184/332 (55.42%), Postives = 255/332 (76.81%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQ-------KQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXX----------XXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            D+FD + +++AQQCE GGI+ELL+ FFGFL R+TDF+ G    +A K+V   FE ++       ++  A+ + E+K R+E+   KK ++E   +K+++ EP++ ELT+EEAEK++ ++   ++KD +VD             E K   D +ED KDKGK+KPN GNGAD+P   W Q+L++V+IR+P KVNFP+KS+D++VNI+K+ +S+ LKGH P+LEGT+YND+KV+ESTW ++D K+I +++EKVNQMEWW+R+   +PEINT+KV PENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTS++QKKQD+L+KFM QHPEMDFSKCKF+
Sbjct:    8 DRFDGMLMAMAQQCE-GGIQELLDAFFGFLARKTDFYTGAGGAQAEKLVIAKFEQYETIFNARLQKEKAERDAEEKRRQERLAKKKTEEEKIAEKVEE-EPKIKELTDEEAEKLERDL---QNKDNDVDAVNGDEDVAEDPIEQKSPSDDEEDEKDKGKIKPNIGNGADMPNYSWTQTLQEVEIRVPFKVNFPLKSKDIVVNIEKRKLSIGLKGHPPVLEGTMYNDVKVDESTWCLQDKKLILINIEKVNQMEWWSRIVTTEPEINTRKVQPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQHPEMDFSKCKFS 334          
BLAST of NudC nuclear distribution protein vs. TrEMBL
Match: A0A091GHR4 (Nuclear migration protein nudC OS=Cuculus canorus OX=55661 GN=N303_00258 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 9.597e-110
Identity = 175/329 (53.19%), Postives = 240/329 (72.95%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQD-NEPRVVELTNEEAEKMQAEIDAEKHKDMEVD-------------IXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            D+FD + L++AQQ  +GG++EL+N FF FL R+TDFF G     A K++T+ F  H K +  +  ++K ++E + + K  +     ++ Q+ NEPR+ ELT+EEAE++Q EID +K    EV+             +    +E +D +ED KDKGKLKPN GNGADLP  +W Q+L ++D+ +P KVNF +K +DV+V+IQ++ + V LKGH P+++G L+N++KVEES+W IEDGK + + LEK+N+MEWWN++    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQD+L+KFM QHPEMDFSK KFN
Sbjct:   13 DRFDGMLLAMAQQ-HQGGVRELVNTFFSFLRRKTDFFTGGEDGVAEKLITETFSYHNKLAQKERKEKKAQQEAERREKAERAAKLAREKQEANEPRIKELTDEEAERLQLEIDQKKEAQGEVNSVPVKPSEAGGDSLDSSKQETDDEEEDEKDKGKLKPNSGNGADLPNYRWTQTLSELDLAVPFKVNFRLKGKDVVVDIQRRRLKVGLKGHSPVIDGELFNEVKVEESSWLIEDGKTVTVHLEKINKMEWWNKLVSTDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQDILKKFMEQHPEMDFSKAKFN 340          
BLAST of NudC nuclear distribution protein vs. TrEMBL
Match: A0A091VLZ1 (Nuclear migration protein nudC OS=Nipponia nippon OX=128390 GN=Y956_14884 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 2.079e-109
Identity = 175/329 (53.19%), Postives = 238/329 (72.34%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQD-NEPRVVELTNEEAEKMQAEIDAEKHKDMEVD-------------IXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            D+FD + L++AQQ  +GG++EL+N FF FL R+TDFF G     A K++TD F  H K +  +  ++K  +E +   K  +     K+ Q+ NEPR+ ELT+EEAE++Q EID +K    +++             +    +E +D +ED KDKGKL+PN GNGADLP  +W Q+L ++D+ IP KVNF +K +DV+V+IQ++ + V LKGH P+++G L+N++KVEES+W IEDGK + + LEK+N+MEWWN++    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQD+L+KFM QHPEMDFSK KFN
Sbjct:   13 DRFDGMLLAMAQQ-HQGGVRELVNTFFSFLRRKTDFFTGGEDGVAEKLITDTFNHHNKLAQKEQKEKKARQEAERHEKAERAAKLAKEKQEANEPRIKELTDEEAERLQLEIDQKKEAQGQINSVPVKPSEDEGESLDSNKQETDDEEEDEKDKGKLRPNSGNGADLPNYRWTQTLSELDLAIPFKVNFRLKGKDVVVDIQRRRLKVGLKGHSPVIDGELFNEVKVEESSWLIEDGKTVTVHLEKINKMEWWNKLVSTDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQDILKKFMEQHPEMDFSKAKFN 340          
BLAST of NudC nuclear distribution protein vs. TrEMBL
Match: U3IT87 (Nuclear distribution C, dynein complex regulator OS=Anas platyrhynchos platyrhynchos OX=8840 GN=NUDC PE=4 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 2.615e-109
Identity = 172/330 (52.12%), Postives = 234/330 (70.91%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIK--KIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXXXX-------------XLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            D+FD + L++AQQ  +GG++EL+N FF FL R+TDFF G     A K++TD F  H K +  +  ++K  +E + + K  +     K  K + NEPR+ ELT+EEAE++Q EID +K    EV+  P    E++ +    +K              KLKPN GNGADLP  +W Q+L ++D+ IP KV+F +K +DV+V+IQ++++ V LKGH P+++G L+N++KVEES+W IEDGK + + LEK+N+MEWWN++    PEINTKK+NPENSKLSDLD ETRSMVEKMMYDQRQK MGLPTS++QKKQD+L+KFM QHPEMDFSK KFN
Sbjct:   13 DRFDGMLLAMAQQ-HQGGVRELVNTFFSFLRRKTDFFTGGEDGVAEKLITDTFNHHNKLAQKERKEKKARQEAERREKAERAAKLAKEAKQEANEPRIKELTDEEAERLQLEIDQKKEAQKEVNSVPVKSAEDEGESSDSNKQETDEEEEDEKDKGKLKPNSGNGADLPNYRWTQTLSELDLAIPFKVSFRLKGKDVVVDIQRRHLKVGLKGHSPVIDGDLFNEVKVEESSWLIEDGKTVTVHLEKINKMEWWNKLVSTDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQDILKKFMEQHPEMDFSKAKFN 341          
BLAST of NudC nuclear distribution protein vs. TrEMBL
Match: A0A1S3JUH0 (nuclear migration protein nudC OS=Lingula unguis OX=7574 GN=LOC106176228 PE=4 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 3.407e-109
Identity = 183/326 (56.13%), Postives = 242/326 (74.23%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQ------DNEPRVVELTNEEAEKMQAEIDAEK-----HKDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            ++FD + LS+A QCE GG+ ELL+  F FL R+TDF+ G +K    +++ D F   +K+++ K  KEK++REE +K +K +   + +K +        EP++ E+T+EEAEK+Q EI+ EK      ++   D   + + + D +ED KDK K+KPN GNGADLP  KW Q+L+DV+IRIP KV FP+K +D +V I+KK++ V LKGH P+++G +YND+K EESTW IED K+I L+LEKVNQMEWW+RV    PEINTKKV PENSKLSDLDGETRS+VEKMMYDQRQKEMGLPTS++QKKQD+L KFM QHPEMDFSKCKF+
Sbjct:    5 ERFDGMLLSMATQCE-GGVTELLDVIFSFLARKTDFYTGASKGTPEQLILDKFRHFEKEALKKAQKEKEDREESEKRRKERLAKKAEKERLEQEQLKEEPKIKEITDEEAEKLQKEIEKEKTGNDAEENGSGDADEKEETKSDDEEDEKDKDKIKPNSGNGADLPNYKWTQTLQDVEIRIPFKVPFPIKGKDCVVVIEKKHLKVGLKGHPPVIDGPMYNDVKKEESTWCIEDKKIIILNLEKVNQMEWWSRVVTTDPEINTKKVQPENSKLSDLDGETRSLVEKMMYDQRQKEMGLPTSDEQKKQDVLSKFMKQHPEMDFSKCKFS 329          
BLAST of NudC nuclear distribution protein vs. Ensembl Cavefish
Match: nudc (nuclear distribution C, dynein complex regulator [Source:NCBI gene;Acc:103045763])

HSP 1 Score: 301.597 bits (771), Expect = 1.703e-100
Identity = 167/333 (50.15%), Postives = 230/333 (69.07%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXX------XXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXX------------XXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            +K+D + L +AQQ  EGG++EL+N FF FL R+TDFF G       ++V +AF  H + ++  H       +++K+ + +   K   +E   KK  +NEPR+ ELT+EEAE++Q EID +K K+ + + K       D  +  +             K K+KPN GNGADLP  +W QSL +VD+ +P  V F +K +DV+V++Q++ + V LKGH P+++  L+N++KVEES+W IEDGKV+ + LEK+N+MEWWN++    PEINTKK+ PENSKLSDLDGETRSMVEKMMYDQRQK MGLPTSE+QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:    6 EKYDGMLLVMAQQ-HEGGVQELVNTFFSFLRRKTDFFTGGESGAPERLVKEAFAHHSQLALQAHKDKQSKQEKEKKEKAERAAKLKAEEERKKKELENEPRIKELTDEEAERLQTEIDQKKDKEEQKEKKDTESSAADTSDKAEKGSESEGEEDEKDKNKVKPNSGNGADLPNYRWTQSLSEVDLIVPFDVKFRLKGKDVVVDVQRRSLKVGLKGHPPVIDAALFNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNKLVTTDPEINTKKICPENSKLSDLDGETRSMVEKMMYDQRQKSMGLPTSEEQKKQDILKKFMEQHPEMDFSKAKFS 337          
BLAST of NudC nuclear distribution protein vs. Ensembl Cavefish
Match: nudc (nuclear distribution C, dynein complex regulator [Source:NCBI gene;Acc:103045763])

HSP 1 Score: 283.878 bits (725), Expect = 1.082e-93
Identity = 158/314 (50.32%), Postives = 215/314 (68.47%), Query Frame = 1
Query:   97 KELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXX------XXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXX------------XXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            K L+N FF FL R+TDFF G       ++V +AF  H + ++  H       +++K+ + +   K   +E   KK  +NEPR+ ELT+EEAE++Q EID +K K+ + + K       D  +  +             K K+KPN GNGADLP  +W QSL +VD+ +P  V F +K +DV+V++Q++ + V LKGH P+++  L+N++KVEES+W IEDGKV+ + LEK+N+MEWWN++    PEINTKK+ PENSKLSDLDGETRSMVEKMMYDQRQK MGLPTSE+QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:   15 KGLVNTFFSFLRRKTDFFTGGESGAPERLVKEAFAHHSQLALQAHKDKQSKQEKEKKEKAERAAKLKAEEERKKKELENEPRIKELTDEEAERLQTEIDQKKDKEEQKEKKDTESSAADTSDKAEKGSESEGEEDEKDKNKVKPNSGNGADLPNYRWTQSLSEVDLIVPFDVKFRLKGKDVVVDVQRRSLKVGLKGHPPVIDAALFNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNKLVTTDPEINTKKICPENSKLSDLDGETRSMVEKMMYDQRQKSMGLPTSEEQKKQDILKKFMEQHPEMDFSKAKFS 328          
BLAST of NudC nuclear distribution protein vs. Ensembl Cavefish
Match: nudc (nuclear distribution C, dynein complex regulator [Source:NCBI gene;Acc:103045763])

HSP 1 Score: 279.256 bits (713), Expect = 3.594e-92
Identity = 154/307 (50.16%), Postives = 212/307 (69.06%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXX------XXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFM 942
            +K+D + L +AQQ  EGG++EL+N FF FL R+TDFF G       ++V +AF  H + ++  H       +++K+ + +   K   +E   KK  +NEPR+ ELT+EEAE++Q EID  + +  E               D KDK K+KPN GNGADLP  +W QSL +VD+ +P  V F +K +DV+V++Q++ + V LKGH P+++  L+N++KVEES+W IEDGKV+ + LEK+N+MEWWN++    PEINTKK+ PENSKLSDLDGETRSMVEKMMYDQRQK MGLPTSE+QKKQD+L+ F 
Sbjct:    6 EKYDGMLLVMAQQ-HEGGVQELVNTFFSFLRRKTDFFTGGESGAPERLVKEAFAHHSQLALQAHKDKQSKQEKEKKEKAERAAKLKAEEERKKKELENEPRIKELTDEEAERLQTEIDQSESEGEE---------------DEKDKNKVKPNSGNGADLPNYRWTQSLSEVDLIVPFDVKFRLKGKDVVVDVQRRSLKVGLKGHPPVIDAALFNEVKVEESSWLIEDGKVVTVHLEKINKMEWWNKLVTTDPEINTKKICPENSKLSDLDGETRSMVEKMMYDQRQKSMGLPTSEEQKKQDILKNFF 296          
BLAST of NudC nuclear distribution protein vs. Ensembl Cavefish
Match: nudcd3 (NudC domain containing 3 [Source:NCBI gene;Acc:103040649])

HSP 1 Score: 85.8853 bits (211), Expect = 2.865e-18
Identity = 52/156 (33.33%), Postives = 86/156 (55.13%), Query Frame = 1
Query:  484 NGADLPECKWVQSLKDVDIRI--PTKVNFPVKSRDVIVNIQKKYISVSLK---GHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            NGA      W Q   DV++R+  P  +   VK R V VN+Q   + V++K     + LLEG   + I  E S W++E G+ + LSL K  ++ WW+ V   + EI+  ++N E S ++ +D E  ++++++ +D  QK  G P S + K  D+L+K
Sbjct:  200 NGAVRENYSWSQDYTDVEVRVFVPPSI---VKGRQVSVNLQCGSVRVAVKEGASEKVLLEGEFTHKINTENSLWSLEPGQCVLLSLSKTGEV-WWSAVLKGEQEIDVNQINRERS-MASVDEEEHAVLDRLTFDYHQKLQGKPQSHEMKVHDMLKK 350          
BLAST of NudC nuclear distribution protein vs. Ensembl Sea Lamprey
Match: nudc (nudC nuclear distribution protein [Source:ZFIN;Acc:ZDB-GENE-040426-899])

HSP 1 Score: 233.417 bits (594), Expect = 1.348e-74
Identity = 150/340 (44.12%), Postives = 217/340 (63.82%), Query Frame = 1
Query:   19 VFLVMSNDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIA------XXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEID--------AEKHKDMEVDI--XXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYIS-VSLKGHQPLLEGTLYNDIKVEES-TWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            V      ++FD + L++AQQ  EGG++++L+  F FL R+TDFF G  K  A K++ + F  H+K ++A      +  +E++ R+ +++ ++ +Q+ ++   Q  EPR+ E+T+EEA+++Q EID         E+ K+ +  +       ++ED +ED KDKGKLKPN GNGADL   +W Q+L +VD+R           + +I  +Q   ++ + +K    +      +D+ V  S TW +E   VI      +N+MEWW+R+    PEINT+KVNPENSKLSDLDGETRSMVEKMMYDQRQK MGLPTSEDQKKQD+L+KFM QHPEMDFSK KF+
Sbjct:    1 VMAASDEERFDGILLAMAQQ-HEGGVQQMLDTIFSFLRRKTDFFVGGEKAAAEKLLLECFRRHEKAALAGERERAREREERQRRDAEERTRRRQQQEQLDDAQAKEPRIQEVTDEEAQRIQREIDQVRARSDKKERQKNGQSRLPGVEPAPDKEDEEEDEKDKGKLKPNVGNGADLANYRWTQTLSEVDVRALAAAR--ATGKGLIGPVQSLTLNRLGMKFRCQISNLRAVSDVWVVGSLTWILERVFVITSVTSHINKMEWWSRLVVSDPEINTRKVNPENSKLSDLDGETRSMVEKMMYDQRQKAMGLPTSEDQKKQDILKKFMEQHPEMDFSKAKFS 337          
BLAST of NudC nuclear distribution protein vs. Ensembl Sea Lamprey
Match: nudcd3 (NudC domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2255])

HSP 1 Score: 85.8853 bits (211), Expect = 5.648e-19
Identity = 50/160 (31.25%), Postives = 91/160 (56.88%), Query Frame = 1
Query:  472 PNEGNGADLPECKWVQSLKDVDIRI--PTKVNFPVKSRDVIVNIQKKYISVSLKGHQP---LLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            P+  NGA      W Q   D++I++  P  +   V+ + V +NIQK  + V+++       L+EG L ++I +E S W++E GK I ++L KV +  WWN V + +  I+  ++N E S ++ +D E  ++++++ +D  QK  G P S + K  ++L+K
Sbjct:  196 PDSYNGAVRENYVWSQDFTDLEIKVFVPKTI---VRGKQVSINIQKNSLRVAIREQAEEVVLMEGKLTHNINIESSMWSLEPGKCIQVNLNKVGEY-WWNAVLEGEEPIDIDRINKERS-MATVDEEEHAVLDRLTFDYHQKMHGRPQSHEMKVHEMLKK 350          
BLAST of NudC nuclear distribution protein vs. Ensembl Nematostella
Match: EDO46710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB6])

HSP 1 Score: 239.965 bits (611), Expect = 3.601e-77
Identity = 110/173 (63.58%), Postives = 142/173 (82.08%), Query Frame = 1
Query:  466 LKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            +KPN GNGADLP  KW Q+L+++++RIP  V+F  K +DV+V+IQ+K++   LKGH P+++G     +K+EE TW I DGK + L+LEKVN+MEWW+++    PEINTKKV PENSKLSDLDGETR MVEKMM+DQRQK+MGLPTS++QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:  144 IKPNAGNGADLPNYKWTQTLEEIELRIPLDVSFKPKGKDVVVDIQQKHLKAGLKGHPPIIDGDFPKKVKLEECTWLI-DGKNLVLNLEKVNKMEWWSQLVTSDPEINTKKVQPENSKLSDLDGETRGMVEKMMFDQRQKQMGLPTSDEQKKQDVLKKFMEQHPEMDFSKAKFS 315          
BLAST of NudC nuclear distribution protein vs. Ensembl Nematostella
Match: EDO38002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA5])

HSP 1 Score: 98.9821 bits (245), Expect = 9.475e-25
Identity = 57/160 (35.62%), Postives = 92/160 (57.50%), Query Frame = 1
Query:  484 NGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQP---------LLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            NGA L +  W Q++ D+DI++P       K+RDV V I+   + V LKG  P         L++G L   +K EE  W++E GK + ++LEK  +  +W  V    PEI+  K++     + D D +T++  E++MYD RQK+MG PT ++Q+  ++L+K
Sbjct:    4 NGAALEDYVWAQTIHDIDIKVPVPSCVK-KARDVGVEIKNSSLKVFLKGSVPPDGKVAFTILVDGQLQRHVKCEECMWSLEPGKCVAINLEKTEE-RFWTTVIKGDPEIDRTKID-TTRDIHDFDEQTQTDYEQVMYDYRQKQMGKPTVKEQQTHEMLKK 160          
BLAST of NudC nuclear distribution protein vs. Ensembl Nematostella
Match: EDO29367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3U5])

HSP 1 Score: 96.6709 bits (239), Expect = 4.121e-24
Identity = 55/149 (36.91%), Postives = 88/149 (59.06%), Query Frame = 1
Query:  469 KPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLL-EGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQ 912
            +P+  NGA L +  W Q++ D+DI++P       K+RDV V I+   + V LKG   +L +G L   +K EE  W++E GK + ++LEK  +  +W  V    PEI+  K++     + D D +T++  E++MYD RQK+MG PT ++Q
Sbjct:   14 QPDCYNGAALEDYVWAQTIHDIDIKVPVPSCVK-KARDVGVEIKNSSLKVFLKGRSTILVDGQLQRHVKCEECMWSLEPGKCVAINLEKTEE-RFWTTVIKGDPEIDRTKID-TTRDIHDFDEQTQTDYEQVMYDYRQKQMGKPTVKEQ 159          
BLAST of NudC nuclear distribution protein vs. Ensembl Medaka
Match: nudc (nuclear distribution C, dynein complex regulator [Source:NCBI gene;Acc:101169957])

HSP 1 Score: 315.464 bits (807), Expect = 3.598e-106
Identity = 170/322 (52.80%), Postives = 231/322 (71.74%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKI------QDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIX-XXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            +K+D + L +AQQ  EGG++EL+N FF FL R+TDFF G     A K+V +AF+ H K ++    +++  +E++ K K  +     ++       QD  PR+ ELT+EEAEK+Q+E+D          +     + + + +ED KDKGKLKPN GNGADLP  KW Q+L +VD+ +P  V F +K +DV+V++Q++ I V LKGH P++EG LYN++KVEES+W I+DGKV+ + LEK+N+MEWW+R+    PE+NTKK+ PENSKLSDLDGETR MVEKMMYDQRQK MGLPTSE+QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:    6 EKYDGMLLVMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGDSGAAEKLVKEAFDHHNKLAMKAQREKQMRQEKEKKEKAERAAKLAEEEEERRKNQDG-PRIQELTDEEAEKLQSELDKRTASSQASSLAFSVFQSDSEEEEDEKDKGKLKPNSGNGADLPNYKWTQTLSEVDLSVPFDVKFRIKGKDVVVDVQRRSIKVGLKGHPPVVEGQLYNEVKVEESSWLIDDGKVVNVHLEKINKMEWWSRIVTTDPEMNTKKICPENSKLSDLDGETRGMVEKMMYDQRQKSMGLPTSEEQKKQDILKKFMAQHPEMDFSKAKFS 325          
BLAST of NudC nuclear distribution protein vs. Ensembl Medaka
Match: nudc (nuclear distribution C, dynein complex regulator [Source:NCBI gene;Acc:101169957])

HSP 1 Score: 314.694 bits (805), Expect = 3.749e-105
Identity = 167/331 (50.45%), Postives = 229/331 (69.18%), Query Frame = 1
Query:   40 DKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKI------QDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXXXXX----------LKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            +K+D + L +AQQ  EGG++EL+N FF FL R+TDFF G     A K+V +AF+ H K ++    +++  +E++ K K  +     ++       QD  PR+ ELT+EEAEK+Q+E+D +K  + E       K  +  D++     +          LKPN GNGADLP  KW Q+L +VD+ +P  V F +K +DV+V++Q++ I V LKGH P++EG LYN++KVEES+W I+DGKV+ + LEK+N+MEWW+R+    PE+NTKK+ PENSKLSDLDGETR MVEKMMYDQRQK MGLPTSE+QKKQD+L+KFM QHPEMDFSK KF+
Sbjct:   47 EKYDGMLLVMAQQ-HEGGVQELVNTFFSFLRRKTDFFIGGDSGAAEKLVKEAFDHHNKLAMKAQREKQMRQEKEKKEKAERAAKLAEEEEERRKNQDG-PRIQELTDEEAEKLQSELDKQKDDEKEEGRANAEKTPDKADKEKGSDSEEEEDEKDKGKLKPNSGNGADLPNYKWTQTLSEVDLSVPFDVKFRIKGKDVVVDVQRRSIKVGLKGHPPVVEGQLYNEVKVEESSWLIDDGKVVNVHLEKINKMEWWSRIVTTDPEMNTKKICPENSKLSDLDGETRGMVEKMMYDQRQKSMGLPTSEEQKKQDILKKFMAQHPEMDFSKAKFS 375          
BLAST of NudC nuclear distribution protein vs. Planmine SMEST
Match: SMESG000036795.1 (SMESG000036795.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 317/318 (99.69%), Postives = 317/318 (99.69%), Query Frame = 1
Query:   31 MSNDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 984
            MSNDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAKHNKEKKEREEKDKLKKLKQESEIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIKPEVKEEED DEDPKDKGKLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN
Sbjct:    1 MSNDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFKVVTDAFEVHQKQSIAKHNKEKKEREEKDKLKKLKQESEIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIKPEVKEEEDPDEDPKDKGKLKPNEGNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKGHQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQKFMTQHPEMDFSKCKFN 318          
BLAST of NudC nuclear distribution protein vs. Planmine SMEST
Match: SMESG000064942.1 (SMESG000064942.1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.884e-23
Identity = 87/318 (27.36%), Postives = 156/318 (49.06%), Query Frame = 1
Query:   37 NDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFY---------GVAKEEAFKVVTDAFEVHQ---KQSIAXXXXXXXXXXXXXXXXXXXXXXXIKKIQDNEPRVVELTNEEAEKMQAEIDAEKHKDMEVDIXXXXXXXXXXXXXXXXXXXLKPNEGNGADLPECKWVQSLKDVDIR--IPTKVNFPVKSRDVIVNIQKKYISVSLKGH---QPLLEGTLYNDIKVEESTWTIEDGKV-IYLSLEKVNQMEWWNRVTDKQPEINTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLLQK 936
            ++KFDN+ L I Q+     +   L+  FGFL RRTD +Y         G +  +A K++ DAF+ H+   + S++ + + +K    + +    K+      + ++  ++ +L N+    +    DAE +                                NGA      W Q++ ++DIR  IP  V+    S+D+ V +++K+ISV        + +++  L  ++K  E  W+ +  +  I +S+EKV Q  WW  +   +  INT+K++  +  +SDLD E ++ + K+MYD RQK++GLPTS+ QK   +L+K
Sbjct:    6 DEKFDNILLDIIQRV--NTLPNFLDILFGFLRRRTDLYYIMDDKQSKLGFSPGKAEKLILDAFKKHKDIFESSLSNNCRAEKSILNQSQESDKKEIQIDSTVSNDNSKISKLEND----LIYVADAESY--------------------------------NGAIGENYTWSQTIGELDIRVKIPQAVS---NSKDLTVLVERKHISVIANIQNETKSVIDNDLCWEVKKNEVFWSFDRKESKILISIEKV-QERWWEALFIGESTINTRKIDC-SRPMSDLDDEAQAKIHKLMYDNRQKQLGLPTSDQQKMNSVLKK 280          
The following BLAST results are available for this feature:
BLAST of NudC nuclear distribution protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUDC8.185e-10652.92nuclear distribution C, dynein complex regulator [... [more]
NUDCD35.956e-1831.01NudC domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
NUDC1.356e-1540.65nuclear distribution C, dynein complex regulator [... [more]
NUDC1.446e-851.85nuclear distribution C, dynein complex regulator [... [more]
NUDCD22.225e-622.84NudC domain containing 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nud-13.508e-9246.06Aspergillus NUclear Division related; NUD-1 [Sour... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nudC2.631e-8444.07gene:FBgn0021768 transcript:FBtr0075328[more]
nudC2.631e-8444.07gene:FBgn0021768 transcript:FBtr0305912[more]
CG312512.852e-1232.86gene:FBgn0051251 transcript:FBtr0083484[more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nudc9.504e-10851.52nudC nuclear distribution protein [Source:ZFIN;Acc... [more]
nudcd31.249e-1831.82NudC domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
nudcd27.377e-626.45NudC domain containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
nudcd27.377e-626.45NudC domain containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
klf118.414e-10752.62Kruppel-like factor 11 [Source:Xenbase;Acc:XB-GENE... [more]
nudcd31.821e-1932.28NudC domain containing 3 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nudc2.021e-10652.45nudC nuclear distribution protein [Source:MGI Symb... [more]
Nudcd33.100e-1629.11NudC domain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Nudcd23.248e-622.93NudC domain containing 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of NudC nuclear distribution protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZIN1|NUDC_CHICK1.183e-10953.03Nuclear migration protein nudC OS=Gallus gallus OX... [more]
sp|Q63525|NUDC_RAT7.203e-10653.07Nuclear migration protein nudC OS=Rattus norvegicu... [more]
sp|O35685|NUDC_MOUSE1.414e-10552.45Nuclear migration protein nudC OS=Mus musculus OX=... [more]
sp|Q9Y266|NUDC_HUMAN3.931e-10552.92Nuclear migration protein nudC OS=Homo sapiens OX=... [more]
sp|Q17QG2|NUDC_BOVIN6.872e-10451.23Nuclear migration protein nudC OS=Bos taurus OX=99... [more]
back to top
BLAST of NudC nuclear distribution protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7AID31.212e-11155.42CS domain-containing protein OS=Arion vulgaris OX=... [more]
A0A091GHR49.597e-11053.19Nuclear migration protein nudC OS=Cuculus canorus ... [more]
A0A091VLZ12.079e-10953.19Nuclear migration protein nudC OS=Nipponia nippon ... [more]
U3IT872.615e-10952.12Nuclear distribution C, dynein complex regulator O... [more]
A0A1S3JUH03.407e-10956.13nuclear migration protein nudC OS=Lingula unguis O... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nudc1.703e-10050.15nuclear distribution C, dynein complex regulator [... [more]
nudc1.082e-9350.32nuclear distribution C, dynein complex regulator [... [more]
nudc3.594e-9250.16nuclear distribution C, dynein complex regulator [... [more]
nudcd32.865e-1833.33NudC domain containing 3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nudc1.348e-7444.12nudC nuclear distribution protein [Source:ZFIN;Acc... [more]
nudcd35.648e-1931.25NudC domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO467103.601e-7763.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380029.475e-2535.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293674.121e-2436.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nudc3.598e-10652.80nuclear distribution C, dynein complex regulator [... [more]
nudc3.749e-10550.45nuclear distribution C, dynein complex regulator [... [more]
back to top
BLAST of NudC nuclear distribution protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000036795.10.000e+099.69SMESG000036795.1[more]
SMESG000064942.16.884e-2327.36SMESG000064942.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001081 ID=SMED30001081|Name=NudC nuclear distribution protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1098bp
GATTAATTTTGTCGAACTGTATTTCTTGTTATGTCTAATGATAAATTTGA
TAACTTGTTTCTGAGTATTGCACAGCAATGTGAAGAAGGTGGTATTAAAG
AGCTTTTAAATTGTTTTTTTGGTTTTCTCGGTAGAAGAACGGACTTTTTT
TATGGAGTTGCAAAAGAGGAAGCATTTAAAGTCGTAACTGATGCCTTCGA
AGTTCATCAAAAACAATCAATTGCGAAACATAATAAAGAGAAAAAGGAAC
GAGAAGAGAAAGACAAATTAAAAAAATTAAAACAGGAATCGGAAATTAAA
AAAATTCAAGATAATGAACCTCGAGTTGTTGAATTAACAAATGAAGAAGC
TGAAAAAATGCAAGCAGAAATAGATGCTGAAAAACATAAAGATATGGAAG
TAGACATAAAACCTGAAGTCAAAGAAGAAGAGGATCATGATGAAGATCCT
AAAGATAAGGGTAAATTAAAACCTAACGAAGGAAATGGAGCTGATTTGCC
AGAATGTAAATGGGTTCAGTCTCTAAAAGATGTTGACATTCGTATACCAA
CAAAAGTAAATTTTCCAGTCAAGTCAAGAGATGTCATTGTAAATATTCAA
AAAAAATATATTAGTGTATCTCTAAAAGGACATCAGCCATTATTAGAAGG
AACATTGTATAACGATATTAAAGTTGAAGAGTCAACGTGGACCATAGAAG
ATGGAAAAGTCATTTATTTATCCCTTGAAAAAGTCAATCAAATGGAATGG
TGGAATAGAGTTACCGACAAACAACCAGAAATTAATACTAAAAAAGTTAA
TCCGGAGAACTCTAAGTTGTCCGATCTTGATGGCGAGACTAGAAGCATGG
TGGAGAAGATGATGTATGACCAACGGCAAAAGGAAATGGGATTACCTACA
TCCGAAGATCAAAAGAAGCAAGATTTGTTGCAAAAGTTTATGACCCAACA
TCCGGAAATGGATTTTTCAAAATGCAAATTTAATTAAATTTTAATATAAA
CTATTTCCAATTCTTTTGATACATAAGCATTTATTGCAGTTTGTAATGTA
TGAATTGTATTTTAGAATATTTATAACTATATATAATGCATATGATTA
back to top

protein sequence of SMED30001081-orf-1

>SMED30001081-orf-1 ID=SMED30001081-orf-1|Name=SMED30001081-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=319bp
MSNDKFDNLFLSIAQQCEEGGIKELLNCFFGFLGRRTDFFYGVAKEEAFK
VVTDAFEVHQKQSIAKHNKEKKEREEKDKLKKLKQESEIKKIQDNEPRVV
ELTNEEAEKMQAEIDAEKHKDMEVDIKPEVKEEEDHDEDPKDKGKLKPNE
GNGADLPECKWVQSLKDVDIRIPTKVNFPVKSRDVIVNIQKKYISVSLKG
HQPLLEGTLYNDIKVEESTWTIEDGKVIYLSLEKVNQMEWWNRVTDKQPE
INTKKVNPENSKLSDLDGETRSMVEKMMYDQRQKEMGLPTSEDQKKQDLL
QKFMTQHPEMDFSKCKFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0061371determination of heart left/right asymmetry
GO:0006457protein folding
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0032502developmental process
GO:0051301cell division
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000103central nervous system
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037898NudC_fam
IPR008978HSP20-like_chaperone
IPR025934NudC_N_dom
IPR007052CS_dom
IPR032572NuDC
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 66..93
NoneNo IPR availableCOILSCoilCoilcoord: 100..122
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 113..129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 113..155
NoneNo IPR availablePANTHERPTHR12356:SF3NUCLEAR MIGRATION PROTEIN NUDCcoord: 18..318
IPR032572Nuclear migration protein nudCPFAMPF16273NuDCcoord: 93..144
e-value: 3.3E-7
score: 30.7
IPR007052CS domainPFAMPF04969CScoord: 158..234
e-value: 1.1E-16
score: 61.6
IPR007052CS domainPROSITEPS51203CScoord: 154..245
score: 18.901
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 150..279
e-value: 3.2E-37
score: 129.4
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 152..279
IPR025934NudC N-terminal domainPFAMPF14050Nudc_Ncoord: 5..47
e-value: 5.6E-13
score: 48.7
IPR037898NudC familyPANTHERPTHR12356NUCLEAR MOVEMENT PROTEIN NUDCcoord: 18..318