Low density lipoprotein-receptor, class A,domain-containing protein

Overview
NameLow density lipoprotein-receptor, class A,domain-containing protein
Smed IDSMED30001071
Length (bp)765
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low density lipoprotein-receptor, class A,domain-containing protein (SMED30001071) t-SNE clustered cells

Violin plots show distribution of expression levels for Low density lipoprotein-receptor, class A,domain-containing protein (SMED30001071) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low density lipoprotein-receptor, class A,domain-containing protein (SMED30001071) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low density lipoprotein-receptor, class A,domain-containing protein (SMED30001071) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001071

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30001071SMESG000037863.1 SmedASXL_010583SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001071SMESG000037863.1 dd_Smed_v4_12756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001071SMESG000037863.1 dd_Smed_v4_12756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001071SMESG000037863.1 dd_Smed_v4_12756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30001071SMESG000037863.1 dd_Smed_v4_12756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30001071SMESG000037863.1 dd_Smed_v4_12756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001071SMESG000037863.1 dd_Smed_v6_12756_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30001071SMESG000038762.1 SMESG000037863.1 OX_Smed_1.0.12309ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30001071SMESG000037863.1 dd_Smed_v4_12756_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Human
Match: TMPRSS15 (transmembrane serine protease 15 [Source:HGNC Symbol;Acc:HGNC:9490])

HSP 1 Score: 48.9062 bits (115), Expect = 5.453e-6
Identity = 21/44 (47.73%), Postives = 26/44 (59.09%), Query Frame = 3
Query:  237 GNQCLEKTPW--PCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMC 362
            GN  +E  P   PC  +  C+  D  CDG+ +CPDG DED KMC
Sbjct:  178 GNVSIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMC 221          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Match: F58H1.7 (NMDA receptor auxiliary protein [Source:UniProtKB/TrEMBL;Acc:G5EEF9])

HSP 1 Score: 66.2402 bits (160), Expect = 4.099e-13
Identity = 39/133 (29.32%), Postives = 65/133 (48.87%), Query Frame = 3
Query:  261 PWPCKT-------SGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKY-----QDWLVPAY----------LGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIEL 593
            P PC T       SG C+ + ++CDG  DC D YDE+  MC A +RPP E  + F++       +D+LV  +          +G  D   +A  L ++PT + ++  M L+  +  +++ +ME +      EL
Sbjct:   34 PAPCPTWHPFACPSGECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLVKVFGPKAKAELSGMGGVD--KVAVALSQTPTADLFASEMKLDDGETQHMLEVMEGILNGSTDEL 164          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Match: F58H1.7 (NMDA receptor auxiliary protein [Source:UniProtKB/TrEMBL;Acc:G5EEF9])

HSP 1 Score: 64.6994 bits (156), Expect = 1.161e-12
Identity = 37/126 (29.37%), Postives = 64/126 (50.79%), Query Frame = 3
Query:  261 PWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKY-----QDWLVPAY----------LGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIEL 593
            P+ C  SG C+ + ++CDG  DC D YDE+  MC A +RPP E  + F++       +D+LV  +          +G  D   +A  L ++PT + ++  M L+  +  +++ +ME +      EL
Sbjct:   40 PFACP-SGECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLVKVFGPKAKAELSGMGGVD--KVAVALSQTPTADLFASEMKLDDGETQHMLEVMEGILNGSTDEL 162          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0083762)

HSP 1 Score: 72.7886 bits (177), Expect = 3.205e-15
Identity = 45/160 (28.12%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  243 QCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIE-----------------KYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             C    P+ C   G C+S+ ++CDG  DC DGYDED+++C A  RPP E    F++                 K +D L P  LG  +   +A  L ES TI ++   ++L +  + +L S+  AV       L   G+      ++     ++  +GF+
Sbjct:   63 ACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSP--LGGVEK--VAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0083763)

HSP 1 Score: 72.7886 bits (177), Expect = 3.205e-15
Identity = 45/160 (28.12%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  243 QCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIE-----------------KYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             C    P+ C   G C+S+ ++CDG  DC DGYDED+++C A  RPP E    F++                 K +D L P  LG  +   +A  L ES TI ++   ++L +  + +L S+  AV       L   G+      ++     ++  +GF+
Sbjct:   63 ACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSP--LGGVEK--VAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0330030)

HSP 1 Score: 73.1738 bits (178), Expect = 4.999e-15
Identity = 45/160 (28.12%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  243 QCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIE-----------------KYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             C    P+ C   G C+S+ ++CDG  DC DGYDED+++C A  RPP E    F++                 K +D L P  LG  +   +A  L ES TI ++   ++L +  + +L S+  AV       L   G+      ++     ++  +GF+
Sbjct:   63 ACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSP--LGGVEK--VAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Zebrafish
Match: lrp1ba (low density lipoprotein receptor-related protein 1Ba [Source:ZFIN;Acc:ZDB-GENE-050208-608])

HSP 1 Score: 47.7506 bits (112), Expect = 8.958e-6
Identity = 23/49 (46.94%), Postives = 29/49 (59.18%), Query Frame = 3
Query:  246 CLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDE---DVKMCIAKSRPP 383
            C  K  + CK SG C+S D+VCDGD DC D  DE   +V +C    +PP
Sbjct: 1071 CDPKAKFTCKVSGKCVSKDWVCDGDIDCEDQSDEEGCEVSVC----KPP 1115          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|A0A0F7YYX3|CPROH_CONVC (Neuropeptide prohormone-4 OS=Conus victoriae OX=319920 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.951e-16
Identity = 43/141 (30.50%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  246 CLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGF 668
            C   +P+ C+ S  CL L  VC+G +DC  G DED  +C A  RP   ++  F+E  +DW++P    +A+   +A  L E+ ++ +    +NL  + I N+ +            L+  GMP RAW E+  L   +   G 
Sbjct:   51 CDIASPFKCEESPTCLRLFQVCNGRWDCEHGSDEDNALCAAVLRPLECMIWEFLEGQRDWILPNLFNDANTDLVAHALHEAYSMGDLQSYLNLTDQNIENIRNSTRGAIVGDPRPLMALGMPDRAWPEVMYLLKELYNLGL 191          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|E2AX35|PROH4_CAMFO (IDLSRF-like peptide OS=Camponotus floridanus OX=104421 GN=EAG_01737 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.810e-15
Identity = 46/163 (28.22%), Postives = 75/163 (46.01%), Query Frame = 3
Query:  234 QGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIE-----------------KYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
            + + C    P+ C   G C+S+ ++CDG  DC DGYDED ++C A  RPP E    F++                 K +D L P  LG  +   +A  L ES TI ++   ++L +  + +L S+  AV       L   G+      ++     ++ K+GF+
Sbjct:   42 RSDACHPYEPFKCPGDGLCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETATFLQSLLASHGPNYLEKLFGNKARDTLKP--LGGVEK--VAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFL 200          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|P85831|PROH4_APIME (Prohormone-4 OS=Apis mellifera OX=7460 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.880e-14
Identity = 43/159 (27.04%), Postives = 70/159 (44.03%), Query Frame = 3
Query:  234 QGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGE-------------ADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             G+ C    P+ C     C+S+ ++CDG  DC DGYDED ++C A  RPP E    F++       P YL +                  +A  L ES TI ++   ++L +  + +L S+  AV       L   G+      ++     ++ K+GF+
Sbjct:   43 SGDACRPYEPFKCPGDDTCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETASFLQSLLASHGPNYLEKLFGTKARDTLKPLGGVNTVAIALSESQTIEDFGAALHLLRTDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFL 201          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A0R3U366 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS979 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 7.287e-57
Identity = 81/145 (55.86%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  237 GNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             N C E +PWPC++  +CLS DF+CDGD DCPDGYDED +MC AK RPP E L RFI++YQDWL+P +LGE +P  +AT+L+ESP+I +Y+K   L + Q+ NL SL+E V + +E++L++ GMP  AW+EL  LF RI +SGFV
Sbjct:    9 ANDCPESSPWPCRSPNFCLSFDFICDGDLDCPDGYDEDQEMCTAKQRPPIEYLYRFIKRYQDWLIPEFLGEGEPFDLATKLVESPSIEDYAKSARLAQHQLANLRSLIEGVVQRKEMQLVLLGMPLGAWSELFYLFDRIARSGFV 153          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A5K3F2A5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 9.663e-57
Identity = 81/145 (55.86%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  237 GNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             N C E +PWPC++  +CLS DF+CDGD DCPDGYDED +MC AK RPP E L RFI++YQDWL+P +LGE +P  +AT+L+ESP+I +Y+K   L + Q+ NL SL+E V + +E++L++ GMP  AW+EL  LF RI +SGFV
Sbjct:   41 ANDCPESSPWPCRSPNFCLSFDFICDGDLDCPDGYDEDQEMCTAKQRPPIEYLYRFIKRYQDWLIPEFLGEGEPFDLATKLVESPSIEDYAKSARLAQHQLANLRSLIEGVVQRKEMQLVLLGMPLGAWSELFYLFDRIARSGFV 185          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A0R3WBB8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7927 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.334e-56
Identity = 81/152 (53.29%), Postives = 112/152 (73.68%), Query Frame = 3
Query:  216 KSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
            K T +   N+C E +PWPC+  G+CLS DF+CDG+ DCPDGYDED +MC AK RPP E L RFI++YQDWL+P +LGE  P  +A +L+ESPTI +Y++  +L ++Q++NL SL+E V + +E+ +++ GMP  AW+EL  LF RI  SGFV
Sbjct:   35 KDTKKKIANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKERPPLEYLYRFIQRYQDWLIPTFLGEGTPLELAKKLVESPTIEDYARSAHLTEKQLINLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFV 186          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A068XY98 (Prohormone 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000443800 PE=4 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 1.442e-55
Identity = 79/145 (54.48%), Postives = 108/145 (74.48%), Query Frame = 3
Query:  237 GNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             N+C E +PWPC+  G+CLS DF+CDG+ DCPDGYDED +MC AK RPP E L RFI++YQDWL+P +LGE  P  +A +L+ESPTI +Y++  +L ++Q+ NL SL+E V + +E+ +++ GMP  AW+EL  LF RI  SGFV
Sbjct:   85 ANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKQRPPIEYLFRFIQRYQDWLIPTFLGEGTPLELAKKLVESPTIEDYARSAHLTEKQLFNLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFV 229          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: W6UW14 (Prohormone-4 OS=Echinococcus granulosus OX=6210 GN=EGR_02423 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.534e-55
Identity = 78/145 (53.79%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  237 GNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
             N+C E +PWPC+  G+CLS DF+CDG+ DCPDGYDED +MC AK RPP E L RFI++YQDWL+P +LG+  P  +A +L+ESPTI +Y++  +L ++Q++NL SL+E V + +E+ +++ GMP  AW+EL  LF RI  SGFV
Sbjct:   70 ANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKQRPPIEYLFRFIQRYQDWLIPTFLGKGTPLELAKKLVESPTIEDYARSAHLTEKQLVNLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFV 214          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000037863.1 (SMESG000037863.1)

HSP 1 Score: 426.787 bits (1096), Expect = 9.289e-154
Identity = 206/208 (99.04%), Postives = 207/208 (99.52%), Query Frame = 3
Query:   51 MISIHALFIWLLISEIEPINSYSYKYDQIYLRHNLLKRQKQIELDQNIEEKYRIRKSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFVQ 674
            MISIHALFIWLLISEIEPINSYSYKYDQ+YLRHNLLKRQKQIELDQNIEEKYRIRKSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSK MNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFVQ
Sbjct:    1 MISIHALFIWLLISEIEPINSYSYKYDQMYLRHNLLKRQKQIELDQNIEEKYRIRKSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKMMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFVQ 208          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000059509.1 (SMESG000059509.1)

HSP 1 Score: 203.756 bits (517), Expect = 6.439e-66
Identity = 103/181 (56.91%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  153 LLKRQKQIELDQNIEEKYR------IRKSTYE--FQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
            LL R +  EL +N  + YR      IR S  E  F GN C E  PWPCKT G CLS DF+CDG+ DC D YDED  +C AK+RPP+ IL +FI KY+DWL+P YLG   P  ++T LIES    EY K MN+  E+  N  SL+E+V+E R+IELI+FGMPPRAWNELSILFGRI KSGF+
Sbjct:   16 LLPRSRTNELREN--QIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 194          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000059509.1 (SMESG000059509.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.814e-65
Identity = 103/181 (56.91%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  153 LLKRQKQIELDQNIEEKYR------IRKSTYE--FQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 671
            LL R +  EL +N  + YR      IR S  E  F GN C E  PWPCKT G CLS DF+CDG+ DC D YDED  +C AK+RPP+ IL +FI KY+DWL+P YLG   P  ++T LIES    EY K MN+  E+  N  SL+E+V+E R+IELI+FGMPPRAWNELSILFGRI KSGF+
Sbjct:   88 LLPRSRTNELREN--QIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 266          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000021406.1 (SMESG000021406.1)

HSP 1 Score: 193.356 bits (490), Expect = 3.575e-62
Identity = 88/162 (54.32%), Postives = 116/162 (71.60%), Query Frame = 3
Query:  189 NIEEKYRIRKSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFVQ 674
            ++ E+ +  KS+    GN C E  PWPCKT G CLS DF+CDG+ DCPD YDED  +C AK+RPP+E+L +F+ KY+ WL+P YLG+     IAT LIES    EYS +M L ++Q  +L+ L+ AV+E R+IELI+ GMPPRAWNEL +LFGRI  SGF++
Sbjct:   20 SLAEESKTAKSS----GNGCPESQPWPCKTPGQCLSFDFICDGEPDCPDKYDEDQSLCTAKNRPPFEVLDKFLLKYESWLIPKYLGQGTHTQIATYLIESTNAEEYSNKMKLTQQQKKDLMDLLTAVKEGRQIELIMEGMPPRAWNELYLLFGRIASSGFLK 177          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000021406.1 (SMESG000021406.1)

HSP 1 Score: 192.971 bits (489), Expect = 4.649e-62
Identity = 88/162 (54.32%), Postives = 116/162 (71.60%), Query Frame = 3
Query:  189 NIEEKYRIRKSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFVQ 674
            ++ E+ +  KS+    GN C E  PWPCKT G CLS DF+CDG+ DCPD YDED  +C AK+RPP+E+L +F+ KY+ WL+P YLG+     IAT LIES    EYS +M L ++Q  +L+ L+ AV+E R+IELI+ GMPPRAWNEL +LFGRI  SGF++
Sbjct:   17 SLAEESKTAKSS----GNGCPESQPWPCKTPGQCLSFDFICDGEPDCPDKYDEDQSLCTAKNRPPFEVLDKFLLKYESWLIPKYLGQGTHTQIATYLIESTNAEEYSNKMKLTQQQKKDLMDLLTAVKEGRQIELIMEGMPPRAWNELYLLFGRIASSGFLK 174          
The following BLAST results are available for this feature:
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TMPRSS155.453e-647.73transmembrane serine protease 15 [Source:HGNC Symb... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F58H1.74.099e-1329.32NMDA receptor auxiliary protein [Source:UniProtKB... [more]
F58H1.71.161e-1229.37NMDA receptor auxiliary protein [Source:UniProtKB... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG312213.205e-1528.13gene:FBgn0051221 transcript:FBtr0083762[more]
CG312213.205e-1528.13gene:FBgn0051221 transcript:FBtr0083763[more]
CG312214.999e-1528.13gene:FBgn0051221 transcript:FBtr0330030[more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrp1ba8.958e-646.94low density lipoprotein receptor-related protein 1... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A0A0F7YYX3|CPROH_CONVC4.951e-1630.50Neuropeptide prohormone-4 OS=Conus victoriae OX=31... [more]
sp|E2AX35|PROH4_CAMFO6.810e-1528.22IDLSRF-like peptide OS=Camponotus floridanus OX=10... [more]
sp|P85831|PROH4_APIME1.880e-1427.04Prohormone-4 OS=Apis mellifera OX=7460 PE=1 SV=1[more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U3667.287e-5755.86Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F2A59.663e-5755.86Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3WBB83.334e-5653.29Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068XY981.442e-5554.48Prohormone 4 OS=Echinococcus multilocularis OX=621... [more]
W6UW141.534e-5553.79Prohormone-4 OS=Echinococcus granulosus OX=6210 GN... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037863.19.289e-15499.04SMESG000037863.1[more]
SMESG000059509.16.439e-6656.91SMESG000059509.1[more]
SMESG000059509.11.814e-6556.91SMESG000059509.1[more]
SMESG000021406.13.575e-6254.32SMESG000021406.1[more]
SMESG000021406.14.649e-6254.32SMESG000021406.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001071 ID=SMED30001071|Name=Low density lipoprotein-receptor, class A,domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=765bp
ATTTAGTTAAACAATGAATTATTTTGCATGAGCAATATATTTAGGACTTT
ATGATTTCAATTCACGCATTATTTATCTGGTTGCTGATCAGTGAAATTGA
ACCGATTAATTCATATTCGTACAAATACGATCAAATTTATCTAAGGCACA
ACTTGTTGAAAAGGCAAAAGCAAATAGAGCTTGATCAAAATATTGAGGAA
AAATATCGAATAAGAAAATCAACCTACGAATTTCAAGGCAATCAGTGTCT
AGAAAAGACTCCTTGGCCGTGCAAAACGTCAGGTTATTGTCTGTCACTGG
ATTTCGTATGTGACGGTGATTTCGATTGTCCAGATGGATATGATGAGGAT
GTAAAAATGTGCATTGCTAAAAGCCGTCCTCCGTATGAAATTCTTAAACG
ATTTATTGAAAAGTATCAAGACTGGCTCGTTCCGGCTTATTTAGGTGAAG
CAGATCCGGGTTACATAGCAACTCAATTAATTGAGAGTCCAACAATCAAT
GAATATTCAAAAAGGATGAATTTAAACAAGGAGCAGATTTTGAATTTAAT
TTCGTTAATGGAGGCAGTGAGAGAAGATCGGGAGATTGAACTGATCATAT
TTGGAATGCCTCCACGAGCGTGGAATGAGTTATCGATTTTATTTGGTAGA
ATTACTAAAAGTGGTTTTGTGCAGTGATGTAATCTATGAATCAATAATCA
AATTATTTCCGCGCAAATTTTATTTCTTCTGACTCAATCTTTGAAAAAAT
CAAAAGTTATGATCA
back to top

protein sequence of SMED30001071-orf-1

>SMED30001071-orf-1 ID=SMED30001071-orf-1|Name=SMED30001071-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
MISIHALFIWLLISEIEPINSYSYKYDQIYLRHNLLKRQKQIELDQNIEE
KYRIRKSTYEFQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDED
VKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTIN
EYSKRMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGR
ITKSGFVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR002172LDrepeatLR_classA_rpt
IPR023415LDLR_class-A_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 65..106
e-value: 3.0E-8
score: 43.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 65..105
score: 10.713
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 72..100
e-value: 2.43166E-7
score: 43.7346
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 59..119
e-value: 1.3E-8
score: 36.4
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 71..102
NoneNo IPR availablePANTHERPTHR20967UNCHARACTERIZEDcoord: 60..122
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.667
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 80..104