AcetylCoA_hyd_C domain-containing protein

Overview
NameAcetylCoA_hyd_C domain-containing protein
Smed IDSMED30001056
Length (bp)1720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AcetylCoA_hyd_C domain-containing protein (SMED30001056) t-SNE clustered cells

Violin plots show distribution of expression levels for AcetylCoA_hyd_C domain-containing protein (SMED30001056) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AcetylCoA_hyd_C domain-containing protein (SMED30001056) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AcetylCoA_hyd_C domain-containing protein (SMED30001056) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001056

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001056SMESG000063866.1 Contig4623uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001056SMESG000063866.1 Contig4623newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001056SMESG000072821.1 Contig4623uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001056SMESG000072821.1 Contig4623newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001056SMESG000063866.1 dd_Smed_v4_1775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001056SMESG000063866.1 dd_Smed_v4_1775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30001056SMESG000063866.1 dd_Smed_v4_1775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001056SMESG000063866.1 dd_Smed_v4_1775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30001056SMESG000063866.1 dd_Smed_v4_1775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30001056SMESG000063866.1 dd_Smed_v6_1775_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30001056SMESG000063866.1 dd_Smed_v4_1775_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Celegans
Match: acer-1 (ACEtyl-CoA Regulator [Source:UniProtKB/TrEMBL;Acc:Q18599])

HSP 1 Score: 505.753 bits (1301), Expect = 7.449e-176
Identity = 249/447 (55.70%), Postives = 322/447 (72.04%), Query Frame = 3
Query:  180 EPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHP--MELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            E   PI G+ PK     E       I++G  +++HG AATP+PL++   ++A    L  + +HH+H EG  P+         RSNSLFTG N RA +N+G AD+   FL E+PLLFR+  IKL+ +LIQV+PPD  GFCSLG SVD AR+A+ N+  IIA VN  MP T GD  +H+SHID +++     ELH+      +D+E KIG+IIA NL+ +G+TLQMGIG++PDA LS   +HK+LG+HTEMFSDG+L L++   ITNA K + PGK+V SFV G+ K + +L++NP ++  DV WVN+P  V +NPKV AINS +EID+TGQ+VSDS+G R  SGFGGQVDFIRGA I  D  GKPIIAL S +KKG SKIVP +++GAGVVT+RAHVHYVVTEYGIA L+GKN+RQRA+ LI I+HP  RESL+KAAF+RLK MP+AD
Sbjct:   28 EVAFPIAGKSPKVVSLAE---ATRDIKSGDNVFVHGIAATPTPLLQSLSEHAVANNLNKIKLHHLHLEGATPWTAEGVRDRIRSNSLFTGHNLRACVNNGIADFNSCFLYEVPLLFRKGAIKLNASLIQVSPPDAFGFCSLGTSVDTARAAVTNSPLIIAMVNKNMPRTFGDGVIHVSHIDYLVNEADGFELHQRNIGPQNDQEKKIGKIIAENLVDNGATLQMGIGAVPDAALSALSNHKDLGIHTEMFSDGVLDLIEKNAITNAKKAIHPGKLVVSFVYGSTKLYDYLNDNPLIEFGDVNWVNDPAVVRKNPKVTAINSAVEIDLTGQVVSDSVGKRFLSGFGGQVDFIRGAAIGNDGLGKPIIALPSISKKGQSKIVPTINEGAGVVTSRAHVHYVVTEYGIAQLWGKNMRQRAYELIKISHPSQRESLDKAAFDRLKVMPSAD 471          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Celegans
Match: acer-1 (ACEtyl-CoA Regulator [Source:UniProtKB/TrEMBL;Acc:Q18599])

HSP 1 Score: 505.753 bits (1301), Expect = 7.449e-176
Identity = 249/447 (55.70%), Postives = 322/447 (72.04%), Query Frame = 3
Query:  180 EPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHP--MELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            E   PI G+ PK     E       I++G  +++HG AATP+PL++   ++A    L  + +HH+H EG  P+         RSNSLFTG N RA +N+G AD+   FL E+PLLFR+  IKL+ +LIQV+PPD  GFCSLG SVD AR+A+ N+  IIA VN  MP T GD  +H+SHID +++     ELH+      +D+E KIG+IIA NL+ +G+TLQMGIG++PDA LS   +HK+LG+HTEMFSDG+L L++   ITNA K + PGK+V SFV G+ K + +L++NP ++  DV WVN+P  V +NPKV AINS +EID+TGQ+VSDS+G R  SGFGGQVDFIRGA I  D  GKPIIAL S +KKG SKIVP +++GAGVVT+RAHVHYVVTEYGIA L+GKN+RQRA+ LI I+HP  RESL+KAAF+RLK MP+AD
Sbjct:   28 EVAFPIAGKSPKVVSLAE---ATRDIKSGDNVFVHGIAATPTPLLQSLSEHAVANNLNKIKLHHLHLEGATPWTAEGVRDRIRSNSLFTGHNLRACVNNGIADFNSCFLYEVPLLFRKGAIKLNASLIQVSPPDAFGFCSLGTSVDTARAAVTNSPLIIAMVNKNMPRTFGDGVIHVSHIDYLVNEADGFELHQRNIGPQNDQEKKIGKIIAENLVDNGATLQMGIGAVPDAALSALSNHKDLGIHTEMFSDGVLDLIEKNAITNAKKAIHPGKLVVSFVYGSTKLYDYLNDNPLIEFGDVNWVNDPAVVRKNPKVTAINSAVEIDLTGQVVSDSVGKRFLSGFGGQVDFIRGAAIGNDGLGKPIIALPSISKKGQSKIVPTINEGAGVVTSRAHVHYVVTEYGIAQLWGKNMRQRAYELIKISHPSQRESLDKAAFDRLKVMPSAD 471          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Celegans
Match: ZK1320.9 (pep chromosome:WBcel235:II:9684088:9686713:-1 gene:WBGene00014258.1 transcript:ZK1320.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1320.9)

HSP 1 Score: 419.468 bits (1077), Expect = 6.063e-142
Identity = 225/476 (47.27%), Postives = 298/476 (62.61%), Query Frame = 3
Query:   93 LKKVLINRYVISNPSKLLSRTFYE-EGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMH--HPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGA--GICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTA 1505
            L K L    VIS     LSR F     L  +  H  PG  PK+   +E L     + +   IY+   A+ P+ L+E  C+      L N+ + H+   G  P  DP+Y G  ++NSLF     R  +N G ADYTPIFLSE+P L+    + +D ALI V+PPD  GFC+LG  +D   +A  +A+ IIA VN  MP TRG  +VH SH   M+    P+   +    ++S+ E +IG+IIA NL+ +G+TLQ+GIG+IPD+ L+    HK+LGVHTEMFSDG++ L+  G+I N  K   PGK VSSF  GTK+ +  +D NP        + N+   V RN K+ +INS IEID+TGQIVSDSIG   +SGFGGQVDF+  +  G    GK IIAL S T KG +KIVP+L QG+GVVTTRAH  Y+VTE+GIA L+GK++RQRA+ LI I+HP +RE+LEKAAF+R K MP+A
Sbjct:    5 LAKQLSKSSVIS-----LSRHFTNGPRLPTKLLHAKPGFVPKYVSADEALAM---VNSDSDIYVGNHASAPNVLLEALCRRVDSANLNNIRMSHLILSGNCPQFDPKYHGKIQNNSLFICPGNRKNVNLGAADYTPIFLSEVPSLYTSGTLNVDFALITVSPPDELGFCTLGVDIDTTLAAATSAKKIIALVNSTMPRTRGHTTVHSSHFAAMVQTDRPIAFRQSGGEEMSETEQRIGKIIAENLVDNGATLQLGIGAIPDSALAAMKQHKDLGVHTEMFSDGVIDLIDRGIINNQKKAFMPGKTVSSFAFGTKEFYKKIDNNPEFYFAPCDFTNHIDIVRRNSKMTSINSAIEIDLTGQIVSDSIGRNFFSGFGGQVDFMAASPHGFDGLGKAIIALPSRTTKGQTKIVPFLTQGSGVVTTRAHARYIVTEHGIANLWGKSIRQRAYELIQISHPDDREALEKAAFDRFKVMPSA 472          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Fly
Match: CG7920 (gene:FBgn0039737 transcript:FBtr0334706)

HSP 1 Score: 474.937 bits (1221), Expect = 2.009e-163
Identity = 230/418 (55.02%), Postives = 307/418 (73.44%), Query Frame = 3
Query:  255 IENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGA--GICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPT 1502
            +++G  ++  G AATP  L+    ++ K   L+ ++V H+HTEG   +  PEY+  FRSNS F GAN R A+  GR D  PIFL EIP LF ++I+K D++ I V+PPD HG+CSLG SVD  R+A+ N++ I+AQ+NPKMP T GDA +H SH D+ +    +L +    KIS+ E KIG++IA NL+ DG+TLQMGIGSIPDA L+   +HK+LG+H+EMF++G++ LV+ G +TN+ K +  G+IV SF+IG K  + F+D NPF++M  + +VNN   V + P++ AINSCIE+D+TGQ+ SDSIG R YSGFGGQVDFIRGA  G+   G PIIA+ S T KG+SKIVP L +GAGVVT+RAHVHYVVTE+GIA LFGKN+RQR + LI IA PK+RE+LEK AFER+K MP+
Sbjct:   58 VKSGDTVFAGGAAATPVALLNAMAKHGKSNNLECVTVCHMHTEGPGEYAKPEYKDHFRSNSFFMGANVRKAVADGRGDNVPIFLHEIPNLFYKQIVKPDVSFIHVSPPDNHGYCSLGTSVDCVRAALLNSKLIVAQINPKMPRTFGDAIIHKSHFDLAIEVTDDLPQHGTGKISEVEKKIGKLIAENLVKDGATLQMGIGSIPDAVLAALHNHKDLGIHSEMFANGVVELVRKGCVTNSKKKMHQGRIVGSFLIGDKALYDFVDNNPFIEMYAIDYVNNTSIVKQQPRMTAINSCIEVDLTGQVCSDSIGPRFYSGFGGQVDFIRGAAEGLDGLGVPIIAMPSTTNKGESKIVPTLKEGAGVVTSRAHVHYVVTEHGIASLFGKNVRQRMYELIQIADPKHRETLEKQAFERIKVMPS 475          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Fly
Match: CG7920 (gene:FBgn0039737 transcript:FBtr0085603)

HSP 1 Score: 474.937 bits (1221), Expect = 2.009e-163
Identity = 230/418 (55.02%), Postives = 307/418 (73.44%), Query Frame = 3
Query:  255 IENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGA--GICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPT 1502
            +++G  ++  G AATP  L+    ++ K   L+ ++V H+HTEG   +  PEY+  FRSNS F GAN R A+  GR D  PIFL EIP LF ++I+K D++ I V+PPD HG+CSLG SVD  R+A+ N++ I+AQ+NPKMP T GDA +H SH D+ +    +L +    KIS+ E KIG++IA NL+ DG+TLQMGIGSIPDA L+   +HK+LG+H+EMF++G++ LV+ G +TN+ K +  G+IV SF+IG K  + F+D NPF++M  + +VNN   V + P++ AINSCIE+D+TGQ+ SDSIG R YSGFGGQVDFIRGA  G+   G PIIA+ S T KG+SKIVP L +GAGVVT+RAHVHYVVTE+GIA LFGKN+RQR + LI IA PK+RE+LEK AFER+K MP+
Sbjct:   58 VKSGDTVFAGGAAATPVALLNAMAKHGKSNNLECVTVCHMHTEGPGEYAKPEYKDHFRSNSFFMGANVRKAVADGRGDNVPIFLHEIPNLFYKQIVKPDVSFIHVSPPDNHGYCSLGTSVDCVRAALLNSKLIVAQINPKMPRTFGDAIIHKSHFDLAIEVTDDLPQHGTGKISEVEKKIGKLIAENLVKDGATLQMGIGSIPDAVLAALHNHKDLGIHSEMFANGVVELVRKGCVTNSKKKMHQGRIVGSFLIGDKALYDFVDNNPFIEMYAIDYVNNTSIVKQQPRMTAINSCIEVDLTGQVCSDSIGPRFYSGFGGQVDFIRGAAEGLDGLGVPIIAMPSTTNKGESKIVPTLKEGAGVVTSRAHVHYVVTEHGIASLFGKNVRQRMYELIQIADPKHRETLEKQAFERIKVMPS 475          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. UniProt/SwissProt
Match: sp|P38942|CAT2_CLOK5 (4-hydroxybutyrate coenzyme A transferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) OX=431943 GN=cat2 PE=3 SV=3)

HSP 1 Score: 373.244 bits (957), Expect = 2.122e-123
Identity = 193/405 (47.65%), Postives = 263/405 (64.94%), Query Frame = 3
Query:  252 KIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGD-SKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESL 1463
            KIEN  ++        P  L+    +   +     L + H+   G   +     +  FR N+LF G   R A+NSGRADYTP F  E+P LF+ K + +D+ALIQV+ PD++G+CS G S D  + A ++A+ +IA+VN  MP T GD+ +H+S ID ++     L ELQ  K+ D E  IG+  A +LI DG+TLQ+GIG+IPDA L    + KNLG+H+EM SDG++ LV++GVI N  K L PGKIV +F++GTKK + F++ NP V+   V +VNNP+ + +N  + +INSC+++D+ GQ+ S+SIG +  SG GGQVDFIRGA +   GK IIA+ S   KG  S+I P L  GA V T+R  V YVVTEYG+A+L GK LR RA ALINIAHPK RESL
Sbjct:   20 KIENHSRVVFAHAVGEPVDLVNALVK--NKDNYIGLEIVHMVAMGKGEYTKEGMQRHFRHNALFVGGCTRDAVNSGRADYTPCFFYEVPSLFKEKRLPVDVALIQVSEPDKYGYCSFGVSNDYTKPAAESAKLVIAEVNKNMPRTLGDSFIHVSDIDYIVEASHPLLELQPPKLGDVEKAIGENCA-SLIEDGATLQLGIGAIPDAVLLFLKNKKNLGIHSEMISDGVMELVKAGVINNKKKTLHPGKIVVTFLMGTKKLYDFVNNNPMVETYSVDYVNNPLVIMKNDNMVSINSCVQVDLMGQVCSESIGLKQISGVGGQVDFIRGANLSKGGKAIIAIPSTAGKGKVSRITPLLDTGAAVTTSRNEVDYVVTEYGVAHLKGKTLRNRARALINIAHPKFRESL 421          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. UniProt/SwissProt
Match: sp|B0MC58|BCACT_ANACD (Butyryl-CoA:acetate CoA-transferase OS=Anaerostipes caccae (strain DSM 14662 / NCIMB 13811 / L1-92) OX=411490 GN=ANACAC_01149 PE=1 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.160e-66
Identity = 136/361 (37.67%), Postives = 204/361 (56.51%), Query Frame = 3
Query:  423 FRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRG--DASVHISHIDVMMH--HPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCM--DHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCS--ATKKGD--SKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAA 1475
            F  NS   G   R  I  G + Y PI  SE+P  +R  I  +D+A++QV P D HGF + GPS     + ++ A  +I +VN  MP   G  +  VHIS +D+++   +P           +D +  + ++I  + I +G+ LQ+GIG +P+A  S     D K+LGVHTEM+ D  + + ++G IT A KN+   +   +F  GTKK + +L++NP      V + N+   V+      +IN+ +++D+ GQI ++S G +  SG GGQ+DF+ GA +   GK  + L S    K G   S+I+P LH G+ V  TRA+ HY+VTEYG+A + G +  QRA ALINIAHP  R+ L K A
Sbjct:   76 FTWNSWHMGGLERKWIKEGFSYYAPIRYSELPGYYRNYIDHVDVAMMQVAPMDEHGFFNFGPSASHLAAMLEKADCVIVEVNENMPRCLGGFEEGVHISKVDMIVEGENPAIAELGGGGAATDVDKAVAKLIV-DQIPNGACLQLGIGGMPNAVGSMIAESDLKDLGVHTEMYVDAFVDIAKAGKITGARKNIDRYRQTYAFAAGTKKLYDYLNDNPECMSAPVNYTNDIARVSSIDNFISINNAVDVDLYGQISAESSGIKQISGAGGQLDFVMGAYLSNGGKSFVCLSSTFTDKAGQMHSRILPTLHNGSIVTDTRANAHYIVTEYGMANMKGLSAWQRAEALINIAHPDFRDQLIKDA 435          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0AVM5|BCT_SYNWW (Probable butyrate:acetyl-CoA coenzyme A-transferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) OX=335541 GN=Swol_1932 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.513e-61
Identity = 131/359 (36.49%), Postives = 205/359 (57.10%), Query Frame = 3
Query:  423 FRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRG--DASVHISHIDVMMHHPME-LHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDA--TLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATK-KGD--SKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAA 1475
            F  NS     + R  IN     Y P+   E P++ R+  +  ++A+IQ T  D+HG+ + G S     + ++ AR  I +VN KMP   G     +HIS +D ++    E +  + + + S  E+ + Q I   L +DG+ +Q+GIG  P+A  ++    D K+LGVHTEM+ D  L + ++G IT A K++   K V SF +G+++ + ++D+NP +    V + NNP  VA+     +IN+CIE+D+ GQ+ ++S+G+R  SG GGQ+DF+ GA    +G+  I L S  + KG+  S+I P L  GA V   R   H +VTE+GIA L G++  +RA  LI IAHP  ++ L K A
Sbjct:   78 FTWNSWHVAGHDRKFINKNLF-YIPMKFHENPMMTRKDCVPTNVAVIQCTAMDKHGYFNFGGSSVNCCAMMETARVTILEVNEKMPRCLGGNQECLHISQVDYIIQSKNEPIATIGSAEPSPVEIAMAQHIIERL-YDGNCIQLGIGGTPNAVGSMVAASDLKDLGVHTEMYVDAYLLMAKAGKITGARKSIDKYKQVYSFAMGSQELYDYIDDNPGLASYSVDYTNNPWVVAQIDDFVSINACIEVDLYGQVCAESVGTRHISGTGGQLDFVEGAYKSKNGQSFICLPSTIEIKGEVTSRIKPILTPGAIVTDPRTATHMMVTEFGIATLKGRSTWERAEELIKIAHPDFQDELVKEA 434          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. UniProt/SwissProt
Match: sp|G2SYC0|BCACT_ROSHA (Butyryl-CoA:acetate CoA-transferase OS=Roseburia hominis (strain DSM 16839 / NCIMB 14029 / A2-183) OX=585394 GN=RHOM_13820 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.694e-58
Identity = 132/361 (36.57%), Postives = 196/361 (54.29%), Query Frame = 3
Query:  423 FRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRG--DASVHISHIDVMMHHPME-LHELQAHK-ISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDA--TLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGD----SKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAA 1475
            F  NS       R  IN G A Y PI  SE+P  +R      D+A+ QV P D HG+ + GPS     +  + A+ II +VN  MP   G  +  +HIS +  ++      + EL A    +D +  + ++I    I +G+ LQ+GIG +P+A  +L    D K+LGVHTEM+ D  + + ++G I  + KN+   +   +F  GTKK + +LD+NP +    V + N+  +++      +IN+ ++ID+ GQ+ ++S G +  SG GGQ+DF+ GA +   GK  I L S  K  D    S+I P L  G+ V   R + HYVVTEYG   L G +  QRA ALI+IAHP  R+ L K A
Sbjct:   76 FCWNSWHMSGIERKMINRGVAYYCPIRYSELPRYYRELDCPDDVAMFQVAPMDAHGYFNFGPSASHLGAMCERAKHIIVEVNENMPRCLGGTECGIHISDVTYIVEGSNPPIGELGAGGPATDVDKAVAKLIVDE-IPNGACLQLGIGGMPNAVGSLIAESDLKDLGVHTEMYVDAFVDIAKAGKINGSKKNIDRYRQTYAFGAGTKKMYDYLDDNPELMSAPVDYTNDIRSISALDNFISINNAVDIDLYGQVNAESAGIKQISGAGGQLDFVLGAYLSKGGKSFICLSSTFKTKDGQVQSRIRPTLANGSIVTDARPNTHYVVTEYGKVNLKGLSTWQRAEALISIAHPDFRDDLIKEA 435          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. UniProt/SwissProt
Match: sp|P38946|CAT1_CLOK5 (Succinyl-CoA:coenzyme A transferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) OX=431943 GN=cat1 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.482e-17
Identity = 106/390 (27.18%), Postives = 179/390 (45.90%), Query Frame = 3
Query:  444 TGANCRAAINSGRADYTPIFLSEIPLLFRRKII-KLDLALIQVTPPDRHGFCSLGPSVDIARSA--IQNARSIIAQVNPKMPLT-RGDASVHISHIDVMMHHPMEL----------------HELQAHKISDEEMK---------IGQIIAHNLI-------HDGST------LQMGIGSIPDATLSQCMDH--KNLGVHTEMFSDGILPLVQSG---VITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSI-GSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGD-SKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALI-NIAHPKNRESL 1463
            T ++ R  IN G   Y  + LS +       +I K+D+A+I+       G   + PS  I  +A  ++NA  +I ++N   PL   G A ++    +     P+ +                 ++ A  +++ + K         + Q I+ NLI        +G        +Q G+GS+ +A L+   +   KNL  +TE+  D +L L++ G   V++  + +  P +++  F+    K   F  E   +   +++  NNP  +AR   V +IN+ +E+DI G + S  + GS++ +G GG  DF R A +      I    S  KKGD S IVP +     V  T   V  +VTE G+A L G + R++A A+I N  HP  ++ L
Sbjct:  132 TNSDMRKKINDGSIKYADMHLSHMAQYINYSVIPKVDIAIIEAVAITEEG--DIIPSTGIGNTATFVENADKVIVEINEAQPLELEGMADIYTLK-NPPRREPIPIVNAGNRIGTTYVTCGSEKICAIVMTNTQDKTRPLTEVSPVSQAISDNLIGFLNKEVEEGKLPKNLLPIQSGVGSVANAVLAGLCESNFKNLSCYTEVIQDSMLKLIKCGKADVVSGTSISPSP-EMLPEFI----KDINFFREKIVLRPQEIS--NNP-EIARRIGVISINTALEVDIYGNVNSTHVMGSKMMNGIGGSGDFARNAYLT-----IFTTESIAKKGDISSIVPMVSH---VDHTEHDVMVIVTEQGVADLRGLSPREKAVAIIENCVHPDYKDML 502          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. TrEMBL
Match: A0A068YM46 (Acetyl coenzyme A hydrolase transferase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001088400 PE=4 SV=1)

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 311/453 (68.65%), Postives = 378/453 (83.44%), Query Frame = 3
Query:  156 FYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            +Y EG ++EP+ PIP RFP+WA   E+ F +LK  +G ++++HGGAATPS L+++  QY   +G+K++ + HIHTEG FPF+DPE  G FR+NSLFTG+NCR AIN GRAD+TPIFLSEIPLLFRRK ++LDLA++ +TPPDRHGFCSLGPSVD+ RSAIQNA+ I+ QVNP MPLTRGDAS+H+S+I V+MH P  LHE +  KI+D E +IG+ IA  L+ DG+T+QMGIGSIPDA LSQ   H++LGVHTEMFSD ++ LV+ GVITN+ K +RPGKIV+SFVIGTKK F FLD NPFVDMCD+AWVN+PV +A+NP+  AINSCIE+D+TGQ+VSDSIGSR+YSG GGQVDFIRGA I  D  GKPIIAL S T KG+SKIVPYL +G G+VTTRAHVHY+VTEYGIAYLFG+NLRQRAHALI IAHP +RESLEKAAFERLK MP+ D
Sbjct:   57 YYIEG-AHEPFAPIPDRFPRWATSGEDAFSHLK--DGAKVFVHGGAATPSLLVKELHQYVMSRGIKDVQLLHIHTEGPFPFNDPECVGHFRTNSLFTGSNCRQAINEGRADFTPIFLSEIPLLFRRKHVELDLAIVSITPPDRHGFCSLGPSVDVTRSAIQNAKFIVGQVNPHMPLTRGDASIHVSNIGVLMHGPQPLHETKTRKITDVEQQIGKYIAEELVPDGATMQMGIGSIPDAVLSQLTSHQHLGVHTEMFSDRLVDLVKLGVITNSMKKMRPGKIVTSFVIGTKKCFDFLDNNPFVDMCDIAWVNSPVIIAQNPRPMAINSCIEVDLTGQVVSDSIGSRIYSGVGGQVDFIRGAAISTDGEGKPIIALPSVTAKGESKIVPYLKEGGGIVTTRAHVHYIVTEYGIAYLFGRNLRQRAHALIKIAHPDHRESLEKAAFERLKVMPSPD 506          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. TrEMBL
Match: A0A068WZM6 (Acetyl coenzyme A hydrolase transferase OS=Echinococcus granulosus OX=6210 GN=EgrG_001088400 PE=4 SV=1)

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 311/453 (68.65%), Postives = 379/453 (83.66%), Query Frame = 3
Query:  156 FYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            +Y EG ++EP+ PIP RFP+WA   E+ F +LK  +G ++++HGGAATPS L+++  QY   +G+K++ + HIHTEG FPF+DPE  G FR+NSLFTG+NCR AIN GRAD+TPIFLSEIPLLFRRK ++LDLA++ +TPPDRHGFCSLGPSVD+ RSAIQNA+ I+ QVNP MPLTRGDAS+H+S+I V+MH P  LHE +A KI+D E +IG+ IA  L+ DG+T+QMGIGSIPDA LSQ  +H++LGVHTEMFSD ++ LV+ GVITN+ K +RPGKIV+SFVIGTKK F FLD NPFVDMCD+AWVN+PV +A+NP+  AINSCIE+D+TGQ+VSDSIGSR+YSG GGQVDFIRGA I  D  GKPIIAL S T KG+SK VPYL +G G+VTTRAHVHY+VTEYGIAYLFG+NLRQRAHALI IAHP +RESLEKAAFERLK MP+ D
Sbjct:   57 YYIEG-AHEPFAPIPDRFPRWATSGEDAFSHLK--DGAKVFVHGGAATPSLLVKELHQYVMSRGIKDVQLLHIHTEGPFPFNDPECVGHFRTNSLFTGSNCRQAINEGRADFTPIFLSEIPLLFRRKHVELDLAIVSITPPDRHGFCSLGPSVDVTRSAIQNAKFIVGQVNPHMPLTRGDASIHVSNIGVLMHGPQPLHETKARKITDVEQQIGKYIAEELVPDGATMQMGIGSIPDAVLSQLTNHQHLGVHTEMFSDRLVDLVKLGVITNSMKKMRPGKIVTSFVIGTKKCFDFLDNNPFVDMCDIAWVNSPVIIAQNPRPMAINSCIEVDLTGQVVSDSIGSRIYSGVGGQVDFIRGAAISTDGEGKPIIALPSVTAKGESKFVPYLKEGGGIVTTRAHVHYIVTEYGIAYLFGRNLRQRAHALIKIAHPDHRESLEKAAFERLKVMPSPD 506          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. TrEMBL
Match: W6U576 (4-hydroxybutyrate coenzyme A transferase OS=Echinococcus granulosus OX=6210 GN=EGR_08830 PE=4 SV=1)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 311/453 (68.65%), Postives = 379/453 (83.66%), Query Frame = 3
Query:  156 FYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            +Y EG ++EP+ PIP RFP+WA   E+ F +LK  +G ++++HGGAATPS L+++  QY   +G+K++ + HIHTEG FPF+DPE  G FR+NSLFTG+NCR AIN GRAD+TPIFLSEIPLLFRRK ++LDLA++ +TPPDRHGFCSLGPSVD+ RSAIQNA+ I+ QVNP MPLTRGDAS+H+S+I V+MH P  LHE +A KI+D E +IG+ IA  L+ DG+T+QMGIGSIPDA LSQ  +H++LGVHTEMFSD ++ LV+ GVITN+ K +RPGKIV+SFVIGTKK F FLD NPFVDMCD+AWVN+PV +A+NP+  AINSCIE+D+TGQ+VSDSIGSR+YSG GGQVDFIRGA I  D  GKPIIAL S T KG+SK VPYL +G G+VTTRAHVHY+VTEYGIAYLFG+NLRQRAHALI IAHP +RESLEKAAFERLK MP+ D
Sbjct:   34 YYIEG-AHEPFAPIPDRFPRWATSGEDAFSHLK--DGAKVFVHGGAATPSLLVKELHQYVMSRGIKDVQLLHIHTEGPFPFNDPECVGHFRTNSLFTGSNCRQAINEGRADFTPIFLSEIPLLFRRKHVELDLAIVSITPPDRHGFCSLGPSVDVTRSAIQNAKFIVGQVNPHMPLTRGDASIHVSNIGVLMHGPQPLHETKARKITDVEQQIGKYIAEELVPDGATMQMGIGSIPDAVLSQLTNHQHLGVHTEMFSDRLVDLVKLGVITNSMKKMRPGKIVTSFVIGTKKCFDFLDNNPFVDMCDIAWVNSPVIIAQNPRPMAINSCIEVDLTGQVVSDSIGSRIYSGVGGQVDFIRGAAISTDGEGKPIIALPSVTAKGESKFVPYLKEGGGIVTTRAHVHYIVTEYGIAYLFGRNLRQRAHALIKIAHPDHRESLEKAAFERLKVMPSPD 483          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. TrEMBL
Match: A0A3P7FT36 (AcetylCoA_hyd_C domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS10676 PE=4 SV=1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 309/453 (68.21%), Postives = 381/453 (84.11%), Query Frame = 3
Query:  156 FYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            +Y EG S+EP+ PIP RFP+WA   E+ F +LK  +G ++++HGGAATPS L+++  QY   +G+K++ + HIHTEG FPF+DPE  G FR+NSLFTG+NCR AIN GRAD+TPIFLSEIPLLFRRK ++LDLA++ +TPPDRHGFCSLGPSVD+ RSAIQNA+ I+ QVNP MPLTRGDAS+H+S+I V+MH P  LHE +A KI++ E +IG+ IA  L+ DG+T+QMGIGSIPDA LSQ  +H++LGVHTEMFSD ++ LV+ GVITN+ K +RPGKIV+SFVIGTKK F FLD NPFVDMCD+AWVN+PV +A+NP+  AINSCIE+D+TGQ+VSDSIGSR+YSG GGQVDFIRGA I  D  GKPIIAL S T KG+SKIVP+L +G G+VTTRAHVHY+VTE+GIAYLFG+NLRQRA+ALINIAHP +RE+LEKAAFERLK MP+ D
Sbjct:   68 YYVEG-SHEPFAPIPDRFPRWATSGEDAFSHLK--DGAKVFVHGGAATPSLLVKELHQYVMSRGIKDVQLFHIHTEGPFPFNDPECAGHFRTNSLFTGSNCRQAINEGRADFTPIFLSEIPLLFRRKHVELDLAIVSITPPDRHGFCSLGPSVDVTRSAIQNAKFIVGQVNPHMPLTRGDASIHVSNIGVLMHGPQPLHETKARKITEVEQRIGKYIAEELVPDGATMQMGIGSIPDAVLSQLTNHQHLGVHTEMFSDRLVDLVKLGVITNSMKKMRPGKIVTSFVIGTKKCFDFLDNNPFVDMCDIAWVNSPVIIAQNPRPMAINSCIEVDLTGQVVSDSIGSRIYSGVGGQVDFIRGAAISTDGEGKPIIALPSVTSKGESKIVPFLKEGGGIVTTRAHVHYIVTEFGIAYLFGRNLRQRAYALINIAHPDHREALEKAAFERLKVMPSPD 517          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. TrEMBL
Match: A0A0R3XAW6 (AcetylCoA_hyd_C domain-containing protein OS=Hydatigena taeniaeformis OX=6205 PE=4 SV=1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 309/453 (68.21%), Postives = 381/453 (84.11%), Query Frame = 3
Query:  156 FYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            +Y EG S+EP+ PIP RFP+WA   E+ F +LK  +G ++++HGGAATPS L+++  QY   +G+K++ + HIHTEG FPF+DPE  G FR+NSLFTG+NCR AIN GRAD+TPIFLSEIPLLFRRK ++LDLA++ +TPPDRHGFCSLGPSVD+ RSAIQNA+ I+ QVNP MPLTRGDAS+H+S+I V+MH P  LHE +A KI++ E +IG+ IA  L+ DG+T+QMGIGSIPDA LSQ  +H++LGVHTEMFSD ++ LV+ GVITN+ K +RPGKIV+SFVIGTKK F FLD NPFVDMCD+AWVN+PV +A+NP+  AINSCIE+D+TGQ+VSDSIGSR+YSG GGQVDFIRGA I  D  GKPIIAL S T KG+SKIVP+L +G G+VTTRAHVHY+VTE+GIAYLFG+NLRQRA+ALINIAHP +RE+LEKAAFERLK MP+ D
Sbjct:   68 YYVEG-SHEPFAPIPDRFPRWATSGEDAFSHLK--DGAKVFVHGGAATPSLLVKELHQYVMSRGIKDVQLFHIHTEGPFPFNDPECAGHFRTNSLFTGSNCRQAINEGRADFTPIFLSEIPLLFRRKHVELDLAIVSITPPDRHGFCSLGPSVDVTRSAIQNAKFIVGQVNPHMPLTRGDASIHVSNIGVLMHGPQPLHETKARKITEVEQRIGKYIAEELVPDGATMQMGIGSIPDAVLSQLTNHQHLGVHTEMFSDRLVDLVKLGVITNSMKKMRPGKIVTSFVIGTKKCFDFLDNNPFVDMCDIAWVNSPVIIAQNPRPMAINSCIEVDLTGQVVSDSIGSRIYSGVGGQVDFIRGAAISTDGEGKPIIALPSVTSKGESKIVPFLKEGGGIVTTRAHVHYIVTEFGIAYLFGRNLRQRAYALINIAHPDHREALEKAAFERLKVMPSPD 517          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Yeast
Match: ACH1 (Protein with CoA transferase activity; particularly for CoASH transfer from succinyl-CoA to acetate; has minor acetyl-CoA-hydrolase activity; phosphorylated; required for acetate utilization and for diploid pseudohyphal growth [Source:SGD;Acc:S000000111])

HSP 1 Score: 68.5514 bits (166), Expect = 1.132e-12
Identity = 67/209 (32.06%), Postives = 98/209 (46.89%), Query Frame = 3
Query:  837 LQMGIGSIPDATLSQCM--DHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWV--NNPVNVARNPKVCAINSCIEIDITGQIVSDSI-GSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALIN-IAHP 1445
            LQ GIG+I +A +        K+L V TE+  D  L L ++G +  A         V     G  +AF    EN    +C  + V  NNP  + R   V A+N+ +E+DI     S ++ GSR+ +G GG  DF+R A +     P          G S IVP     + V  T   +  +VT+ G+A L G + ++RA  +IN  AHP
Sbjct:  274 LQSGIGNIANAVIEGLAGAQFKHLTVWTEVLQDSFLDLFENGSLDYAT-----ATSVRLTEKGFDRAFANW-ENFKHRLCLRSQVVSNNP-EMIRRLGVIAMNTPVEVDIYAHANSTNVNGSRMLNGLGGSADFLRNAKLSIMHAPSARPTKVDPTGISTIVP---MASHVDQTEHDLDILVTDQGLADLRGLSPKERAREIINKCAHP 472          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Nematostella
Match: EDO31214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYK6])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 274/456 (60.09%), Postives = 348/456 (76.32%), Query Frame = 3
Query:  147 SRTFYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPD--GKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            +R +Y    S+EP+HP+PGR P W    E +     I++G ++++H  AATP PL+E   ++ K+  L+N+ V HIH EG       EYEGIFR NS F GANCR AIN GRAD TPIFLSEIPL+F R +I+LD+ALIQV+PPD+HGFC+LGPSVD+ R+A+QNA+ II  VNP+ P T+G   +H SH+DV+      L E +    S+++ KIG+ IA NL+ DG+TLQMGIGSIPD  L++ MDHK+LG+H+EMFSDG++ LV+ G +TNA K + PG+IV SFVIGTKK F F+D NPFV M DV +VN     ++NPK+ AINSCIE+D+TGQ+VSDSIG+R+YSG GGQVDF+RGA +  D  GKPI+AL S T KG+SKIVP++ QGAGVVTTRAHVHYVVTEYGIA LFGKNLRQRA+ LI I+HPK+RE LEKA+F+RLKCMP+ D
Sbjct:   38 NRPYYT--YSSEPFHPLPGRTPAWKSPEEAV---QVIKSGMKVFVHSAAATPIPLVEAMAKWGKKANLQNVEVIHIHIEGNAEHTKEEYEGIFRDNSFFIGANCRKAINDGRADCTPIFLSEIPLVFHRNLIELDVALIQVSPPDKHGFCTLGPSVDVTRAALQNAKYIIGLVNPQCPRTQGPGGIHQSHLDVLCVADFPLPEHKTGVPSEQDRKIGKYIAENLVADGATLQMGIGSIPDCCLAELMDHKDLGIHSEMFSDGVVDLVERGAVTNAKKKILPGRIVGSFVIGTKKVFEFIDNNPFVVMLDVGFVNLVAISSQNPKMTAINSCIEVDLTGQVVSDSIGTRMYSGVGGQVDFLRGAALGYDGLGKPILALNSTTSKGESKIVPFIKQGAGVVTTRAHVHYVVTEYGIAQLFGKNLRQRAYELIRISHPKHREELEKASFDRLKCMPSPD 488          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Nematostella
Match: EDO29714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2V1])

HSP 1 Score: 332.798 bits (852), Expect = 9.925e-111
Identity = 159/310 (51.29%), Postives = 234/310 (75.48%), Query Frame = 3
Query:  558 LIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMM--HHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFE 1481
             I V+PPD+HG+CSLG SV+   +AI+N+++IIAQVNP+MP T GD  +H+S ID M+  + P+  HE+     ++ E KIG+ +A +LI D STLQMGIG+IP+A LS+  +HKNLG+HTEMFSDG++ L++  VI    K    G+ +++F+IG+++ + F+++NPFV++ + + VN+   + +NPK+ AINS IE+D+TGQ+ +DSIG ++YSG GGQ+DF+RGA +   GK IIAL S TK+G+S+IVPYL QGAGVVTTR+HV Y++TE GIA L+GK L++R   ++ IAHP ++E++E+  FE
Sbjct:    1 FIHVSPPDKHGYCSLGVSVEATIAAIENSKTIIAQVNPQMPRTFGDGILHVSEIDYMVEVNVPIFCHEVAP--FTEVEGKIGEYVA-SLIDDKSTLQMGIGNIPNAALSKLTNHKNLGLHTEMFSDGVIDLIEKNVIDCNYKGTVRGRALATFLIGSQRLYDFVNDNPFVELRESSMVNDTAMIRKNPKMVAINSAIEVDVTGQVCADSIGGKMYSGVGGQMDFMRGASLSEGGKAIIALPSVTKRGESRIVPYLKQGAGVVTTRSHVQYIITENGIADLYGKTLKKRIDEMVKIAHPNHQETIERQYFE 307          
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Planmine SMEST
Match: SMESG000063866.1 (SMESG000063866.1)

HSP 1 Score: 981.86 bits (2537), Expect = 0.000e+0
Identity = 473/473 (100.00%), Postives = 473/473 (100.00%), Query Frame = 3
Query:   90 MLKKVLINRYVISNPSKLLSRTFYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 1508
            MLKKVLINRYVISNPSKLLSRTFYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD
Sbjct:    1 MLKKVLINRYVISNPSKLLSRTFYEEGLSNEPYHPIPGRFPKWADENENLFQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGTFPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKIIKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTRGDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTLQMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRPGKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSCIEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKKGDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIAHPKNRESLEKAAFERLKCMPTAD 473          
The following BLAST results are available for this feature:
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
acer-17.449e-17655.70ACEtyl-CoA Regulator [Source:UniProtKB/TrEMBL;Acc... [more]
acer-17.449e-17655.70ACEtyl-CoA Regulator [Source:UniProtKB/TrEMBL;Acc... [more]
ZK1320.96.063e-14247.27pep chromosome:WBcel235:II:9684088:9686713:-1 gene... [more]
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG79202.009e-16355.02gene:FBgn0039737 transcript:FBtr0334706[more]
CG79202.009e-16355.02gene:FBgn0039737 transcript:FBtr0085603[more]
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38942|CAT2_CLOK52.122e-12347.654-hydroxybutyrate coenzyme A transferase OS=Clostr... [more]
sp|B0MC58|BCACT_ANACD1.160e-6637.67Butyryl-CoA:acetate CoA-transferase OS=Anaerostipe... [more]
sp|Q0AVM5|BCT_SYNWW1.513e-6136.49Probable butyrate:acetyl-CoA coenzyme A-transferas... [more]
sp|G2SYC0|BCACT_ROSHA2.694e-5836.57Butyryl-CoA:acetate CoA-transferase OS=Roseburia h... [more]
sp|P38946|CAT1_CLOK51.482e-1727.18Succinyl-CoA:coenzyme A transferase OS=Clostridium... [more]
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YM460.000e+068.65Acetyl coenzyme A hydrolase transferase OS=Echinoc... [more]
A0A068WZM60.000e+068.65Acetyl coenzyme A hydrolase transferase OS=Echinoc... [more]
W6U5760.000e+068.654-hydroxybutyrate coenzyme A transferase OS=Echino... [more]
A0A3P7FT360.000e+068.21AcetylCoA_hyd_C domain-containing protein OS=Hydat... [more]
A0A0R3XAW60.000e+068.21AcetylCoA_hyd_C domain-containing protein OS=Hydat... [more]
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ACH11.132e-1232.06Protein with CoA transferase activity; particularl... [more]
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO312140.000e+060.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297149.925e-11151.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AcetylCoA_hyd_C domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000063866.10.000e+0100.00SMESG000063866.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001056 ID=SMED30001056|Name=AcetylCoA_hyd_C domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1720bp
ATCTTAACTTGAATTCAATATTTTGATTATTGTTCGTGTATCACGTTTAA
AATATATAATTTAATTTAATACTCTAAACGAGAAATTAAATGCTAAAGAA
AGTTTTAATTAATCGTTACGTCATATCCAATCCATCTAAATTATTAAGTC
GCACATTTTACGAAGAAGGCTTATCAAATGAACCATATCATCCAATTCCT
GGTAGATTTCCGAAGTGGGCTGATGAAAATGAAAATTTGTTTCAAAATTT
AAAAATTGAAAATGGAGGGCAAATTTATTTGCACGGAGGAGCAGCAACTC
CTTCGCCACTAATTGAAAAGTTTTGTCAATACGCTAAAGAAAAAGGTTTA
AAAAATTTGAGTGTGCATCACATACACACAGAAGGAACTTTTCCTTTCCA
CGATCCAGAATATGAAGGAATTTTCCGATCAAATTCACTATTTACTGGAG
CAAACTGTCGAGCTGCAATCAACTCGGGTAGAGCTGATTATACACCAATA
TTTCTTAGTGAAATTCCGCTGTTGTTTAGAAGAAAAATTATCAAATTAGA
TTTAGCACTTATTCAGGTAACACCTCCAGACAGGCATGGGTTTTGTTCAC
TTGGACCTAGTGTTGACATAGCAAGATCAGCTATTCAAAATGCAAGAAGC
ATTATCGCACAAGTCAATCCTAAAATGCCTTTAACAAGAGGTGATGCAAG
TGTGCATATCAGTCATATAGATGTGATGATGCATCATCCAATGGAATTAC
ACGAATTGCAGGCACATAAAATTTCAGATGAAGAAATGAAGATTGGACAA
ATTATTGCTCATAATTTGATTCATGATGGTTCGACATTACAAATGGGAAT
CGGATCGATTCCCGATGCAACTCTGTCTCAATGCATGGATCACAAGAATT
TAGGAGTTCATACAGAAATGTTTTCCGATGGAATATTACCATTGGTTCAA
AGTGGTGTTATTACTAATGCTAATAAAAACCTTCGACCAGGGAAAATTGT
TTCTAGTTTCGTAATCGGTACCAAGAAGGCATTTACATTTCTTGATGAAA
ATCCGTTTGTTGATATGTGTGATGTGGCATGGGTCAATAATCCTGTCAAC
GTTGCCCGTAATCCAAAGGTATGTGCTATAAATTCATGCATTGAGATTGA
TATTACTGGCCAAATTGTTTCCGATTCAATCGGATCAAGAGTTTATTCCG
GTTTTGGAGGTCAAGTAGACTTTATTCGAGGTGCAGGTATTTGCCCCGAT
GGTAAGCCAATTATTGCATTGTGCTCAGCCACAAAGAAAGGAGATTCAAA
AATAGTCCCATATCTCCACCAGGGGGCTGGAGTAGTCACAACCAGAGCCC
ATGTTCATTATGTGGTTACCGAGTATGGTATTGCCTACTTATTCGGTAAA
AACCTGCGACAAAGAGCACATGCTTTGATCAATATAGCCCATCCTAAAAA
TAGGGAATCTTTAGAAAAGGCAGCATTCGAACGATTAAAATGCATGCCAA
CTGCTGATTAGAAACGAGATTGGCTTACTTTGCTTTGATATTTCTCATTA
TATCTTATTACTTTCGTGATTATTTTCTTTTTAGTAGGATTTCGATTGAA
TTTATTTCGCTTTGCAGAATATTATTTGTAAATTTTATCTCCAACGAAAT
AGATCTGCCCTATTCACATATATATATAGCAGTGTTATAATACATTGAAT
ATATTTCAATTTAAAGTAGA
back to top

protein sequence of SMED30001056-orf-1

>SMED30001056-orf-1 ID=SMED30001056-orf-1|Name=SMED30001056-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MLKKVLINRYVISNPSKLLSRTFYEEGLSNEPYHPIPGRFPKWADENENL
FQNLKIENGGQIYLHGGAATPSPLIEKFCQYAKEKGLKNLSVHHIHTEGT
FPFHDPEYEGIFRSNSLFTGANCRAAINSGRADYTPIFLSEIPLLFRRKI
IKLDLALIQVTPPDRHGFCSLGPSVDIARSAIQNARSIIAQVNPKMPLTR
GDASVHISHIDVMMHHPMELHELQAHKISDEEMKIGQIIAHNLIHDGSTL
QMGIGSIPDATLSQCMDHKNLGVHTEMFSDGILPLVQSGVITNANKNLRP
GKIVSSFVIGTKKAFTFLDENPFVDMCDVAWVNNPVNVARNPKVCAINSC
IEIDITGQIVSDSIGSRVYSGFGGQVDFIRGAGICPDGKPIIALCSATKK
GDSKIVPYLHQGAGVVTTRAHVHYVVTEYGIAYLFGKNLRQRAHALINIA
HPKNRESLEKAAFERLKCMPTAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003986acetyl-CoA hydrolase activity
GO:0008775acetate CoA-transferase activity
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006083acetate metabolic process
GO:0019679propionate metabolic process, methylcitrate cycle
GO:0006084acetyl-CoA metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038460AcetylCoA_hyd_C_sf
IPR037171NagB/RpiA_transferase-like
IPR026888AcetylCoA_hyd_C
IPR003702ActCoA_hydro
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.1080.10coord: 53..220
e-value: 6.4E-60
score: 203.7
NoneNo IPR availableGENE3DG3DSA:3.30.750.70coord: 222..327
e-value: 1.5E-40
score: 139.2
NoneNo IPR availablePANTHERPTHR21432ACETYL-COA HYDROLASE-RELATEDcoord: 26..473
NoneNo IPR availablePANTHERPTHR21432:SF20ACETYL-COA REGULATORcoord: 26..473
IPR003702Acetyl-CoA hydrolase/transferasePFAMPF02550AcetylCoA_hydrocoord: 50..217
e-value: 6.4E-20
score: 72.0
IPR026888Acetyl-CoA hydrolase/transferase C-terminal domainPFAMPF13336AcetylCoA_hyd_Ccoord: 310..462
e-value: 5.7E-59
score: 198.5
IPR038460Acetyl-CoA hydrolase/transferase, C-terminal domain superfamilyGENE3DG3DSA:3.40.1080.20coord: 328..471
e-value: 9.9E-61
score: 205.8
IPR037171NagB/RpiA transferase-likeSUPERFAMILYSSF100950NagB/RpiA/CoA transferase-likecoord: 56..260
IPR037171NagB/RpiA transferase-likeSUPERFAMILYSSF100950NagB/RpiA/CoA transferase-likecoord: 227..469