Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30001049
Length (bp)2732
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001049

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30001049SMESG000038532.1 SMESG000038497.1 SMESG000036102.1 SMESG000036067.1 SMESG000036060.1 Contig92newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001049SMESG000038532.1 SMESG000038497.1 SMESG000036102.1 SMESG000036067.1 SMESG000036060.1 Contig92uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001049SMESG000031127.1 Contig92newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30001049SMESG000031127.1 Contig92uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30001049SMESG000038532.1 SMESG000038519.1 SMESG000038510.1 SMESG000036103.1 SMESG000036102.1 SMESG000036062.1 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001049SMESG000038532.1 SMESG000038519.1 SMESG000038510.1 SMESG000036103.1 SMESG000036102.1 SMESG000036062.1 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001049SMESG000038532.1 SMESG000038519.1 SMESG000038510.1 SMESG000036103.1 SMESG000036102.1 SMESG000036062.1 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30001049SMESG000038532.1 SMESG000038519.1 SMESG000038510.1 SMESG000036103.1 SMESG000036102.1 SMESG000036062.1 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001049SMESG000038532.1 SMESG000038519.1 SMESG000038510.1 SMESG000036103.1 SMESG000036102.1 SMESG000036062.1 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30001049SMESG000036112.1 SMESG000036067.1 dd_Smed_v4_9156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30001049SMESG000036112.1 SMESG000036067.1 dd_Smed_v4_9156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001049SMESG000036112.1 SMESG000036067.1 dd_Smed_v4_9156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001049SMESG000038532.1 SMESG000038519.1 SMESG000038510.1 SMESG000036103.1 SMESG000036102.1 SMESG000036062.1 dd_Smed_v4_8017_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0077346)

HSP 1 Score: 38.891 bits (89), Expect = 9.646e-6
Identity = 38/158 (24.05%), Postives = 68/158 (43.04%), Query Frame = 2
Query: 2300 STIRLDEIINGFLQESPVEMDDKRDC-KCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLK-------------YKLISVIDHIGDTLGGHYYAKSCFE--TDQWWMLNDSTVYRISGDEKIATENTIVFLFKK 2725
            S  +L+  ++ F++E  ++ D+   C KC        S T     P+YL I+L R S  +    +NI       + FP  D+ L              Y L ++ +H+G T GGHY A  C    + +W   ND+ V     +  + + +  +  +++
Sbjct:  707 SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSETRWSKLSNI-------VEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVAL-CKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 855          

HSP 2 Score: 30.8018 bits (68), Expect = 9.646e-6
Identity = 36/167 (21.56%), Postives = 69/167 (41.32%), Query Frame = 1
Query: 1804 IGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYF---------IESSSGDDVLKCFMTVL-TILSNVTKVKILNRNNSIQ-YINPEVSFENFKNQNYGFVFKSFYGQMALRLVCVHC 2271
             G  N     F+N VIQ L    E    L  +H   S++T          D+  ++ F+KL++E+   N   +  +  E+++ F                + L+ F+  L + L++  K + LN ++++      ++++E +       V   F GQ+   L C  C
Sbjct:  531 CGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLST---------KDQQILHEFAKLIQEMWTANVHTVTPM--ELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTC 686          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0077348)

HSP 1 Score: 38.891 bits (89), Expect = 9.646e-6
Identity = 38/158 (24.05%), Postives = 68/158 (43.04%), Query Frame = 2
Query: 2300 STIRLDEIINGFLQESPVEMDDKRDC-KCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLK-------------YKLISVIDHIGDTLGGHYYAKSCFE--TDQWWMLNDSTVYRISGDEKIATENTIVFLFKK 2725
            S  +L+  ++ F++E  ++ D+   C KC        S T     P+YL I+L R S  +    +NI       + FP  D+ L              Y L ++ +H+G T GGHY A  C    + +W   ND+ V     +  + + +  +  +++
Sbjct:  707 SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSETRWSKLSNI-------VEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVAL-CKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 855          

HSP 2 Score: 30.8018 bits (68), Expect = 9.646e-6
Identity = 36/167 (21.56%), Postives = 69/167 (41.32%), Query Frame = 1
Query: 1804 IGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYF---------IESSSGDDVLKCFMTVL-TILSNVTKVKILNRNNSIQ-YINPEVSFENFKNQNYGFVFKSFYGQMALRLVCVHC 2271
             G  N     F+N VIQ L    E    L  +H   S++T          D+  ++ F+KL++E+   N   +  +  E+++ F                + L+ F+  L + L++  K + LN ++++      ++++E +       V   F GQ+   L C  C
Sbjct:  531 CGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLST---------KDQQILHEFAKLIQEMWTANVHTVTPM--ELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTC 686          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0077347)

HSP 1 Score: 38.891 bits (89), Expect = 9.646e-6
Identity = 38/158 (24.05%), Postives = 68/158 (43.04%), Query Frame = 2
Query: 2300 STIRLDEIINGFLQESPVEMDDKRDC-KCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLK-------------YKLISVIDHIGDTLGGHYYAKSCFE--TDQWWMLNDSTVYRISGDEKIATENTIVFLFKK 2725
            S  +L+  ++ F++E  ++ D+   C KC        S T     P+YL I+L R S  +    +NI       + FP  D+ L              Y L ++ +H+G T GGHY A  C    + +W   ND+ V     +  + + +  +  +++
Sbjct:  707 SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSETRWSKLSNI-------VEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVAL-CKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 855          

HSP 2 Score: 30.8018 bits (68), Expect = 9.646e-6
Identity = 36/167 (21.56%), Postives = 69/167 (41.32%), Query Frame = 1
Query: 1804 IGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYF---------IESSSGDDVLKCFMTVL-TILSNVTKVKILNRNNSIQ-YINPEVSFENFKNQNYGFVFKSFYGQMALRLVCVHC 2271
             G  N     F+N VIQ L    E    L  +H   S++T          D+  ++ F+KL++E+   N   +  +  E+++ F                + L+ F+  L + L++  K + LN ++++      ++++E +       V   F GQ+   L C  C
Sbjct:  531 CGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLST---------KDQQILHEFAKLIQEMWTANVHTVTPM--ELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTC 686          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp2a (ubiquitin specific peptidase 2a [Source:ZFIN;Acc:ZDB-GENE-041212-59])

HSP 1 Score: 50.0618 bits (118), Expect = 8.425e-6
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query: 2306 IRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLK-----------YKLISVIDHIGDTLGGHYYAKSC-FETDQWWMLNDSTVYRISGDEKIATENTIVF 2713
            + L + +  F +E  ++ D+K  C                  P+ L ++L R  F +  ++ +   T    +NFPMKD  L+           Y L +V +H G T+GGHY A  C  E  +W+  NDS V  +S  +  +++  ++F
Sbjct:  246 VSLMDCMRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTVQKFPKILVLHLKR--FSEARIRTSKLST---FVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPENGEWYTYNDSRVTPMSASQVRSSDAYVLF 388          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9C585|UBP8_ARATH (Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana OX=3702 GN=UBP8 PE=2 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 9.108e-7
Identity = 49/178 (27.53%), Postives = 79/178 (44.38%), Query Frame = 2
Query: 2237 VKWLSVWFVCIANIL*IQETRSTIRLDEIIN------GFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGS---FYKNGLKNNI-----HVTCGQVLNFPMKDTSLKYKLISVIDHIGDTLGGHYYAKSCFETDQWWMLNDSTVYRISGDEKIATENTIVFLFKKF 2728
            VK L V+  C+ + L       T R  E ++       FL E P+  DD   C         +   +   +P+ L I+L R S   F KN L+  +     ++     +++    T+ +Y L ++ +H G   GGHY A      D+W+  +DS V++IS  EKI T    V  +K+ 
Sbjct:  693 VKELDVYDTCLLSSLPEVSKSGTKRPQESVSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMKNKLEAYVDFPLDNLDLSSYISYKNGQTTYRYMLYAISNHYGSMGGGHYTAYVHHGGDRWYDFDDSHVHQIS-QEKIKTSAAYVLFYKRL 869          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103025848])

HSP 1 Score: 50.447 bits (119), Expect = 1.555e-6
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query: 2306 IRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLK-----------YKLISVIDHIGDTLGGHYYAKSC-FETDQWWMLNDSTVYRISGDEKIATENTIVF 2713
            + L + +  F +E  ++ D+K  C                  P+ L ++L R  F +  ++++   T    +NFPMKD  L+           Y L +V +H G T+GGHY A  C   T +W+  NDS V  +S  +  +++  ++F
Sbjct:  420 VSLMDCVRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTIQRFPKILVLHLKR--FSEARVRSSKLST---FVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPATGEWYTYNDSRVTPMSSSQVRSSDAYVLF 562          

HSP 2 Score: 22.3274 bits (46), Expect = 1.555e-6
Identity = 7/16 (43.75%), Postives = 8/16 (50.00%), Query Frame = 1
Query: 2230 FYGQMALRLVCVHCKY 2277
            F GQ+   L C  C Y
Sbjct:  382 FVGQLKSSLTCTECGY 397          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103025848])

HSP 1 Score: 50.8322 bits (120), Expect = 1.934e-6
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 2
Query: 2306 IRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLK-----------YKLISVIDHIGDTLGGHYYAKSC-FETDQWWMLNDSTVYRISGDEKIATENTIVF 2713
            + L + +  F +E  ++ D+K  C                  P+ L ++L R  F +  ++++   T    +NFPMKD  L+           Y L +V +H G T+GGHY A  C   T +W+  NDS V  +S  +  +++  ++F
Sbjct:  247 VSLMDCVRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTIQRFPKILVLHLKR--FSEARVRSSKLST---FVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPATGEWYTYNDSRVTPMSSSQVRSSDAYVLF 389          

HSP 2 Score: 21.557 bits (44), Expect = 1.934e-6
Identity = 7/16 (43.75%), Postives = 8/16 (50.00%), Query Frame = 1
Query: 2230 FYGQMALRLVCVHCKY 2277
            F GQ+   L C  C Y
Sbjct:  210 FVGQLKSSLTCTECGY 225          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp21 (ubiquitin carboxyl-terminal hydrolase 21-like [Source:NCBI gene;Acc:103044797])

HSP 1 Score: 50.8322 bits (120), Expect = 4.731e-6
Identity = 39/153 (25.49%), Postives = 70/153 (45.75%), Query Frame = 2
Query: 2291 ETRSTIRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYK-NGLKNNIHVTCGQVLNFPMKDTSLK-----------YKLISVIDHIGDTLGGHYYAKSCFETDQWWMLNDSTVYRISGDEKIATENTIVF 2713
            + R+ + L E ++ F QE  +E ++   C+  N              P+ L I+LNR +  + +  K+ + V+      FP+ D  L            Y L ++ +H+G    GHY A +C E + W   NDS V +I  D+  +++  ++F
Sbjct:  248 DPRTGVTLRECLDLFSQEEKLEQENSPMCERCNRRTESTKRLSIQRFPRILVIHLNRFTMTRFSFCKSTVPVS------FPLTDLDLGPFGPVDCGPVLYDLYALCNHVGTVNMGHYTA-ACQEEEGWCCYNDSCVTQIPEDQLQSSQAYVLF 393          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: ENSORLT00000043987.1 (uncharacterized LOC105356426 [Source:NCBI gene;Acc:105356426])

HSP 1 Score: 48.1358 bits (113), Expect = 4.079e-6
Identity = 41/142 (28.87%), Postives = 64/142 (45.07%), Query Frame = 2
Query: 2312 LDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSF---YKNGLKNNIHVTCGQVLNFPMKDTSLKYKLISVIDHIGDTLGGHYYAKSCFETD-QWWMLNDSTVYRISG--DEKIATENTIVFLF 2719
            +D  I+ F + S    +D+  C+  +  ++  +     H P+ L + L R  F   Y   +K N  V     L  P       Y+L +V+DH GD  GGHY ++   + D +W+  ND+ V +I    D  I   NT   LF
Sbjct:  148 VDYGISEFFKASFFTGEDQMYCEHCDTKVDACTKYVVKHHPEVLILLLKRFDFSYKYMTYMKINNAVDVPTFLEIPENQA---YELYAVVDHFGDLRGGHYCSRIRSQVDSRWYEFNDTWVTQIDNNVDSDIKRSNTAFLLF 286          

HSP 2 Score: 23.0978 bits (48), Expect = 4.079e-6
Identity = 9/24 (37.50%), Postives = 14/24 (58.33%), Query Frame = 1
Query: 2218 VFKSFYGQMALRLVCVHCKYSVNT 2289
            V K F+G++  R +C  CK   +T
Sbjct:  104 VAKIFHGELTNRRICSSCKTETDT 127          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: ENSORLT00000042924.1 (uncharacterized LOC105356426 [Source:NCBI gene;Acc:105356426])

HSP 1 Score: 48.1358 bits (113), Expect = 4.307e-6
Identity = 41/144 (28.47%), Postives = 65/144 (45.14%), Query Frame = 2
Query: 2312 LDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSF---YKNGLKNNIHVTCGQVLNFPMKDTSLKYKLISVIDHIGDTLGGHYYAKSCFETD-QWWMLNDSTVYRISG--DEKIATENTIVFLFKK 2725
            +D  I+ F + S    +D+  C+  +  ++  +     H P+ L + L R  F   Y   +K N  V     L  P       Y+L +V+DH GD  GGHY ++   + D +W+  ND+ V +I    D  I   NT   LF +
Sbjct:  148 VDYGISEFFKASFFTGEDQMYCEHCDTKVDACTKYVVKHHPEVLILLLKRFDFSYKYMTYMKINNAVDVPTFLEIPENQA---YELYAVVDHFGDLRGGHYCSRIRSQVDSRWYEFNDTWVTQIDNNVDSDIKRSNTAFLLFYR 288          

HSP 2 Score: 22.7126 bits (47), Expect = 4.307e-6
Identity = 9/24 (37.50%), Postives = 14/24 (58.33%), Query Frame = 1
Query: 2218 VFKSFYGQMALRLVCVHCKYSVNT 2289
            V K F+G++  R +C  CK   +T
Sbjct:  104 VAKIFHGELTNRRICSSCKTETDT 127          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000038532.1 (SMESG000038532.1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 429/733 (58.53%), Postives = 494/733 (67.39%), Query Frame = 1
Query:  229 IYKDKYENVSKLIKQLENEISQIKLKIE---------------------IKLNKSEDQCKSLQ-------SXXXXXXXXXXXXXXXXXXXXQILLTYYNELKGKIIQSNEKEKHFQNICNQLQQEINYWRSKLIDLDKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNEN-------NQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNE----KGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQILQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKRDKKEIQSP-------LNSRINTKKIHSKANEKSNYPHESNQTKFEAPIKINYSEDHNKRLMKENDNLERIESNRIGRSRSNLEVERRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINPEVSFENFKNQNYGFVFKSFYGQMALRLVCVHCKYSVNT 2289
            I +++  N  +LIKQL+NE  ++K KIE                      +LN+S ++CKSLQ       S  L+        IKEIN E QIL   Y+E K +  QSN +++  Q            W++++ +L    KY+K     LQ++  +L                 K L+K++ KEN   +  Y K   EN       ++YLA+I +L+S  +ES+RTN RLQ   D  K+K     ERN +LESAN  KSQM+RNR  N AELI QL+NE    K K   I KD + +++N NRS++ LK +       C++LQ+ ND ++S +                            +E+D+  QI                             LQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKR+KKE+ S        LNSRIN+KKIHSKANEKSN+PHESNQTKFEAPIKINYSEDHNKR MKENDN+ RIESN IGRS SNLEV+RRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGF FLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEI+NRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYIN EVSFENFKNQN GFVF+SFYGQMALRLVCVHCKYSVNT
Sbjct:  428 INRNQCTNCEELIKQLQNENERVKSKIEEITKDFQLKMEDSNSTIEKLKSELNQSVNKCKSLQNENDNDKSKFLEQNRKFESIIKEINEERQILQNKYDECKLRFNQSNHEKQILQ------------WQTEMKNL--TTKYVK-----LQSERDNL-----------------KLLVKEIDKENKILQNNYNKSGEENENLKFQCDKYLAEINKLESVLKESDRTNSRLQQEFDA-KSK---HSERNSQLESANLFKSQMDRNRFENNAELIKQLENEKEIDKKKVEEITKDFQLKMENSNRSIEKLKLE-------CRNLQNANDQLESTI----------------------------KEIDKGKQI-----------------------------LQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKREKKEMPSTLIMENNRLNSRINSKKIHSKANEKSNFPHESNQTKFEAPIKINYSEDHNKRFMKENDNVVRIESNSIGRSMSNLEVKRRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGFCFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEINNRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINSEVSFENFKNQNNGFVFRSFYGQMALRLVCVHCKYSVNT 1056          

HSP 2 Score: 196.438 bits (498), Expect = 2.962e-51
Identity = 91/104 (87.50%), Postives = 97/104 (93.27%), Query Frame = 2
Query: 2258 FVCIANIL*IQETRSTIRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLKYKLISV 2569
            F  +A  L + ETRSTIRLDEIINGFLQESPVEMDDKR+CKCP+GSLNFLSITEYTHMP+YLHIYLNRGSFYKNGLKNN HVTCGQVLNFPMKDTSLKYKLIS+
Sbjct: 1061 FKSVA--LPVPETRSTIRLDEIINGFLQESPVEMDDKRNCKCPDGSLNFLSITEYTHMPRYLHIYLNRGSFYKNGLKNNTHVTCGQVLNFPMKDTSLKYKLISL 1162          

HSP 3 Score: 94.3597 bits (233), Expect = 2.720e-19
Identity = 94/282 (33.33%), Postives = 133/282 (47.16%), Query Frame = 1
Query:  553 DKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENS-----QFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYD-------------ERYLRENKKLESTIKEIDKGKQILQKKYDDVKRHS 1344
            ++KN  L++   D +AK K       +SQ+  +QLE + E+   L+ ENS     +   + K LQNE NQYLAQI +L+S  +ES+  N RLQ + D  K KL  SQ RN +LESAN  + Q+  N+CANCAE   QLQN+K K                                     +END  KSQ   +           +E II         ++++E  QIL  NY+             ++YL E  KLES +KE D+  + LQ++ D   +HS
Sbjct:  193 ERKNGRLQEELDDCKAKLK-------LSQERNSQLENENEIFI-LEMENSNNSNEKLRSECKILQNETNQYLAQINQLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNQCANCAESTRQLQNQKSK-------------------------------------NENDSNKSQFSGQI--------GKLELII---------KQINEERQILQSNYNKSGEENENLKFQHDKYLAEINKLESMLKESDRTNRRLQQEIDAKSKHS 412          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000038532.1 (SMESG000038532.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 420/733 (57.30%), Postives = 485/733 (66.17%), Query Frame = 1
Query:  229 IYKDKYENVSKLIKQLENEISQIKLKIE---------------------IKLNKSEDQCKSLQ-------SXXXXXXXXXXXXXXXXXXXXQILLTYYNELKGKIIQSNEKEKHFQNICNQLQQEINYWRSKLIDLDKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNEN-------NQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNE----KGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQILQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKRDKKEIQSP-------LNSRINTKKIHSKANEKSNYPHESNQTKFEAPIKINYSEDHNKRLMKENDNLERIESNRIGRSRSNLEVERRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINPEVSFENFKNQNYGFVFKSFYGQMALRLVCVHCKYSVNT 2289
            I +++  N  +LIKQL+NE  ++K KIE                      +LN+S ++CKSLQ       S  L+        IKEIN E QIL   Y+E K +  QSN +++  Q            W++++ +L    KY+K     LQ++  +L                 K L+K++ KEN   +  Y K   EN       ++YLA+I +L+S  +ES+RTN RLQ   D       +  ERN +LESAN  KSQM+RNR  N AELI QL+NE    K K   I KD + +++N NRS++ LK +       C++LQ+ ND ++S +                            +E+D+  QI                             LQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKR+KKE+ S        LNSRIN+KKIHSKANEKSN+PHESNQTKFEAPIKINYSEDHNKR MKENDN+ RIESN IGRS SNLEV+RRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGF        QLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEI+NRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYIN EVSFENFKNQN GFVF+SFYGQMALRLVCVHCKYSVNT
Sbjct:  428 INRNQCTNCEELIKQLQNENERVKSKIEEITKDFQLKMEDSNSTIEKLKSELNQSVNKCKSLQNENDNDKSKFLEQNRKFESIIKEINEERQILQNKYDECKLRFNQSNHEKQILQ------------WQTEMKNL--TTKYVK-----LQSERDNL-----------------KLLVKEIDKENKILQNNYNKSGEENENLKFQCDKYLAEINKLESVLKESDRTNSRLQQEFDAKS----KHSERNSQLESANLFKSQMDRNRFENNAELIKQLENEKEIDKKKVEEITKDFQLKMENSNRSIEKLKLE-------CRNLQNANDQLESTI----------------------------KEIDKGKQI-----------------------------LQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKREKKEMPSTLIMENNRLNSRINSKKIHSKANEKSNFPHESNQTKFEAPIKINYSEDHNKRFMKENDNVVRIESNSIGRSMSNLEVKRRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGF--------QLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEINNRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINSEVSFENFKNQNNGFVFRSFYGQMALRLVCVHCKYSVNT 1048          

HSP 2 Score: 196.823 bits (499), Expect = 2.198e-51
Identity = 91/104 (87.50%), Postives = 97/104 (93.27%), Query Frame = 2
Query: 2258 FVCIANIL*IQETRSTIRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLKYKLISV 2569
            F  +A  L + ETRSTIRLDEIINGFLQESPVEMDDKR+CKCP+GSLNFLSITEYTHMP+YLHIYLNRGSFYKNGLKNN HVTCGQVLNFPMKDTSLKYKLIS+
Sbjct: 1053 FKSVA--LPVPETRSTIRLDEIINGFLQESPVEMDDKRNCKCPDGSLNFLSITEYTHMPRYLHIYLNRGSFYKNGLKNNTHVTCGQVLNFPMKDTSLKYKLISL 1154          

HSP 3 Score: 93.9745 bits (232), Expect = 2.902e-19
Identity = 94/282 (33.33%), Postives = 133/282 (47.16%), Query Frame = 1
Query:  553 DKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENS-----QFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYD-------------ERYLRENKKLESTIKEIDKGKQILQKKYDDVKRHS 1344
            ++KN  L++   D +AK K       +SQ+  +QLE + E+   L+ ENS     +   + K LQNE NQYLAQI +L+S  +ES+  N RLQ + D  K KL  SQ RN +LESAN  + Q+  N+CANCAE   QLQN+K K                                     +END  KSQ   +           +E II         ++++E  QIL  NY+             ++YL E  KLES +KE D+  + LQ++ D   +HS
Sbjct:  193 ERKNGRLQEELDDCKAKLK-------LSQERNSQLENENEIFI-LEMENSNNSNEKLRSECKILQNETNQYLAQINQLQSALKESKGINGRLQQDFDDCKVKLNHSQRRNSQLESANQYEHQIGTNQCANCAESTRQLQNQKSK-------------------------------------NENDSNKSQFSGQI--------GKLELII---------KQINEERQILQSNYNKSGEENENLKFQHDKYLAEINKLESMLKESDRTNRRLQQEIDAKSKHS 412          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036067.1 (SMESG000036067.1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 381/408 (93.38%), Postives = 391/408 (95.83%), Query Frame = 1
Query:  112 MRSIIMKNRFQSLKTNSLRLIENRSQSSAYIVPKRTDSFIYKDKYENVSKLIKQLENEISQIKLKIEIKLNKSEDQCKSLQSXXXXXXXXXXXXXXXXXXXXQILLTYYNELKGKIIQSNEKEKHFQNICNQLQQEINYWRSKLIDLDKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQILQKKYDDVK 1335
            MRSIIMKNRFQS KTNS RLIENRSQSSAYIVPKRTDSFIYKDKYENV KLIKQLENEISQIKLKIEIKLNKSEDQCKSLQSNNLKILENIIIKIKEINAENQI LTYYNELK KIIQSNEKEKHFQNI NQ  QEI+ +RSKLIDLDKKNKYL QICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESAN LKSQMERNRC NCAELINQLQNEKGKT RIAKDCE+QLDNLNRSVKNLKSQLN+MGNKCKDLQDENDHIKS+LESRKNCDSPTKNAN+EQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEI+K  +ILQ KY++ K
Sbjct:    1 MRSIIMKNRFQSPKTNSSRLIENRSQSSAYIVPKRTDSFIYKDKYENVFKLIKQLENEISQIKLKIEIKLNKSEDQCKSLQSNNLKILENIIIKIKEINAENQIFLTYYNELKEKIIQSNEKEKHFQNIFNQSHQEIDDYRSKLIDLDKKNKYLNQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANRLKSQMERNRCVNCAELINQLQNEKGKTNRIAKDCEFQLDNLNRSVKNLKSQLNKMGNKCKDLQDENDHIKSELESRKNCDSPTKNANIEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIEKKNKILQNKYEEYK 408          

HSP 2 Score: 108.612 bits (270), Expect = 7.594e-24
Identity = 143/522 (27.39%), Postives = 244/522 (46.74%), Query Frame = 1
Query:  616 QNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNEN-------NQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQILQKKYDDVK---RHS----IQPERDLVRLQQSVEELRNELEYWKSKSNGNPQ------NRNDEFQAQIKRDKKEIQSPLNSRINTKKIHSKANE--------KSNYPHES-NQTKFEAPIKINYSEDHNKRLMKENDNLE-RIESNRIGRSRSNLEVERRDRRSFGSES----NMSNVTPYNYQNN--NILRDPIGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYFIESSSG 2073
            QNL S  QK  ++ +  K L+K++  +N   +  Y K + EN       ++YLA+I +L+S  +ES  TN+RL  + D  K +L+RS+ERN +LE                     N+++    K   IAK  + Q+ + N S + LK +L Q  NK + LQ++N++I+S+                EQI                                ++L+S +KE D+    LQ+ ++D K   +HS    +Q E +LV  ++++EE+  + +     SN + +      NR++     ++ +   I+S   S+I  +++  K NE        ++NY     NQ++ +   KIN  ++ N++L   N++ E +++ N+    +S L  E+        +S    N + +    Y+ N   I   PIGF NPKG+ +LNCVIQ L SC +FK D+ +        +D S      DD IFV     L+  + N +   ++E ++ IQ+Y  ESS G
Sbjct:  419 QNLTSEYQKLLSERDNLKFLVKEIDDKNKILQNNYNKSEEENENLKFQRDKYLAEINKLESVLKESYTTNRRLHKDCDDCKAELQRSEERNSQLE---------------------NEIEVNNRKNKEIAKYFQMQIKDSNYSNERLKLELKQSENKFQSLQNDNNNIESRF--------------AEQI--------------------------------EQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLENELVVNKRTIEEITEDFQLKMEDSNSSNEKMLLELNRSEYKFKSLQIENNNIKSGFASQI--EQLELKMNEINEENKILQNNYSQSKLNQSEID---KINLQKE-NEKLKSSNNHAECKLKFNQSETEKSILIAEKSPESQLFIDSTKAANTNEIGALEYKKNIPVIPVPPIGFNNPKGYCYLNCVIQVLASCDDFKKDIEK--------SDCSECFDGTDDSIFVKGLFDLIHALRNSDFNSVKESLNIIQQYITESSFG 859          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036067.1 (SMESG000036067.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 381/408 (93.38%), Postives = 391/408 (95.83%), Query Frame = 1
Query:  112 MRSIIMKNRFQSLKTNSLRLIENRSQSSAYIVPKRTDSFIYKDKYENVSKLIKQLENEISQIKLKIEIKLNKSEDQCKSLQSXXXXXXXXXXXXXXXXXXXXQILLTYYNELKGKIIQSNEKEKHFQNICNQLQQEINYWRSKLIDLDKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQILQKKYDDVK 1335
            MRSIIMKNRFQS KTNS RLIENRSQSSAYIVPKRTDSFIYKDKYENV KLIKQLENEISQIKLKIEIKLNKSEDQCKSLQSNNLKILENIIIKIKEINAENQI LTYYNELK KIIQSNEKEKHFQNI NQ  QEI+ +RSKLIDLDKKNKYL QICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESAN LKSQMERNRC NCAELINQLQNEKGKT RIAKDCE+QLDNLNRSVKNLKSQLN+MGNKCKDLQDENDHIKS+LESRKNCDSPTKNAN+EQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEI+K  +ILQ KY++ K
Sbjct:    1 MRSIIMKNRFQSPKTNSSRLIENRSQSSAYIVPKRTDSFIYKDKYENVFKLIKQLENEISQIKLKIEIKLNKSEDQCKSLQSNNLKILENIIIKIKEINAENQIFLTYYNELKEKIIQSNEKEKHFQNIFNQSHQEIDDYRSKLIDLDKKNKYLNQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANRLKSQMERNRCVNCAELINQLQNEKGKTNRIAKDCEFQLDNLNRSVKNLKSQLNKMGNKCKDLQDENDHIKSELESRKNCDSPTKNANIEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIEKKNKILQNKYEEYK 408          

HSP 2 Score: 99.7525 bits (247), Expect = 3.998e-21
Identity = 146/547 (26.69%), Postives = 247/547 (45.16%), Query Frame = 1
Query:  616 QNLESISQKSRNQLEYQKELIKQLQKENSQFEGKYKKLQNEN-------NQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQILQKKYDDVK---RHS----IQPERDLVRLQQSVEELRNELEYWKSKSNGNPQ------NRNDEFQAQIKRDKKEIQSPLNSRINTKKIHSKANE--------KSNYPHES-NQTKFEAPIKINYSEDHNKRLMKENDNLE-RIESNRIGRSRSNLEVERRDRRSFGSES----NMSNVTPYNYQNN--NILRDPIGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKY--FIESSSGDDVLKCFMTVLTILSNVTKVKIL 2142
            QNL S  QK  ++ +  K L+K++  +N   +  Y K + EN       ++YLA+I +L+S  +ES  TN+RL  + D  K +L+RS+ERN +LE                     N+++    K   IAK  + Q+ + N S + LK +L Q  NK + LQ++N++I+S+                EQI                                ++L+S +KE D+    LQ+ ++D K   +HS    +Q E +LV  ++++EE+  + +     SN + +      NR++     ++ +   I+S   S+I  +++  K NE        ++NY     NQ++ +   KIN  ++ N++L   N++ E +++ N+    +S L  E+        +S    N + +    Y+ N   I   PIGF NPKG+ +LNCVIQ L SC +FK D+ +        +D S      DD IFV + + L          K   L +   +Y  FI       + KC    + IL + T +K L
Sbjct:  419 QNLTSEYQKLLSERDNLKFLVKEIDDKNKILQNNYNKSEEENENLKFQRDKYLAEINKLESVLKESYTTNRRLHKDCDDCKAELQRSEERNSQLE---------------------NEIEVNNRKNKEIAKYFQMQIKDSNYSNERLKLELKQSENKFQSLQNDNNNIESRF--------------AEQI--------------------------------EQLQSALKESDRKMGSLQRDFEDCKEKLKHSQERNLQLENELVVNKRTIEEITEDFQLKMEDSNSSNEKMLLELNRSEYKFKSLQIENNNIKSGFASQI--EQLELKMNEINEENKILQNNYSQSKLNQSEID---KINLQKE-NEKLKSSNNHAECKLKFNQSETEKSILIAEKSPESQLFIDSTKAANTNEIGALEYKKNIPVIPVPPIGFNNPKGYCYLNCVIQVLASCDDFKKDIEK--------SDCSECFDGTDDSIFVKDCTALF---------KFCHLFATSHRYNRFI------CIFKCMRLNILILLDYTPLKFL 869          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000038532.1 (SMESG000038532.1)

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 430/764 (56.28%), Postives = 508/764 (66.49%), Query Frame = 1
Query:  271 QLENEISQIKLKIEIKLNKSEDQCKSLQSXXXXXXXXXXXXXXXXXXXXQILLTYYNELKGKIIQSNEKEKHFQNICNQLQQ-----EINYWRSKLIDLDKKNKYLKQICIDLQAKSKHL---QNLESISQK----SRNQLEYQKELIKQLQKENSQFEG--------------------------------KYKKLQNENN----QYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQ--------ERNLKLESANCLKSQMERNRCANCAELINQ----LQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDEND----HIK--SQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERN--------QILLHNYDE---------RYLR-ENKKLESTIKEIDKGKQILQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKRDKKEIQSPL-------NSRINTKKIHSKANEKSNYPHESNQTKFEAPIKINYSEDHNKRLMKENDNLERIESNRIGRSRSNLEVERRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINPEVSFENFKNQNYGFVFKSFYGQMALRLVCVHCKYSVNT 2289
            ++EN  S I+ K++ +LNKS ++CKSLQ+ N         +I ++    ++++   NE + +I+QSN  +   +N   + Q      EIN   S L + D+ N+ L+Q   ++ AKSKH      LES +Q     +RNQ    +ELIKQLQ EN + +                                 K K LQNEN+    ++L Q  + +S  +E     + LQ   D+ K +  +S         +  +K  +   +K Q ER+      + I++    LQN   K+    ++ ++Q D     +  L+S L +       LQ E D    H +  SQLES     S       E     +K L   +E+D++         Q+ + N +          R L+  N +LESTIKEIDKGKQILQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKR+KKE+ S L       NSRIN+KKIHSKANEKSN+PHESNQTKFEAPIKINYSEDHNKR MKENDN+ RIESN IGRS SNLEV+RRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGF FLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEI+NRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYIN EVSFENFKNQN GFVF+SFYGQMALRLVCVHCKYSVNT
Sbjct:  311 KMENSKSSIE-KLKSELNKSVNKCKSLQNENDSNKSQFSGQIGKL----ELIIKQINEER-QILQSNYNKSGEENENLKFQHDKYLAEINKLESMLKESDRTNRRLQQ---EIDAKSKHSDWNSQLESTNQYEHQINRNQCTNCEELIKQLQNENERVKSKIEEITKDFQLKMEDSNSTIEKLKSELNQSVNKCKSLQNENDNDKSKFLEQNRKFESIIKEINEERQILQNKYDECKLRFNQSNHEKQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSGEENENLKFQCDKYLAEINKLESVLKESDRTNSRLQQEFDAKSKHSERNSQLESANLFKSQMDRNRFENNAELIKQLENEKEIDKKKVEEITKDFQLKMENSNRSIEKLKLECRNLQNANDQLESTIKEIDKGKQILQKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEFQAQIKREKKEMPSTLIMENNRLNSRINSKKIHSKANEKSNFPHESNQTKFEAPIKINYSEDHNKRFMKENDNVVRIESNSIGRSMSNLEVKRRDRRSFGSESNMSNVTPYNYQNNNILRDPIGFENPKGFCFLNCVIQQLYSCTEFKDDLIQYHRGDSIATDQSNPQASDDDKIFVNNFSKLMEEINNRNDRKIRELVSEIQKYFIESSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINSEVSFENFKNQNNGFVFRSFYGQMALRLVCVHCKYSVNT 1065          

HSP 2 Score: 196.052 bits (497), Expect = 3.114e-51
Identity = 91/104 (87.50%), Postives = 97/104 (93.27%), Query Frame = 2
Query: 2258 FVCIANIL*IQETRSTIRLDEIINGFLQESPVEMDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVTCGQVLNFPMKDTSLKYKLISV 2569
            F  +A  L + ETRSTIRLDEIINGFLQESPVEMDDKR+CKCP+GSLNFLSITEYTHMP+YLHIYLNRGSFYKNGLKNN HVTCGQVLNFPMKDTSLKYKLIS+
Sbjct: 1070 FKSVA--LPVPETRSTIRLDEIINGFLQESPVEMDDKRNCKCPDGSLNFLSITEYTHMPRYLHIYLNRGSFYKNGLKNNTHVTCGQVLNFPMKDTSLKYKLISL 1171          

HSP 3 Score: 107.071 bits (266), Expect = 3.213e-23
Identity = 126/401 (31.42%), Postives = 190/401 (47.38%), Query Frame = 1
Query:  418 QILLTYYNELKGKIIQSNEKEKHFQNICNQLQQEIN-------------------------YWRSKLIDLDKKNKYLKQICIDLQAKSKHLQNLESISQKSR--NQLEYQKELIKQLQKENSQFEGKYKKLQNEN-------NQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNE----KGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQ-LESRKNCDSPTKNANVEQIIFK-------------------------MKNLN---------------LNEEMDERNQILLHNYD-------------ERYLRENKKLESTIKEIDKGKQILQKKYDDVKRHS 1344
            +IL    N+   +I Q     K  + I  +LQQ+ +                         Y++ K+ +     + LK        K K LQN E+ S KS+   Q+   + +IKQ+ +E    +  Y K   EN       ++YLA+I +L+S  +ES+RTN+RLQ  ID  K+K     + N +LES N  + Q+ RN+C NC ELI QLQNE    K K   I KD + ++++ N +++ LKS+LNQ  NKCK LQ+END+ KS+ LE  +  +S  K  N E+ I +                         MKNL                L +E+D+ N+IL +NY+             ++YL E  KLES +KE D+    LQ+++D   +HS
Sbjct:  246 KILQNETNQYLAQINQLQSALKESKGINGRLQQDFDDCKNRQDNCKIKNRKLKKKIEELAKYYQLKMENSKSSIEKLKSELNKSVNKCKSLQN-ENDSNKSQFSGQIGKLELIIKQINEERQILQSNYNKSGEENENLKFQHDKYLAEINKLESMLKESDRTNRRLQQEIDA-KSK---HSDWNSQLESTNQYEHQINRNQCTNCEELIKQLQNENERVKSKIEEITKDFQLKMEDSNSTIEKLKSELNQSVNKCKSLQNENDNDKSKFLEQNRKFESIIKEINEERQILQNKYDECKLRFNQSNHEKQILQWQTEMKNLTTKYVKLQSERDNLKLLVKEIDKENKILQNNYNKSGEENENLKFQCDKYLAEINKLESVLKESDRTNSRLQQEFDAKSKHS 641          

HSP 4 Score: 77.7962 bits (190), Expect = 2.620e-14
Identity = 90/282 (31.91%), Postives = 137/282 (48.58%), Query Frame = 1
Query:  553 DKKNKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENS-----QFEGKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQERNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDNLNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQIIFKMKNLNLNEEMDERNQILLHNYD-------------ERYLRENKKLESTIKEIDKGKQILQKKYDDVKRHS 1344
            ++KN  L++   D +AK K       +SQ+  +QLE + E+   L+ ENS     +   + K LQNE NQYLAQI +L+S  +ES+  N RLQ + D                   +C      +NR  NC     + +  K K   +AK  + +++N   S++ LKS+LN+  NKCK LQ+END  KSQ   +           +E II         ++++E  QIL  NY+             ++YL E  KLES +KE D+  + LQ++ D   +HS
Sbjct:  193 ERKNGRLQEELDDCKAKLK-------LSQERNSQLENENEIFI-LEMENSNNSNEKLRSECKILQNETNQYLAQINQLQSALKESKGINGRLQQDFD-------------------DC------KNRQDNCKI---KNRKLKKKIEELAKYYQLKMENSKSSIEKLKSELNKSVNKCKSLQNENDSNKSQFSGQI--------GKLELII---------KQINEERQILQSNYNKSGEENENLKFQHDKYLAEINKLESMLKESDRTNRRLQQEIDAKSKHS 421          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Usp29.646e-624.05gene:FBgn0031187 transcript:FBtr0077346[more]
Usp29.646e-624.05gene:FBgn0031187 transcript:FBtr0077348[more]
Usp29.646e-624.05gene:FBgn0031187 transcript:FBtr0077347[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp2a8.425e-626.35ubiquitin specific peptidase 2a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9C585|UBP8_ARATH9.108e-727.53Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabido... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
usp2a1.555e-626.35ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2a1.934e-626.35ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp214.731e-625.49ubiquitin carboxyl-terminal hydrolase 21-like [Sou... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000043987.14.079e-628.87uncharacterized LOC105356426 [Source:NCBI gene;Acc... [more]
ENSORLT00000042924.14.307e-628.47uncharacterized LOC105356426 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038532.12.962e-5158.53SMESG000038532.1[more]
SMESG000038532.12.198e-5157.30SMESG000038532.1[more]
SMESG000036067.17.594e-2493.38SMESG000036067.1[more]
SMESG000036067.13.998e-2193.38SMESG000036067.1[more]
SMESG000038532.13.114e-5156.28SMESG000038532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001049 ID=SMED30001049|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=2732bp
TATATAAATCTTATATGATTATTAATAATATTTGAAAGCATAAGATGGAC
AATTACTTTTGTAGTTGACGAAATAATTGTATAATATTATTTCTATATAA
GAAAAAACCTAATGCGAAGTATCATAATGAAAAACAGATTTCAATCACTT
AAAACGAATTCCTTGAGGCTTATCGAAAACCGCTCTCAGTCATCTGCGTA
TATCGTACCAAAAAGAACTGATTCATTTATTTATAAAGATAAATACGAAA
ATGTTTCTAAGTTAATAAAACAATTGGAAAATGAAATATCCCAGATAAAA
CTAAAAATAGAGATTAAATTAAATAAATCGGAAGACCAATGTAAAAGCTT
GCAATCAAACAATTTGAAAATTTTAGAAAATATTATAATAAAAATAAAAG
AAATTAATGCAGAAAATCAAATTTTGCTGACTTATTATAATGAATTAAAA
GGAAAAATAATTCAATCAAATGAAAAAGAAAAACATTTCCAAAATATTTG
TAATCAATTGCAGCAAGAAATTAATTATTGGAGATCAAAATTGATTGATT
TAGATAAGAAAAACAAATATTTGAAACAAATCTGTATCGATTTGCAAGCA
AAATCGAAACATTTACAGAATTTGGAATCGATATCTCAAAAAAGCAGAAA
TCAGCTTGAATATCAAAAAGAATTGATTAAACAACTGCAGAAAGAAAACT
CACAATTTGAAGGCAAATATAAAAAATTACAGAATGAAAATAATCAATAT
TTGGCACAAATTGAGCGATTGAAATCAGGATTCAGGGAATCAGAAAGAAC
AAATAAAAGATTACAGCTAAATATTGATCAATATAAAACGAAATTGGAAC
GTTCACAAGAAAGAAATTTAAAATTGGAATCAGCAAATTGCTTGAAATCA
CAAATGGAAAGAAATCGATGCGCAAATTGTGCAGAATTGATAAATCAATT
ACAAAATGAAAAGGGGAAAACTTATCGAATTGCAAAAGATTGCGAATATC
AGCTGGATAATTTAAACCGTTCTGTTAAAAATCTGAAATCGCAATTGAAT
CAAATGGGAAACAAATGCAAAGACTTGCAGGATGAAAATGATCACATTAA
ATCCCAATTGGAATCACGGAAAAATTGCGATTCGCCTACAAAAAATGCGA
ATGTTGAGCAAATTATTTTTAAAATGAAAAATTTGAACTTGAATGAAGAA
ATGGATGAGAGGAATCAAATTTTACTACATAATTATGATGAAAGATATTT
AAGAGAAAATAAAAAATTGGAATCGACAATAAAAGAAATTGATAAGGGCA
AGCAAATTCTGCAAAAGAAATATGATGATGTCAAAAGGCATTCCATTCAG
CCAGAAAGAGATTTAGTACGTTTACAACAGAGCGTTGAAGAATTGAGGAA
TGAATTAGAATATTGGAAATCAAAATCCAATGGAAACCCACAAAATAGAA
ATGATGAGTTTCAGGCACAAATAAAACGCGACAAAAAGGAAATTCAATCA
CCATTAAACTCACGAATAAATACTAAGAAAATACATTCAAAAGCAAATGA
GAAATCAAATTATCCACATGAATCGAATCAGACCAAATTCGAAGCTCCAA
TAAAAATAAATTATTCGGAAGATCATAACAAAAGATTAATGAAAGAAAAT
GATAATTTAGAAAGAATAGAATCAAACAGAATAGGTAGATCTAGGTCAAA
TTTGGAAGTAGAACGAAGAGATAGAAGGAGTTTCGGATCAGAGTCAAATA
TGTCTAATGTCACACCTTATAATTATCAGAATAATAACATTTTGCGAGAT
CCAATCGGATTTGAGAATCCCAAAGGATTTGGTTTCCTTAACTGCGTCAT
CCAGCAACTGTACAGCTGCACAGAATTTAAAGATGATCTTATTCAATACC
ACCGCGGTGATTCAATCGCTACTGACCAATCAAATCCTCAAGCGAGTGAT
GATGATAAAATATTCGTCAATAACTTCAGCAAATTAATGGAAGAAATTGA
TAATAGGAATGATAGGAAAATCCGTGAATTGGTATCTGAAATTCAGAAAT
ACTTCATCGAATCATCATCGGGAGATGACGTGCTCAAATGTTTCATGACG
GTCTTAACCATATTGTCAAATGTTACGAAAGTAAAAATTCTAAATCGAAA
CAATTCAATTCAATATATAAACCCTGAAGTGTCATTTGAAAATTTTAAAA
ACCAGAATTACGGATTTGTCTTTAAATCTTTTTATGGTCAAATGGCTCTC
CGTCTGGTTTGTGTGCATTGCAAATATTCTGTGAATACAAGAAACTAGAA
GTACAATTCGATTGGATGAAATTATAAATGGATTCCTTCAAGAATCTCCA
GTAGAAATGGATGATAAAAGGGATTGCAAATGTCCAAATGGATCACTTAA
TTTCTTATCAATCACAGAATACACCCATATGCCTCAGTATTTACATATTT
ATTTAAACCGAGGTTCATTTTACAAAAATGGACTGAAAAACAACATTCAC
GTTACATGTGGGCAAGTTTTGAATTTCCCAATGAAAGACACATCATTGAA
GTATAAATTGATATCAGTAATTGACCATATTGGTGATACCCTCGGTGGGC
ATTATTATGCGAAAAGTTGTTTCGAAACCGACCAATGGTGGATGCTAAAT
GATTCAACAGTATATCGAATTTCCGGTGACGAAAAGATTGCAACTGAAAA
CACAATTGTTTTCCTGTTCAAAAAATTTACCT
back to top

protein sequence of SMED30001049-orf-1

>SMED30001049-orf-1 ID=SMED30001049-orf-1|Name=SMED30001049-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=729bp
MRSIIMKNRFQSLKTNSLRLIENRSQSSAYIVPKRTDSFIYKDKYENVSK
LIKQLENEISQIKLKIEIKLNKSEDQCKSLQSNNLKILENIIIKIKEINA
ENQILLTYYNELKGKIIQSNEKEKHFQNICNQLQQEINYWRSKLIDLDKK
NKYLKQICIDLQAKSKHLQNLESISQKSRNQLEYQKELIKQLQKENSQFE
GKYKKLQNENNQYLAQIERLKSGFRESERTNKRLQLNIDQYKTKLERSQE
RNLKLESANCLKSQMERNRCANCAELINQLQNEKGKTYRIAKDCEYQLDN
LNRSVKNLKSQLNQMGNKCKDLQDENDHIKSQLESRKNCDSPTKNANVEQ
IIFKMKNLNLNEEMDERNQILLHNYDERYLRENKKLESTIKEIDKGKQIL
QKKYDDVKRHSIQPERDLVRLQQSVEELRNELEYWKSKSNGNPQNRNDEF
QAQIKRDKKEIQSPLNSRINTKKIHSKANEKSNYPHESNQTKFEAPIKIN
YSEDHNKRLMKENDNLERIESNRIGRSRSNLEVERRDRRSFGSESNMSNV
TPYNYQNNNILRDPIGFENPKGFGFLNCVIQQLYSCTEFKDDLIQYHRGD
SIATDQSNPQASDDDKIFVNNFSKLMEEIDNRNDRKIRELVSEIQKYFIE
SSSGDDVLKCFMTVLTILSNVTKVKILNRNNSIQYINPEVSFENFKNQNY
GFVFKSFYGQMALRLVCVHCKYSVNTRN*
back to top

protein sequence of SMED30001049-orf-2

>SMED30001049-orf-2 ID=SMED30001049-orf-2|Name=SMED30001049-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MDDKRDCKCPNGSLNFLSITEYTHMPQYLHIYLNRGSFYKNGLKNNIHVT
CGQVLNFPMKDTSLKYKLISVIDHIGDTLGGHYYAKSCFETDQWWMLNDS
TVYRISGDEKIATENTIVFLFKKFT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028889USP_dom
IPR001394Peptidase_C19_UCH
IPR018200USP_CS