CSP domain-containing protein

Overview
NameCSP domain-containing protein
Smed IDSMED30001048
Length (bp)1196
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CSP domain-containing protein (SMED30001048) t-SNE clustered cells

Violin plots show distribution of expression levels for CSP domain-containing protein (SMED30001048) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CSP domain-containing protein (SMED30001048) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CSP domain-containing protein (SMED30001048) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001048

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30001048h1SMcG0010567 dd_Smed_v4_3631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30001048h1SMcG0010567 dd_Smed_v4_3631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CSP domain-containing protein vs. Ensembl Human
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:HGNC Symbol;Acc:HGNC:17150])

HSP 1 Score: 112.464 bits (280), Expect = 2.705e-29
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. Ensembl Human
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:HGNC Symbol;Acc:HGNC:17150])

HSP 1 Score: 112.464 bits (280), Expect = 2.705e-29
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. Ensembl Human
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:HGNC Symbol;Acc:HGNC:17150])

HSP 1 Score: 112.464 bits (280), Expect = 2.705e-29
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. Ensembl Human
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:HGNC Symbol;Acc:HGNC:17150])

HSP 1 Score: 112.464 bits (280), Expect = 2.705e-29
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. Ensembl Human
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:HGNC Symbol;Acc:HGNC:17150])

HSP 1 Score: 112.464 bits (280), Expect = 2.705e-29
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. Ensembl Fly
Match: CG9705 (gene:FBgn0036661 transcript:FBtr0075325)

HSP 1 Score: 119.013 bits (297), Expect = 4.282e-32
Identity = 58/109 (53.21%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  145 NLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDPVH 471
            +L +PSPI  +R RT S S +ALE PV  G + SF R KGHGFI  N   E +F H+ DIEGEYVP  GDEV +R   IPPK  K+QA+H  I HL P  H KW +P +
Sbjct:   28 SLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHHKWEEPFY 136          
BLAST of CSP domain-containing protein vs. Ensembl Fly
Match: CG9705 (gene:FBgn0036661 transcript:FBtr0075324)

HSP 1 Score: 119.013 bits (297), Expect = 4.282e-32
Identity = 58/109 (53.21%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  145 NLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDPVH 471
            +L +PSPI  +R RT S S +ALE PV  G + SF R KGHGFI  N   E +F H+ DIEGEYVP  GDEV +R   IPPK  K+QA+H  I HL P  H KW +P +
Sbjct:   28 SLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHHKWEEPFY 136          
BLAST of CSP domain-containing protein vs. Ensembl Fly
Match: CG9705 (gene:FBgn0036661 transcript:FBtr0333607)

HSP 1 Score: 119.013 bits (297), Expect = 4.282e-32
Identity = 58/109 (53.21%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  145 NLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDPVH 471
            +L +PSPI  +R RT S S +ALE PV  G + SF R KGHGFI  N   E +F H+ DIEGEYVP  GDEV +R   IPPK  K+QA+H  I HL P  H KW +P +
Sbjct:   28 SLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHHKWEEPFY 136          
BLAST of CSP domain-containing protein vs. Ensembl Zebrafish
Match: carhsp1 (calcium regulated heat stable protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1479])

HSP 1 Score: 108.997 bits (271), Expect = 5.026e-28
Identity = 56/106 (52.83%), Postives = 69/106 (65.09%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            IPSP+  +RNRT S + +A E PV  G    F R+KGHGFI  ++    IF+HI DI+GEYVP EGDEV ++   IPPK+ K QA+   I HLAPG  HE WS  V
Sbjct:   47 IPSPLPTRRNRTCSAAARAAEGPVFSGVCKCFSRSKGHGFITPSDGGNDIFVHISDIDGEYVPVEGDEVCYKICSIPPKHEKIQAVEVTITHLAPGTKHETWSGAV 152          
BLAST of CSP domain-containing protein vs. Ensembl Zebrafish
Match: carhsp1 (calcium regulated heat stable protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1479])

HSP 1 Score: 108.997 bits (271), Expect = 5.026e-28
Identity = 56/106 (52.83%), Postives = 69/106 (65.09%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            IPSP+  +RNRT S + +A E PV  G    F R+KGHGFI  ++    IF+HI DI+GEYVP EGDEV ++   IPPK+ K QA+   I HLAPG  HE WS  V
Sbjct:   47 IPSPLPTRRNRTCSAAARAAEGPVFSGVCKCFSRSKGHGFITPSDGGNDIFVHISDIDGEYVPVEGDEVCYKICSIPPKHEKIQAVEVTITHLAPGTKHETWSGAV 152          
BLAST of CSP domain-containing protein vs. Ensembl Zebrafish
Match: CSDC2 (cold shock domain containing C2, RNA binding b [Source:NCBI gene;Acc:557375])

HSP 1 Score: 102.449 bits (254), Expect = 6.672e-26
Identity = 54/103 (52.43%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  KR RT S + +A   PV  G    F R++GHGFI      + IF HI DIEGEYVP EGDEVT++  LIPPKN K QA+   I HL  G  HE WS
Sbjct:   31 LPSPLPTKRTRTYSATVRANAGPVFKGVCKDFSRSQGHGFIKPAHGGDDIFFHISDIEGEYVPVEGDEVTYKVCLIPPKNVKVQAVEVTITHLKAGAKHETWS 133          
BLAST of CSP domain-containing protein vs. Ensembl Zebrafish
Match: csdc2a (cold shock domain containing C2, RNA binding a [Source:ZFIN;Acc:ZDB-GENE-040718-442])

HSP 1 Score: 102.064 bits (253), Expect = 1.721e-25
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  157 PSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGH-HEKWSDPV 468
            PSP+  KR RT S S +A   PV  G   +F R++GHGFI  +   E IF+HI DIEGEYVP EGDEVT++   +PPKN K+QA+   I +L+ G  HE WS  V
Sbjct:   46 PSPLPTKRTRTYSASVRAKSGPVYKGICKNFSRSQGHGFIRPSHGGEDIFVHISDIEGEYVPMEGDEVTYKVCPVPPKNIKFQAVEVVITNLSSGRKHETWSGQV 150          
BLAST of CSP domain-containing protein vs. Ensembl Zebrafish
Match: csdc2a (cold shock domain containing C2, RNA binding a [Source:ZFIN;Acc:ZDB-GENE-040718-442])

HSP 1 Score: 102.064 bits (253), Expect = 1.721e-25
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  157 PSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGH-HEKWSDPV 468
            PSP+  KR RT S S +A   PV  G   +F R++GHGFI  +   E IF+HI DIEGEYVP EGDEVT++   +PPKN K+QA+   I +L+ G  HE WS  V
Sbjct:   46 PSPLPTKRTRTYSASVRAKSGPVYKGICKNFSRSQGHGFIRPSHGGEDIFVHISDIEGEYVPMEGDEVTYKVCPVPPKNIKFQAVEVVITNLSSGRKHETWSGQV 150          
BLAST of CSP domain-containing protein vs. Ensembl Xenopus
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:NCBI gene;Acc:100038105])

HSP 1 Score: 111.694 bits (278), Expect = 3.348e-29
Identity = 57/103 (55.34%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGH-HEKWS 459
            IPSP+  +R RT S + +A E PV  G    F R+KGHGFI   +    IFLHI DIEGEYVP EGDEVT++   +PPKN K+QA+   I HLAPG  HE WS
Sbjct:   26 IPSPLPTRRTRTFSATVRASEGPVYKGVCKCFSRSKGHGFITPVDGGPDIFLHISDIEGEYVPAEGDEVTYKVCTVPPKNEKHQAVEVKITHLAPGSKHETWS 128          
BLAST of CSP domain-containing protein vs. Ensembl Xenopus
Match: CARHSP1 (calcium regulated heat stable protein 1 [Source:NCBI gene;Acc:100038105])

HSP 1 Score: 110.923 bits (276), Expect = 9.782e-29
Identity = 57/103 (55.34%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGH-HEKWS 459
            IPSP+  +R RT S + +A E PV  G    F R+KGHGFI   +    IFLHI DIEGEYVP EGDEVT++   +PPKN K+QA+   I HLAPG  HE WS
Sbjct:   36 IPSPLPTRRTRTFSATVRASEGPVYKGVCKCFSRSKGHGFITPVDGGPDIFLHISDIEGEYVPAEGDEVTYKVCTVPPKNEKHQAVEVKITHLAPGSKHETWS 138          
BLAST of CSP domain-containing protein vs. Ensembl Xenopus
Match: tspan16 (tetraspanin 16 [Source:Xenbase;Acc:XB-GENE-868326])

HSP 1 Score: 106.301 bits (264), Expect = 5.980e-27
Identity = 54/110 (49.09%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  133 DNILNLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAP-GHHEKWS 459
             ++L   +PSP+  KR RT S + +A   P+  G    F R++GHGFI      E IF+HI DIEGEYVP EGDEVTF+   IPPKN K+QA+   + HL+P   HE WS
Sbjct:   36 SHLLLGELPSPLPTKRTRTYSATARASAGPIYKGVCKQFSRSQGHGFITPENGTEDIFVHISDIEGEYVPVEGDEVTFKMCPIPPKNQKFQAVEVILTHLSPHTKHETWS 145          
BLAST of CSP domain-containing protein vs. Ensembl Mouse
Match: Carhsp1 (calcium regulated heat stable protein 1 [Source:MGI Symbol;Acc:MGI:1196368])

HSP 1 Score: 112.464 bits (280), Expect = 1.891e-29
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   40 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 142          
BLAST of CSP domain-containing protein vs. Ensembl Mouse
Match: Csdc2 (cold shock domain containing C2, RNA binding [Source:MGI Symbol;Acc:MGI:2146027])

HSP 1 Score: 105.145 bits (261), Expect = 1.278e-26
Identity = 55/114 (48.25%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  130 GDNILNLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAP-GHHEKWSDPV 468
            G  I    +PSP+  KR RT S + +A   PV  G    F R++GHGFI      E IF+H+ DIEGEYVP EGDEVT++   IPPKN K+QA+   +  LAP   HE WS  V
Sbjct:   38 GGGIAPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKICPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQV 151          
BLAST of CSP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VVA0|Y9705_DROME (Cold shock domain-containing protein CG9705 OS=Drosophila melanogaster OX=7227 GN=CG9705 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.293e-31
Identity = 58/109 (53.21%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  145 NLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDPVH 471
            +L +PSPI  +R RT S S +ALE PV  G + SF R KGHGFI  N   E +F H+ DIEGEYVP  GDEV +R   IPPK  K+QA+H  I HL P  H KW +P +
Sbjct:   28 SLQLPSPIITRRTRTASTSARALENPVVTGMVKSFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQISHLTPEVHHKWEEPFY 136          
BLAST of CSP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9WU49|CHSP1_RAT (Calcium-regulated heat stable protein 1 OS=Rattus norvegicus OX=10116 GN=Carhsp1 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.208e-28
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2V2|CHSP1_HUMAN (Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 1.299e-28
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   39 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 141          
BLAST of CSP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CR86|CHSP1_MOUSE (Calcium-regulated heat stable protein 1 OS=Mus musculus OX=10090 GN=Carhsp1 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.323e-28
Identity = 56/103 (54.37%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  +R RT S + +A + PV  G    FCR+KGHGFI   +    IFLHI D+EGEYVP EGDEVT++   IPPKN K QA+   I HLAPG  HE WS
Sbjct:   40 VPSPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS 142          
BLAST of CSP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91YQ3|CSDC2_MOUSE (Cold shock domain-containing protein C2 OS=Mus musculus OX=10090 GN=Csdc2 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 8.941e-26
Identity = 55/114 (48.25%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  130 GDNILNLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAP-GHHEKWSDPV 468
            G  I    +PSP+  KR RT S + +A   PV  G    F R++GHGFI      E IF+H+ DIEGEYVP EGDEVT++   IPPKN K+QA+   +  LAP   HE WS  V
Sbjct:   38 GGGIAPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKICPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQV 151          
BLAST of CSP domain-containing protein vs. TrEMBL
Match: A0A4S2M393 (CSP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004291 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.369e-36
Identity = 61/106 (57.55%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  148 LSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDP 465
            +SIPSPI H+RNRT+SQSE A    +  G +V FCR +GHGFI  + + + IFLH++DIEGE +P+ GD V +RK+LIPPKN KYQA+H  IV+ APG H  W+DP
Sbjct:   13 MSIPSPILHRRNRTKSQSETAASAELGRGTVVEFCRERGHGFIKPDGDGDAIFLHVYDIEGEVIPNHGDIVEYRKMLIPPKNEKYQAVHVKIVNFAPGRHRTWNDP 118          
BLAST of CSP domain-containing protein vs. TrEMBL
Match: A0A1S8WRE6 (Cold-shock DNA-binding domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_07090 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.747e-36
Identity = 61/106 (57.55%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  148 LSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDP 465
            +SIPSPI H+RNRT+SQSE A    +  G +V FCR +GHGFI  + + + IFLH++DIEGE +P+ GD V +RK+LIPPKN KYQA+H  IV+ APG H  W+DP
Sbjct:   13 MSIPSPILHRRNRTKSQSETAASAELGRGTVVEFCRERGHGFIKPDGDGDSIFLHVYDIEGEVIPNHGDIVEYRKMLIPPKNEKYQAVHVKIVNFAPGRHRTWNDP 118          
BLAST of CSP domain-containing protein vs. TrEMBL
Match: A0A504YM84 (Cold shock protein DNA binding OS=Fasciola gigantica OX=46835 GN=FGIG_12128 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.280e-36
Identity = 65/107 (60.75%), Postives = 78/107 (72.90%), Query Frame = 1
Query:  148 LSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDPV 468
            L IPSPI HKRNRT+SQSE A       G+IV+FCR KGHGFI  ++  + +F+HIFDIEGE VP+EGD V FRK+LIPPKN KYQA+H  IV   PG H+ W +P 
Sbjct:   28 LIIPSPIIHKRNRTKSQSEYAANAEHGKGRIVTFCREKGHGFIKPDDGEDYLFVHIFDIEGELVPNEGDTVEFRKMLIPPKNEKYQAVHVKIVDFGPGRHKTWDEPA 134          
BLAST of CSP domain-containing protein vs. TrEMBL
Match: A0A2H1CEI0 (Cold-shock DNA-binding domain protein (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_06897 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.238e-35
Identity = 65/107 (60.75%), Postives = 78/107 (72.90%), Query Frame = 1
Query:  148 LSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDPV 468
            L IPSPI HKRNRT+SQSE A       G+IV+FCR KGHGFI  ++  + +F+HIFDIEGE VP+EGD V FRK+LIPPKN KYQA+H  IV   PG H+ W +P 
Sbjct:   53 LIIPSPIIHKRNRTKSQSEYAANAEHGKGRIVTFCREKGHGFIKPDDGEDYLFVHIFDIEGELVPNEGDTVEFRKMLIPPKNEKYQAVHVKIVDFGPGRHKTWDEPA 159          
BLAST of CSP domain-containing protein vs. TrEMBL
Match: A0A075ADA8 (CSP domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_06700 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.157e-35
Identity = 61/106 (57.55%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  148 LSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDP 465
            +SIPSPI H+RNRT+SQSE A    +  G +V FCR +GHGFI  + + + IFLH++DIEGE +P+ GD V +RK+LIPPKN KYQA+H  IV+ APG H  W+DP
Sbjct:  104 MSIPSPILHRRNRTKSQSETAASAELGRGTVVEFCRERGHGFIKPDGDGDSIFLHVYDIEGEVIPNHGDIVEYRKMLIPPKNEKYQAVHVKIVNFAPGRHRTWNDP 209          
BLAST of CSP domain-containing protein vs. Ensembl Cavefish
Match: carhsp1 (calcium regulated heat stable protein 1 [Source:NCBI gene;Acc:111193795])

HSP 1 Score: 109.768 bits (273), Expect = 1.908e-28
Identity = 56/106 (52.83%), Postives = 70/106 (66.04%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            IPSP+  +RNRT S S +A E PV  G    F R+KGHGF+  ++    IF+HI DI+GEYVP EGDEV+++   IPPK+ K QA+   I HLAPG  HE WS  V
Sbjct:   50 IPSPLPTRRNRTCSASARAAEGPVFSGVCKCFSRSKGHGFLTPSDGGADIFVHISDIDGEYVPVEGDEVSYKICSIPPKHEKIQAVEVTITHLAPGTKHETWSGMV 155          
BLAST of CSP domain-containing protein vs. Ensembl Cavefish
Match: carhsp1 (calcium regulated heat stable protein 1 [Source:NCBI gene;Acc:111193795])

HSP 1 Score: 109.768 bits (273), Expect = 1.908e-28
Identity = 56/106 (52.83%), Postives = 70/106 (66.04%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            IPSP+  +RNRT S S +A E PV  G    F R+KGHGF+  ++    IF+HI DI+GEYVP EGDEV+++   IPPK+ K QA+   I HLAPG  HE WS  V
Sbjct:   50 IPSPLPTRRNRTCSASARAAEGPVFSGVCKCFSRSKGHGFLTPSDGGADIFVHISDIDGEYVPVEGDEVSYKICSIPPKHEKIQAVEVTITHLAPGTKHETWSGMV 155          
BLAST of CSP domain-containing protein vs. Ensembl Cavefish
Match: CSDC2 (cold shock domain-containing protein C2-like [Source:NCBI gene;Acc:103032460])

HSP 1 Score: 105.145 bits (261), Expect = 8.900e-27
Identity = 54/106 (50.94%), Postives = 68/106 (64.15%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            +PSP+  KR RT S + +A   PV  G   +F R++GHG+I      E IF+HI DIEGEYVP EGDEVT++   IPPKN K+QA+   I HL PG  HE WS  +
Sbjct:   42 LPSPLPTKRTRTYSATVRATSGPVFKGMCKNFSRSQGHGYITPANGAEDIFVHISDIEGEYVPVEGDEVTYKVCPIPPKNLKFQAVEVIITHLNPGTKHETWSGQI 147          
BLAST of CSP domain-containing protein vs. Ensembl Cavefish
Match: csdc2a (cold shock domain-containing protein C2-like [Source:NCBI gene;Acc:103030148])

HSP 1 Score: 96.2857 bits (238), Expect = 1.656e-23
Identity = 51/99 (51.52%), Postives = 63/99 (63.64%), Query Frame = 1
Query:  175 KRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            KRNRT S + +A   PV  G   +F R++GHGFI      E IF+HI D+EGEYVP EGDEVT++   +PPKN K QA+   I +L PG  HE WS  V
Sbjct:   53 KRNRTYSATVRARSGPVFKGVCKNFSRSQGHGFIRPAHGGEDIFVHISDVEGEYVPMEGDEVTYKVCPVPPKNLKVQAVEVVITNLTPGTKHETWSGQV 151          
BLAST of CSP domain-containing protein vs. Ensembl Cavefish
Match: carhsp1 (calcium regulated heat stable protein 1 [Source:NCBI gene;Acc:111193795])

HSP 1 Score: 92.0485 bits (227), Expect = 5.208e-22
Identity = 47/91 (51.65%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  199 SEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            S +A E PV  G    F R+KGHGF+  ++    IF+HI DI+GEYVP EGDEV+++   IPPK+ K QA+   I HLAPG  HE WS  V
Sbjct:   59 SARAAEGPVFSGVCKCFSRSKGHGFLTPSDGGADIFVHISDIDGEYVPVEGDEVSYKICSIPPKHEKIQAVEVTITHLAPGTKHETWSGMV 149          
BLAST of CSP domain-containing protein vs. Ensembl Medaka
Match: carhsp1 (calcium-regulated heat-stable protein 1 [Source:NCBI gene;Acc:101169363])

HSP 1 Score: 107.071 bits (266), Expect = 2.386e-27
Identity = 54/102 (52.94%), Postives = 67/102 (65.69%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKW 456
            IPSP+  +RNRT S + +A E PV  G    F R+KGHGFI  ++    IF+HI DIEGEYVP EGDEV+++   IPPK+ K QA+   I HL PG  HE W
Sbjct:   50 IPSPLPTRRNRTYSATARASEGPVFTGVCKCFSRSKGHGFITPSDGGSDIFVHISDIEGEYVPVEGDEVSYKVCAIPPKHEKVQAVEVAITHLKPGTKHETW 151          
BLAST of CSP domain-containing protein vs. Ensembl Medaka
Match: CSDC2 (cold shock domain-containing protein C2 [Source:NCBI gene;Acc:101174596])

HSP 1 Score: 104.76 bits (260), Expect = 1.325e-26
Identity = 55/103 (53.40%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  KRNRT S + +A   PV  G   +F R++GHGFI  +   E IF+HI DIEGEYVP EGDEVT++   +PPKN K QA+   I HL PG  HE WS
Sbjct:   47 LPSPLPTKRNRTYSATVRAHSGPVFKGVCKNFSRSQGHGFIQPSHGGEDIFVHISDIEGEYVPVEGDEVTYKVCRVPPKNVKVQAVDVKITHLNPGTKHETWS 149          
BLAST of CSP domain-containing protein vs. Ensembl Medaka
Match: CSDC2 (cold shock domain-containing protein C2 [Source:NCBI gene;Acc:101174596])

HSP 1 Score: 104.76 bits (260), Expect = 1.325e-26
Identity = 55/103 (53.40%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  154 IPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWS 459
            +PSP+  KRNRT S + +A   PV  G   +F R++GHGFI  +   E IF+HI DIEGEYVP EGDEVT++   +PPKN K QA+   I HL PG  HE WS
Sbjct:   47 LPSPLPTKRNRTYSATVRAHSGPVFKGVCKNFSRSQGHGFIQPSHGGEDIFVHISDIEGEYVPVEGDEVTYKVCRVPPKNVKVQAVDVKITHLNPGTKHETWS 149          
BLAST of CSP domain-containing protein vs. Ensembl Medaka
Match: csdc2a (cold shock domain-containing protein C2-like [Source:NCBI gene;Acc:101165181])

HSP 1 Score: 102.834 bits (255), Expect = 7.720e-26
Identity = 54/104 (51.92%), Postives = 67/104 (64.42%), Query Frame = 1
Query:  160 SPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPG-HHEKWSDPV 468
            SP+  KR RT S + +A   PV  G   +F R++GHGF+  +   E IF+HI DIEGEYVP EGDEVT++   IPPKN K+QA+   I HL PG  HE WS  V
Sbjct:   57 SPLPTKRTRTYSATVRARSGPVFKGVCKNFSRSQGHGFLRPSHGGEDIFVHISDIEGEYVPVEGDEVTYKVCPIPPKNRKFQAVEVVITHLKPGTKHETWSGQV 160          
BLAST of CSP domain-containing protein vs. Planmine SMEST
Match: SMESG000068700.1 (SMESG000068700.1)

HSP 1 Score: 127.487 bits (319), Expect = 7.536e-36
Identity = 55/105 (52.38%), Postives = 75/105 (71.43%), Query Frame = 1
Query:  151 SIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRNKGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQALHCNIVHLAPGHHEKWSDP 465
             IP+PI HKRNRT SQSE+AL LP  +G I  FCRNKGHGF+  ++  + +F HI+DI+GEYVPH+ D V +R++ +PPKN K+QA+H  ++ +     E W DP
Sbjct:    3 QIPNPIFHKRNRTLSQSERALLLPTMYGIIKEFCRNKGHGFVIPDDGSDELFFHIYDIDGEYVPHQNDRVEYRRVGVPPKNTKFQAVHVKLIGIDKATRETWDDP 107          
The following BLAST results are available for this feature:
BLAST of CSP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CARHSP12.705e-2954.37calcium regulated heat stable protein 1 [Source:HG... [more]
CARHSP12.705e-2954.37calcium regulated heat stable protein 1 [Source:HG... [more]
CARHSP12.705e-2954.37calcium regulated heat stable protein 1 [Source:HG... [more]
CARHSP12.705e-2954.37calcium regulated heat stable protein 1 [Source:HG... [more]
CARHSP12.705e-2954.37calcium regulated heat stable protein 1 [Source:HG... [more]
back to top
BLAST of CSP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CSP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG97054.282e-3253.21gene:FBgn0036661 transcript:FBtr0075325[more]
CG97054.282e-3253.21gene:FBgn0036661 transcript:FBtr0075324[more]
CG97054.282e-3253.21gene:FBgn0036661 transcript:FBtr0333607[more]
back to top
BLAST of CSP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
carhsp15.026e-2852.83calcium regulated heat stable protein 1 [Source:ZF... [more]
carhsp15.026e-2852.83calcium regulated heat stable protein 1 [Source:ZF... [more]
CSDC26.672e-2652.43cold shock domain containing C2, RNA binding b [So... [more]
csdc2a1.721e-2551.43cold shock domain containing C2, RNA binding a [So... [more]
csdc2a1.721e-2551.43cold shock domain containing C2, RNA binding a [So... [more]
back to top
BLAST of CSP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CARHSP13.348e-2955.34calcium regulated heat stable protein 1 [Source:NC... [more]
CARHSP19.782e-2955.34calcium regulated heat stable protein 1 [Source:NC... [more]
tspan165.980e-2749.09tetraspanin 16 [Source:Xenbase;Acc:XB-GENE-868326][more]
back to top
BLAST of CSP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Carhsp11.891e-2954.37calcium regulated heat stable protein 1 [Source:MG... [more]
Csdc21.278e-2648.25cold shock domain containing C2, RNA binding [Sour... [more]
back to top
BLAST of CSP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VVA0|Y9705_DROME4.293e-3153.21Cold shock domain-containing protein CG9705 OS=Dro... [more]
sp|Q9WU49|CHSP1_RAT1.208e-2854.37Calcium-regulated heat stable protein 1 OS=Rattus ... [more]
sp|Q9Y2V2|CHSP1_HUMAN1.299e-2854.37Calcium-regulated heat-stable protein 1 OS=Homo sa... [more]
sp|Q9CR86|CHSP1_MOUSE1.323e-2854.37Calcium-regulated heat stable protein 1 OS=Mus mus... [more]
sp|Q91YQ3|CSDC2_MOUSE8.941e-2648.25Cold shock domain-containing protein C2 OS=Mus mus... [more]
back to top
BLAST of CSP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M3932.369e-3657.55CSP domain-containing protein OS=Opisthorchis feli... [more]
A0A1S8WRE62.747e-3657.55Cold-shock DNA-binding domain protein OS=Opisthorc... [more]
A0A504YM846.280e-3660.75Cold shock protein DNA binding OS=Fasciola giganti... [more]
A0A2H1CEI01.238e-3560.75Cold-shock DNA-binding domain protein (Fragment) O... [more]
A0A075ADA83.157e-3557.55CSP domain-containing protein OS=Opisthorchis vive... [more]
back to top
BLAST of CSP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
carhsp11.908e-2852.83calcium regulated heat stable protein 1 [Source:NC... [more]
carhsp11.908e-2852.83calcium regulated heat stable protein 1 [Source:NC... [more]
CSDC28.900e-2750.94cold shock domain-containing protein C2-like [Sour... [more]
csdc2a1.656e-2351.52cold shock domain-containing protein C2-like [Sour... [more]
carhsp15.208e-2251.65calcium regulated heat stable protein 1 [Source:NC... [more]
back to top
BLAST of CSP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CSP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CSP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CSP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
carhsp12.386e-2752.94calcium-regulated heat-stable protein 1 [Source:NC... [more]
CSDC21.325e-2653.40cold shock domain-containing protein C2 [Source:NC... [more]
CSDC21.325e-2653.40cold shock domain-containing protein C2 [Source:NC... [more]
csdc2a7.720e-2651.92cold shock domain-containing protein C2-like [Sour... [more]
back to top
BLAST of CSP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068700.17.536e-3652.38SMESG000068700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001048 ID=SMED30001048|Name=CSP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1196bp
ATTAAATTAACTAAAAAATAATATAAATTATCATTTTATTTATGCAGTTA
AGTTTCATTGAAATAATTTGTTTAATTAATACAGATTAAAAGTTTAGTAT
TTTATTAAATGATGGATGGGAATAATGTTGGTGATAATATTTTGAATTTA
AGTATACCTAGTCCAATTACTCATAAGAGAAATCGTACAGAATCCCAATC
AGAAAAAGCTCTTGAATTACCAGTTAACCATGGAAAAATAGTTTCTTTTT
GCCGAAATAAAGGTCATGGCTTTATTAATTCTAATGAAGAGCTTGAACCA
ATTTTCCTCCATATTTTTGACATTGAAGGTGAATATGTTCCTCACGAAGG
CGATGAAGTTACTTTTCGTAAGATTCTCATTCCACCAAAAAACAATAAAT
ATCAAGCTCTTCATTGCAATATTGTTCACTTAGCTCCTGGTCATCATGAA
AAATGGAGTGATCCTGTTCACAGAAAAAATTGAATTAGTTTTTGTAATTC
AAATTTCATCGTTAAAATTTATTTAACTGAAATTATCCTAATAATTTCAA
CTTTATTAATGTCTAGTTATATAATTACAAATTTACTAGTTAACTGTATA
ATATTAGCAACTTTATTTAATAATTTGTGTAGGTTCAAATATTGAATAAT
CGTGATTTGGAATTATAGCCATTGTGGAACATTTTATCAAATTATCTGTT
CGTTTGAATTTATAAACCCTTCAAAATATGAAAATTGGAATTTTTGATTA
TCATTGTATTAATTAAAAGGGATTGGTTGTATTATATATATTTTAAAATT
CCTGATGTAATTTTCTTATGTATTCAAATATTATTTAATACCTGTGAAAA
TATTAAGGACAATATATTGTTAGAAAATGCTCTTTATCTCTGTCACGAGT
ATAATGCAATTATAAAATTTGAGGAATCTTTGAATTAATGAGCATGCTTT
AACGACGTCCCCAAAACTAAGCAATTATTTTCACCCCTATTCCTTTATGC
TACTTTATAAGCACCATGTACCCTTTAAGGGACGCATGTAATGAATGCTA
TGTTATAACTCAAAATGATGTTAACAAATATCTGATAAATTCTTTAACTA
TTATTAGTAGTGTAATAATATTTGTATACCATTTCAAGCAAGTTATTCGT
AAAATTGCTTATTTATTTTGGTTAGAAAGGAAATTAAGAGGATTAG
back to top

protein sequence of SMED30001048-orf-1

>SMED30001048-orf-1 ID=SMED30001048-orf-1|Name=SMED30001048-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MMDGNNVGDNILNLSIPSPITHKRNRTESQSEKALELPVNHGKIVSFCRN
KGHGFINSNEELEPIFLHIFDIEGEYVPHEGDEVTFRKILIPPKNNKYQA
LHCNIVHLAPGHHEKWSDPVHRKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR011129CSD
IPR012340NA-bd_OB-fold
IPR002059CSP_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated