Receptor-type tyrosine-protein phosphatase beta

Overview
NameReceptor-type tyrosine-protein phosphatase beta
Smed IDSMED30001036
Uniprot Best hitTyrosine-protein phosphatase non-receptor type 20 OS=Mus musculus OX=10090 GN=Ptpn20 PE=1 SV=1 (E=2.039e-43)
Length (bp)2154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase beta (SMED30001036) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase beta (SMED30001036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase beta (SMED30001036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase beta (SMED30001036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30001036SMESG000050003.1 SMESG000005237.1 SmedASXL_016602SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30001036SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 1.019e-43
Identity = 115/311 (36.98%), Postives = 162/311 (52.09%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K   + Q +    L  + G   KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R  TV          ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct: 1025 NFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRG---KNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKV 1307          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 1.059e-43
Identity = 115/311 (36.98%), Postives = 165/311 (53.05%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K   + Q +    L  + G   KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R  TV   +  ++  ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct: 1030 NFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRG---KNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKV 1312          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 1.086e-43
Identity = 115/311 (36.98%), Postives = 165/311 (53.05%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K   + Q +    L  + G   KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R  TV   +  ++  ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct: 1026 NFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRG---KNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKV 1308          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 165.236 bits (417), Expect = 1.648e-41
Identity = 119/344 (34.59%), Postives = 170/344 (49.42%), Query Frame = 3
Query: 1098 PDDNDKSPL---TFNFHA--------------HFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMN--KYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQR---GLSKVPER 2039
            PD   +SPL    F+F +              H E +K + + +L  +++ I   Q    E  N+ V    N  KNRY N+  Y H+RV L  ++     DYINA+ +         +G    C + YIATQGPL E       T GDFWRMV E     IV +TR EE  + KC QYWP++  +   F      ++V + ++ E + F  R  ++  N    ++ V+Q   T+W DH  P        +   +++  P +A  I+VHCSAGVGRTG FI+ID  L RIK     V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++VP R
Sbjct: 1349 PDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEV----NKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYV---------DG--YRCQNAYIATQGPLPE-------TFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPE-KTVDVYGHVTLMRSQRNYMVQTEDQYSF----IHEALLEAVGCGNTEVPAR 1659          

HSP 2 Score: 141.354 bits (355), Expect = 7.727e-34
Identity = 98/259 (37.84%), Postives = 128/259 (49.42%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ ENN  I+V LT+  E G+EKC QYWP + + R  +   D + E  M       I  E  +T + +   +TV+Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R++     V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1705 NKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP----QYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1940          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPN20 (protein tyrosine phosphatase non-receptor type 20 [Source:HGNC Symbol;Acc:HGNC:23423])

HSP 1 Score: 155.992 bits (393), Expect = 1.690e-41
Identity = 115/309 (37.22%), Postives = 150/309 (48.54%), Query Frame = 3
Query: 1119 PLTFNFHAHFEFMKRDSNGRLIDQFQ--DIKQQVKQLETQNVL-VFSGGNI----HKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTD--YYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDL--VEVIMTNSRENSIFTERVLTV--SMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            PL FNFH       +D    L ++    DI Q+   LE +N+   F+ GN      KNRY +I PY   RV L K  DYINAS I +            NC +  +YIATQGPL       +STI DFW+MVLENN  +I  +TR  E G  KC  YWP      I+     +L    V + N +    F  R+  V         +VKQL  T W DH  P ++D    Y  Y R    +  ++VHCSAG+GRTG F+ +D     I K      I + +  +R+ R  MVQT+ QY F Y I+ E L
Sbjct:   51 PLIFNFHEQTAI--KDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRI-----------VNCGEEYFYIATQGPL-------LSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWP------ISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVKNCS-FNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVL 332          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 153.295 bits (386), Expect = 5.866e-38
Identity = 108/310 (34.84%), Postives = 155/310 (50.00%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVF----SGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSM--NKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVP 2033
            H E ++ ++N     +F+ I       ET     +    +  N HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  + KC QYWP     R   + GD  +EV +  S   + +T R + + M      + +K L  T+W DH  P        +   +++  P++A  II HCSAG+GRTG+FI+ID  L R+ +  + V+IY  +  LR  R  MVQTE QY FI+  + +  +  G ++VP
Sbjct: 1615 HIERLRMNNNAGFQSEFESI-------ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP----SRGTATYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1891          

HSP 2 Score: 113.235 bits (282), Expect = 2.116e-25
Identity = 96/312 (30.77%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLET----------QNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS-MNKYE-KTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKVP---SEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             H H   + + S     DQ   I  + + L T           N+ V    N  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +      +  R   +S +N  E +TV+Q H   W D   P T+D F++F      +      +  I VHC +G GRT  FI +   L R++     V+++ T+  LR  R  M+Q   QY F+Y   +E L
Sbjct: 1895 LHQHLHILSQPS----ADQLSGIDMEFRHLTTLKWTSNRCTVANLPV----NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH------YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 2173          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 152.91 bits (385), Expect = 5.905e-38
Identity = 108/310 (34.84%), Postives = 154/310 (49.68%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGG----NIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSM--NKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVP 2033
            H E ++ ++N     +F+ I       ET     +       N HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  + KC QYWP     R   + GD  +EV +  S   + +T R + + M      + +K L  T+W DH  P        +   +++  P++A  II HCSAG+GRTG+FI+ID  L R+ +  + V+IY  +  LR  R  MVQTE QY FI+  + +  +  G ++VP
Sbjct:  902 HIERLRMNNNAGFQSEFESI-------ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP----SRGTATYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1178          

HSP 2 Score: 112.849 bits (281), Expect = 2.675e-25
Identity = 96/312 (30.77%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLET----------QNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS-MNKYE-KTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKVP---SEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             H H   + + S     DQ   I  + + L T           N+ V    N  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +      +  R   +S +N  E +TV+Q H   W D   P T+D F++F      +      +  I VHC +G GRT  FI +   L R++     V+++ T+  LR  R  M+Q   QY F+Y   +E L
Sbjct: 1182 LHQHLHILSQPS----ADQLSGIDMEFRHLTTLKWTSNRCTVANLPV----NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH------YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 1460          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 153.295 bits (386), Expect = 6.032e-38
Identity = 108/310 (34.84%), Postives = 155/310 (50.00%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVF----SGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSM--NKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVP 2033
            H E ++ ++N     +F+ I       ET     +    +  N HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  + KC QYWP     R   + GD  +EV +  S   + +T R + + M      + +K L  T+W DH  P        +   +++  P++A  II HCSAG+GRTG+FI+ID  L R+ +  + V+IY  +  LR  R  MVQTE QY FI+  + +  +  G ++VP
Sbjct: 1683 HIERLRMNNNAGFQSEFESI-------ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP----SRGTATYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1959          

HSP 2 Score: 113.235 bits (282), Expect = 2.492e-25
Identity = 96/312 (30.77%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLET----------QNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS-MNKYE-KTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKVP---SEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             H H   + + S     DQ   I  + + L T           N+ V    N  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +      +  R   +S +N  E +TV+Q H   W D   P T+D F++F      +      +  I VHC +G GRT  FI +   L R++     V+++ T+  LR  R  M+Q   QY F+Y   +E L
Sbjct: 1963 LHQHLHILSQPS----ADQLSGIDMEFRHLTTLKWTSNRCTVANLPV----NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH------YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 2241          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 152.91 bits (385), Expect = 6.097e-38
Identity = 108/310 (34.84%), Postives = 155/310 (50.00%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVF----SGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSM--NKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVP 2033
            H E ++ ++N     +F+ I       ET     +    +  N HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  + KC QYWP     R   + GD  +EV +  S   + +T R + + M      + +K L  T+W DH  P        +   +++  P++A  II HCSAG+GRTG+FI+ID  L R+ +  + V+IY  +  LR  R  MVQTE QY FI+  + +  +  G ++VP
Sbjct: 1635 HIERLRMNNNAGFQSEFESI-------ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP----SRGTATYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1911          

HSP 2 Score: 113.235 bits (282), Expect = 2.177e-25
Identity = 96/312 (30.77%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLET----------QNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS-MNKYE-KTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKVP---SEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             H H   + + S     DQ   I  + + L T           N+ V    N  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +      +  R   +S +N  E +TV+Q H   W D   P T+D F++F      +      +  I VHC +G GRT  FI +   L R++     V+++ T+  LR  R  M+Q   QY F+Y   +E L
Sbjct: 1915 LHQHLHILSQPS----ADQLSGIDMEFRHLTTLKWTSNRCTVANLPV----NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH------YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 2193          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 152.91 bits (385), Expect = 6.143e-38
Identity = 108/310 (34.84%), Postives = 155/310 (50.00%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVF----SGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSM--NKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVP 2033
            H E ++ ++N     +F+ I       ET     +    +  N HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  + KC QYWP     R   + GD  +EV +  S   + +T R + + M      + +K L  T+W DH  P        +   +++  P++A  II HCSAG+GRTG+FI+ID  L R+ +  + V+IY  +  LR  R  MVQTE QY FI+  + +  +  G ++VP
Sbjct: 1420 HIERLRMNNNAGFQSEFESI-------ETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP----SRGTATYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1696          

HSP 2 Score: 113.235 bits (282), Expect = 2.347e-25
Identity = 96/312 (30.77%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLET----------QNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS-MNKYE-KTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKVP---SEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             H H   + + S     DQ   I  + + L T           N+ V    N  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +      +  R   +S +N  E +TV+Q H   W D   P T+D F++F      +      +  I VHC +G GRT  FI +   L R++     V+++ T+  LR  R  M+Q   QY F+Y   +E L
Sbjct: 1700 LHQHLHILSQPS----ADQLSGIDMEFRHLTTLKWTSNRCTVANLPV----NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH------YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 1978          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330394)

HSP 1 Score: 186.037 bits (471), Expect = 1.217e-48
Identity = 184/666 (27.63%), Postives = 288/666 (43.24%), Query Frame = 3
Query:   99 ILPYTNYTINV--RSLNGYGWGNSSS---KTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPS-KANGVILSYTITCKASSVVFNKTLTD----TWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVIT--VRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSP----------LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            + P+ NYT  V  RS        SSS    +  TN+ + G V  F+  +   + I   W  PS +ANGVI  ++I     + + +  + D        +  ++KP   Y+ +I A T+IG G +  +  T+     P++  P     V+      V  S   + I    N+F++  G +R +T++++ +D           S     +W   Q     +Y + LP    Q               F IG T +C N     CNGPL S T Y +  R +T A   T+   +  ++T +  +        ++                    R  ++      D   +DN   P          L  NF  H+  M  DS+ R  ++F+++K   +  +          N  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   ND +    GD  V+++  +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I   +D V+I+  ++ +RK R  MVQTE QY      IH+CL+
Sbjct:  936 LRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFGPEREYRQTM-----PILAPPRPATQVVP---TEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDD-------AKNASGLEMPSWLDVQ-----SYSVWLP---YQAIDPYYPFENRSVEDFTIG-TENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTEMLSSPDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGR--DQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1547          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0273235)

HSP 1 Score: 185.652 bits (470), Expect = 1.646e-48
Identity = 185/660 (28.03%), Postives = 287/660 (43.48%), Query Frame = 3
Query:   99 ILPYTNYTINV--RSLNGYGWGNSSS---KTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPS-KANGVILSYTITCKASSVVFNKTLTD----TWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLN---RSDSDIVVIHGDICPD---DNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            + P+ NYT  V  RS        SSS    +  TN+ + G V  F+  +   + I   W  PS +ANGVI  ++I     + + +  + D        +  ++KP   Y+ +I A T+IG G +  +  T+     P++  P     V+      V  S   + I    N+F++  G +R +T++++ +D           S     +W   Q     +Y + LP    Q               F IG T +C N     CNGPL S T Y +  R +T A   T+   +     +           +    I           RR N   ++  D         PD   + ++  L  NF  H+  M  DS+ R  ++F+++K   +  +          N  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   ND +    GD  V+++  +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I   +D V+I+  ++ +RK R  MVQTE QY      IH+CL+
Sbjct:  920 LRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFGPEREYRQTM-----PILAPPRPATQVVP---TEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDD-------AKNASGLEMPSWLDVQ-----SYSVWLP---YQAIDPYYPFENRSVEDFTIG-TENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGR--DQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0331406)

HSP 1 Score: 185.652 bits (470), Expect = 1.646e-48
Identity = 185/660 (28.03%), Postives = 287/660 (43.48%), Query Frame = 3
Query:   99 ILPYTNYTINV--RSLNGYGWGNSSS---KTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPS-KANGVILSYTITCKASSVVFNKTLTD----TWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLN---RSDSDIVVIHGDICPD---DNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            + P+ NYT  V  RS        SSS    +  TN+ + G V  F+  +   + I   W  PS +ANGVI  ++I     + + +  + D        +  ++KP   Y+ +I A T+IG G +  +  T+     P++  P     V+      V  S   + I    N+F++  G +R +T++++ +D           S     +W   Q     +Y + LP    Q               F IG T +C N     CNGPL S T Y +  R +T A   T+   +     +           +    I           RR N   ++  D         PD   + ++  L  NF  H+  M  DS+ R  ++F+++K   +  +          N  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   ND +    GD  V+++  +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I   +D V+I+  ++ +RK R  MVQTE QY      IH+CL+
Sbjct:  920 LRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFGPEREYRQTM-----PILAPPRPATQVVP---TEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDD-------AKNASGLEMPSWLDVQ-----SYSVWLP---YQAIDPYYPFENRSVEDFTIG-TENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGR--DQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0073522)

HSP 1 Score: 185.652 bits (470), Expect = 2.027e-48
Identity = 185/660 (28.03%), Postives = 287/660 (43.48%), Query Frame = 3
Query:   99 ILPYTNYTINV--RSLNGYGWGNSSS---KTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPS-KANGVILSYTITCKASSVVFNKTLTD----TWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLN---RSDSDIVVIHGDICPD---DNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            + P+ NYT  V  RS        SSS    +  TN+ + G V  F+  +   + I   W  PS +ANGVI  ++I     + + +  + D        +  ++KP   Y+ +I A T+IG G +  +  T+     P++  P     V+      V  S   + I    N+F++  G +R +T++++ +D           S     +W   Q     +Y + LP    Q               F IG T +C N     CNGPL S T Y +  R +T A   T+   +     +           +    I           RR N   ++  D         PD   + ++  L  NF  H+  M  DS+ R  ++F+++K   +  +          N  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   ND +    GD  V+++  +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I   +D V+I+  ++ +RK R  MVQTE QY      IH+CL+
Sbjct:  920 LRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFGPEREYRQTM-----PILAPPRPATQVVP---TEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDD-------AKNASGLEMPSWLDVQ-----SYSVWLP---YQAIDPYYPFENRSVEDFTIG-TENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGR--DQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330393)

HSP 1 Score: 184.882 bits (468), Expect = 3.362e-48
Identity = 185/660 (28.03%), Postives = 287/660 (43.48%), Query Frame = 3
Query:   99 ILPYTNYTINV--RSLNGYGWGNSSS---KTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPS-KANGVILSYTITCKASSVVFNKTLTD----TWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLN---RSDSDIVVIHGDICPD---DNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            + P+ NYT  V  RS        SSS    +  TN+ + G V  F+  +   + I   W  PS +ANGVI  ++I     + + +  + D        +  ++KP   Y+ +I A T+IG G +  +  T+     P++  P     V+      V  S   + I    N+F++  G +R +T++++ +D           S     +W   Q     +Y + LP    Q               F IG T +C N     CNGPL S T Y +  R +T A   T+   +     +           +    I           RR N   ++  D         PD   + ++  L  NF  H+  M  DS+ R  ++F+++K   +  +          N  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   ND +    GD  V+++  +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I   +D V+I+  ++ +RK R  MVQTE QY      IH+CL+
Sbjct:  920 LRPHRNYTFTVVVRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFGPEREYRQTM-----PILAPPRPATQVVP---TEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDD-------AKNASGLEMPSWLDVQ-----SYSVWLP---YQAIDPYYPFENRSVEDFTIG-TENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGR--DQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFMLC--RGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprb (protein tyrosine phosphatase receptor type b [Source:ZFIN;Acc:ZDB-GENE-101108-3])

HSP 1 Score: 171.014 bits (432), Expect = 1.373e-43
Identity = 121/327 (37.00%), Postives = 174/327 (53.21%), Query Frame = 3
Query: 1113 KSPL-TFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDY-YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIR---SKVPSEAI-IVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            +SP+   NF +H   ++ DS+  L ++F+ +K  V +++TQN     G N +KNRY NI PY   RV+L+ L+D     YINA+ I            P N   + YIATQGPL   ++       DFWRMV E NV  +V +T+  E G  KC  YWP    D      GD +V+++      E +I   ++   S  +Y + V+Q H T W DH  P T+  +  +   +R   ++  S  I +VHCSAGVGRTG+FI++D  L ++  R   V+IY  +F+LR  R  MVQTE QY +I+  + + L  R L    ERD P  P
Sbjct: 1587 RSPVQAANFESHLAKLQSDSSYLLSEEFEGLKD-VGRIQTQNAARLLG-NRNKNRYNNILPYDSTRVRLSCLEDDPCSDYINANYI------------PGNNFRWEYIATQGPLPGTKD-------DFWRMVWEQNVHSLVMVTQCVERGMVKCDHYWP---TDSEPLCYGDIVVQLLSEKVFPEWTIRDFKISCESQLRYPRMVRQFHYTIWPDHGVPDTTQSLIQFVRTVRDFINRTNSPGISVVHCSAGVGRTGTFIVLDRALQQL-DRNCTVDIYGCVFDLRLHRSYMVQTECQYAYIHQCVRDVLRARKLGC--ERDNPLFP 1886          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprb (protein tyrosine phosphatase receptor type b [Source:ZFIN;Acc:ZDB-GENE-101108-3])

HSP 1 Score: 171.014 bits (432), Expect = 1.373e-43
Identity = 121/327 (37.00%), Postives = 174/327 (53.21%), Query Frame = 3
Query: 1113 KSPL-TFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDY-YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIR---SKVPSEAI-IVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            +SP+   NF +H   ++ DS+  L ++F+ +K  V +++TQN     G N +KNRY NI PY   RV+L+ L+D     YINA+ I            P N   + YIATQGPL   ++       DFWRMV E NV  +V +T+  E G  KC  YWP    D      GD +V+++      E +I   ++   S  +Y + V+Q H T W DH  P T+  +  +   +R   ++  S  I +VHCSAGVGRTG+FI++D  L ++  R   V+IY  +F+LR  R  MVQTE QY +I+  + + L  R L    ERD P  P
Sbjct: 1587 RSPVQAANFESHLAKLQSDSSYLLSEEFEGLKD-VGRIQTQNAARLLG-NRNKNRYNNILPYDSTRVRLSCLEDDPCSDYINANYI------------PGNNFRWEYIATQGPLPGTKD-------DFWRMVWEQNVHSLVMVTQCVERGMVKCDHYWP---TDSEPLCYGDIVVQLLSEKVFPEWTIRDFKISCESQLRYPRMVRQFHYTIWPDHGVPDTTQSLIQFVRTVRDFINRTNSPGISVVHCSAGVGRTGTFIVLDRALQQL-DRNCTVDIYGCVFDLRLHRSYMVQTECQYAYIHQCVRDVLRARKLGC--ERDNPLFP 1886          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprjb.2 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131120-137])

HSP 1 Score: 150.599 bits (379), Expect = 5.615e-40
Identity = 103/307 (33.55%), Postives = 154/307 (50.16%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKL----NKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVP----SEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLS 2024
            +  +F+    DSN     ++++++         N    +  N  KNRY N+ PY  +RVKL    N  DDYINA+ +              N    +IA QGPL         TI  FWRM+ EN V  IV LT+  E GK KC +YWP + +    F      + V  T+  E   +T R  ++   + E+T  V+Q H T+W DH  P T++ +  +   +R  +     +   +VHCSAGVGRTG+FI ID  +S+I +R   V+IY  + ++R  R  MVQTE QY ++Y   ++ +  R +S
Sbjct:    8 YEEYFKQKCADSNHGFAIEYEELR--FVGTAQANTAALALENKEKNRYLNVLPYDASRVKLLKCENPFDDYINANYV-----------PGYNSRKEFIAAQGPLP-------VTINKFWRMIWENKVYTIVMLTKCNELGKVKCEKYWPSETD----FYHN---ISVTTTSETELDDWTIRDFSIKNVETEETCNVRQFHFTAWPDHGVPETTEVLIEFRHLVREHMNQYSCTSPTVVHCSAGVGRTGTFIAIDHLISQI-ERDSMVDIYGIVHDMRMHRALMVQTEDQYVYLYQCAYDLIQSRTMS 286          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 157.532 bits (397), Expect = 1.271e-39
Identity = 113/327 (34.56%), Postives = 160/327 (48.93%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMN--KYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQR---GLSKVPERDRPANPQSISHSQS 2081
            H E +K + N  L  +++ I   Q    E  N+ V    N  KNRY N+  Y H RV L  +D     DYINA+ I   R  N             YIATQGPL E       T  DFWRMV E     +V +TR EE  + KC QYWP +  D          V+V + ++ E + F  R  ++  N     + V+Q   T+W DH  P        +   +++  P +A  +IVHCSAGVGRTG FI+ID  L R+++    V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++V  R   A  Q+++ +++
Sbjct:  216 HMERLKANDNLHLSQEYESIDPGQQFTWEHSNLEV----NKQKNRYANVIAYDHTRVILAPVDGIMGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TFADFWRMVWEQRAATVVMMTRLEEKSRVKCDQYWPSRGTDSFG------AVQVSLLDTMELATFCVRTFSLHKNGSNERREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVIVHCSAGVGRTGCFIVIDAMLERLRQER-AVDVYGHVTLMRSQRNYMVQTEDQYGF----IHEALLEAVACGNTEVAARSLYAYIQTLTQTEA 508          

HSP 2 Score: 138.272 bits (347), Expect = 2.161e-33
Identity = 96/259 (37.07%), Postives = 127/259 (49.03%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNR  NI PY+  RV L  +      DYINAS I              +    YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E G+EKC QYWP + + R  +   D + E  M       I  E  +T + +   +TV+Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R++     V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct:  540 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFI--------------DGYRAYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP----QYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYE-GAVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAGLEYL 772          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 157.147 bits (396), Expect = 4.359e-39
Identity = 106/299 (35.45%), Postives = 149/299 (49.83%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMN--KYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            H E +K + N +L  +++ I   Q    E  N+ V    N  KNRY N+  Y H+RV L  ++     DYIN++ I   R  N             YIATQGPL E       T GDFWRMV E     +V +TR EE  + KC QYWP +  +         +++V + ++ E + F  R  ++  N    ++ V+Q   T+W DH  P        +   +++  P +A  II HCSAGVGRTG FI+ID  L RIK     V+IY  +  +R  R  MVQTE QY FI+  + E +
Sbjct: 1230 HTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEV----NKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNA------------YIATQGPLPE-------TFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTETYG------MIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHE-KTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAV 1498          

HSP 2 Score: 138.658 bits (348), Expect = 3.977e-33
Identity = 97/259 (37.45%), Postives = 128/259 (49.42%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNR  NI PY+  RV L  +      DYIN+S I         +G        YIATQGPL E  E       DFWRM+ ENN  I+V LT+  E G+EKC QYWP + + R  +   D + E  M       I  E  +T + +   +TV+Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R++     V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1554 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNM----PQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1789          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 168.318 bits (425), Expect = 1.712e-42
Identity = 114/322 (35.40%), Postives = 163/322 (50.62%), Query Frame = 3
Query: 1122 LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSR-ENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            LT  F  HF  ++ DSN  L  +++++K   +   +   L+    N  KNRY NI PY   RVKL  +DD     YINAS +              N    YIATQGPL   ++       DFW+MV E NV IIV +T+  E G+ KC  YWP    D+ ++  GD +V+++  +   E +I   ++ +       + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++    D V+I+  + +LR  R  MVQTE QY ++Y  + + L  R L    E+D P  P
Sbjct: 1547 LTAQFEEHFSKLQTDSNYLLSREYENLKDFGRDQSSDTALLPE--NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYM-----------PGINFRREYIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP---MDQDSYYYGDLIVQMLSESVLPEWTIREFKICSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQVDT-VDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVLRARKLRN--EQDNPLFP 1842          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 168.318 bits (425), Expect = 1.787e-42
Identity = 114/322 (35.40%), Postives = 163/322 (50.62%), Query Frame = 3
Query: 1122 LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            LT  F  HF  ++ DSN  L  +++++K   +   +   L+    N  KNRY NI PY   RVKL  +DD     YINAS +              N    YIATQGPL   ++       DFW+MV E NV IIV +T+  E G+ KC  YWP    D+ ++  GD +V+++  +   E +I   ++ +       + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++    D V+I+  + +LR  R  MVQTE QY ++Y  + + L  R L    E+D P  P
Sbjct: 1797 LTAQFEEHFSKLQTDSNYLLSREYENLKDFGRDQSSDTALLPE--NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYM-----------PGINFRREYIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP---MDQDSYYYGDLIVQMLSESVLPEWTIREFKICSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQVDT-VDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVLRARKLRN--EQDNPLFP 2092          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 167.933 bits (424), Expect = 2.113e-42
Identity = 114/322 (35.40%), Postives = 163/322 (50.62%), Query Frame = 3
Query: 1122 LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSR-ENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            LT  F  HF  ++ DSN  L  +++++K   +   +   L+    N  KNRY NI PY   RVKL  +DD     YINAS +              N    YIATQGPL   ++       DFW+MV E NV IIV +T+  E G+ KC  YWP    D+ ++  GD +V+++  +   E +I   ++ +       + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++    D V+I+  + +LR  R  MVQTE QY ++Y  + + L  R L    E+D P  P
Sbjct: 1685 LTAQFEEHFSKLQTDSNYLLSREYENLKDFGRDQSSDTALLPE--NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYM-----------PGINFRREYIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP---MDQDSYYYGDLIVQMLSESVLPEWTIREFKICSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQVDT-VDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVLRARKLRN--EQDNPLFP 1980          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 167.933 bits (424), Expect = 2.409e-42
Identity = 114/322 (35.40%), Postives = 163/322 (50.62%), Query Frame = 3
Query: 1122 LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            LT  F  HF  ++ DSN  L  +++++K   +   +   L+    N  KNRY NI PY   RVKL  +DD     YINAS +              N    YIATQGPL   ++       DFW+MV E NV IIV +T+  E G+ KC  YWP    D+ ++  GD +V+++  +   E +I   ++ +       + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++    D V+I+  + +LR  R  MVQTE QY ++Y  + + L  R L    E+D P  P
Sbjct: 1865 LTAQFEEHFSKLQTDSNYLLSREYENLKDFGRDQSSDTALLPE--NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYM-----------PGINFRREYIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP---MDQDSYYYGDLIVQMLSESVLPEWTIREFKICSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQVDT-VDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVLRARKLRN--EQDNPLFP 2160          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 167.933 bits (424), Expect = 2.485e-42
Identity = 114/322 (35.40%), Postives = 163/322 (50.62%), Query Frame = 3
Query: 1122 LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            LT  F  HF  ++ DSN  L  +++++K   +   +   L+    N  KNRY NI PY   RVKL  +DD     YINAS +              N    YIATQGPL   ++       DFW+MV E NV IIV +T+  E G+ KC  YWP    D+ ++  GD +V+++  +   E +I   ++ +       + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++    D V+I+  + +LR  R  MVQTE QY ++Y  + + L  R L    E+D P  P
Sbjct: 1783 LTAQFEEHFSKLQTDSNYLLSREYENLKDFGRDQSSDTALLPE--NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYM-----------PGINFRREYIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP---MDQDSYYYGDLIVQMLSESVLPEWTIREFKICSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQVDT-VDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVLRARKLRN--EQDNPLFP 2078          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptpn20 (protein tyrosine phosphatase, non-receptor type 20 [Source:MGI Symbol;Acc:MGI:1196295])

HSP 1 Score: 165.622 bits (418), Expect = 2.915e-44
Identity = 115/303 (37.95%), Postives = 149/303 (49.17%), Query Frame = 3
Query: 1119 PLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLV-FSGGNI----HKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            PL FN  A    M+   N     +  DI ++  +LE   +   F+ GN      KNRY +I PY   RV L K  DYINAS I + +   +          +YIATQGPL E       TI DFW+MVLENN  +I  +TR  E G  KC  YWP    + + F      +E           FT RV  +      K+  VK L  T W DH  P ++DF   Y  Y+R    +  ++VHCSAGVGRTG FI +D   S I+K     +I N +  +RK RC M+QT+ QY F Y I+ E L
Sbjct:  139 PLIFNSSAR-SAMRDCLNTLQKKEELDIIREFLELEQMTLPDDFNSGNTLQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEY---------FYIATQGPLPE-------TIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLETFHVTQ----YFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFSAIEKNYS-FDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVL 419          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 172.17 bits (435), Expect = 5.328e-44
Identity = 115/310 (37.10%), Postives = 159/310 (51.29%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K     L      +    N  KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R   V    N     ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct: 1038 NFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAE--NRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIIRAQKDSKV 1320          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 171.785 bits (434), Expect = 6.849e-44
Identity = 115/310 (37.10%), Postives = 159/310 (51.29%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K     L      +    N  KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R   V    N     ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct:  852 NFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEI--AENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIIRAQKDSKV 1134          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 171.4 bits (433), Expect = 1.054e-43
Identity = 115/310 (37.10%), Postives = 159/310 (51.29%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K     L      +    N  KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R   V    N     ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct:  945 NFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEI--AENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIIRAQKDSKV 1227          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 159.844 bits (403), Expect = 7.079e-40
Identity = 114/322 (35.40%), Postives = 163/322 (50.62%), Query Frame = 3
Query: 1119 PLTFNFHAHFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMN--KYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDK-VEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQR---GLSKVPER 2039
            P+T +   H E +K + + +L  +++ I   Q    E  N+      N  KNRY N+  Y H+RV L  L+     DYINA+ +   R  N             YIATQGPL E       T GDFWRMV E     +V +TR EE  + KC QYWP++  +   F      ++V + ++ E + F  R  ++  N    ++ V+    T+W DH  P        +   +++  P +A  I+VHCSAGVGRTG FI+ID  L RIK  T+K V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++VP R
Sbjct: 1333 PIT-DMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNL----EANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNA------------YIATQGPLPE-------TFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIK--TEKTVDVYGHVTLMRSQRNYMVQTEDQYGF----IHEALLEAVGCGNTEVPAR 1618          

HSP 2 Score: 137.117 bits (344), Expect = 1.354e-32
Identity = 96/259 (37.07%), Postives = 128/259 (49.42%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNR  NI PY+ +RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWR + ENN  I+V LT+  E G+EKC QYWP + + R  +   D + E  M       I  E  +T + +   +TV+Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R++     V+I+ T+  LR  R  MVQTE +Y F +    E L
Sbjct: 1664 NKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP----QYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1899          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt
Match: sp|O55082|PTN20_MOUSE (Tyrosine-protein phosphatase non-receptor type 20 OS=Mus musculus OX=10090 GN=Ptpn20 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.039e-43
Identity = 115/303 (37.95%), Postives = 149/303 (49.17%), Query Frame = 3
Query: 1119 PLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLV-FSGGNI----HKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            PL FN  A    M+   N     +  DI ++  +LE   +   F+ GN      KNRY +I PY   RV L K  DYINAS I + +   +          +YIATQGPL E       TI DFW+MVLENN  +I  +TR  E G  KC  YWP    + + F      +E           FT RV  +      K+  VK L  T W DH  P ++DF   Y  Y+R    +  ++VHCSAGVGRTG FI +D   S I+K     +I N +  +RK RC M+QT+ QY F Y I+ E L
Sbjct:  139 PLIFNSSAR-SAMRDCLNTLQKKEELDIIREFLELEQMTLPDDFNSGNTLQNRDKNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEY---------FYIATQGPLPE-------TIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLETFHVTQ----YFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFSAIEKNYS-FDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVL 419          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt
Match: sp|Q64455|PTPRJ_MOUSE (Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 4.315e-43
Identity = 115/310 (37.10%), Postives = 159/310 (51.29%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K     L      +    N  KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R   V    N     ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct:  926 NFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEI--AENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIIRAQKDSKV 1208          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt
Match: sp|Q12913|PTPRJ_HUMAN (Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 4.893e-43
Identity = 115/311 (36.98%), Postives = 162/311 (52.09%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K   + Q +    L  + G   KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R  TV          ++Q H TSW DH  P T+D    F      Y++   P   I+VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct: 1025 NFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRG---KNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKV 1307          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt
Match: sp|Q13332|PTPRS_HUMAN (Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 165.236 bits (417), Expect = 7.913e-41
Identity = 119/344 (34.59%), Postives = 170/344 (49.42%), Query Frame = 3
Query: 1098 PDDNDKSPL---TFNFHA--------------HFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMN--KYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQR---GLSKVPER 2039
            PD   +SPL    F+F +              H E +K + + +L  +++ I   Q    E  N+ V    N  KNRY N+  Y H+RV L  ++     DYINA+ +         +G    C + YIATQGPL E       T GDFWRMV E     IV +TR EE  + KC QYWP++  +   F      ++V + ++ E + F  R  ++  N    ++ V+Q   T+W DH  P        +   +++  P +A  I+VHCSAGVGRTG FI+ID  L RIK     V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++VP R
Sbjct: 1349 PDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEV----NKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYV---------DG--YRCQNAYIATQGPLPE-------TFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPE-KTVDVYGHVTLMRSQRNYMVQTEDQYSF----IHEALLEAVGCGNTEVPAR 1659          

HSP 2 Score: 141.354 bits (355), Expect = 3.711e-33
Identity = 98/259 (37.84%), Postives = 128/259 (49.42%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ ENN  I+V LT+  E G+EKC QYWP + + R  +   D + E  M       I  E  +T + +   +TV+Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R++     V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1705 NKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP----QYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1940          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt
Match: sp|P35992|PTP10_DROME (Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4)

HSP 1 Score: 164.466 bits (415), Expect = 1.635e-40
Identity = 105/303 (34.65%), Postives = 154/303 (50.83%), Query Frame = 3
Query: 1122 LTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            L  NF  H+  M  DS+ R  ++F+++K   +  +          N  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   ND +    GD  V+++  +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I   +D V+I+  ++ +RK R  MVQTE QY      IH+CL+
Sbjct: 1253 LIKNFAEHYRLMSADSDFRFSEEFEELKHVGR--DQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFMLC--RGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINT-SDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: gnl|BL_ORD_ID|22110209 (tr|A0A4Y2C1H8|A0A4Y2C1H8_ARAVE Tyrosine-protein phosphatase 10D OS=Araneus ventricosus OX=182803 GN=Ptp10D_1 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 9.929e-45
Identity = 186/678 (27.43%), Postives = 291/678 (42.92%), Query Frame = 3
Query:   63 NKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSS-----SKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPS-KANGVILSYTITC------KASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITV--------RTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQ--QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            N SF  +     + P+ NYT  V  ++GY           SKT QT + + G V  F   +   + +   W  PS + NGV+  Y +T       K     F  T +     + + ++P + Y+ EI A T +G G     +  +S    P+   P   P+V+   +   + +   + +    + F+N  G I  +T++++ +D           S+    TWG  Q      Y +    P  Q+       +      FV+GA     +     CNGPL +A+ Y I  R +TT    T+   T         RT +   ++    + L +   + +         ++   +  D + I          +     +F  H+  M  DS+ R  ++F+ +K   + +     ++ V    N  KNR+ NI PY H+R+KL   DD     YINA+ I              N    +I TQGPL   R+       DFWRMV E N   IV LTR  E G+EKC  YWP    D      GD  ++VI+ N  +   +T     VS N   + V+  H T+W D   P     +  +   +R ++ ++   I+VHCSAGVGR+G+FI +D  L  I+K  D V+I+  +F +RK R  MVQ E QY      IH+CL+
Sbjct:  908 NVSFEEVNTFRGLKPHHNYTFLVSVISGYETATVRRSRPLSKTFQTLESVPGRVHFFRAVDVKPSEVTLQWSLPSNEQNGVLTGYKVTYYIKGTPKRRQEFFEPTESR---GVVTGLQPGMDYVFEIQAHTKVGPG-----STAVSEEATPIWPPPPLEPNVVPKVVGRTSST---IKVEFGSHFFSNVNGKIIAYTIIVAEDD-------AKDSSALRMPTWGDVQ-----QYSLW---PPYQVLEPYYPFNHSLVEDFVVGA--DSCHGIKGYCNGPLKAASTYRIKLRAFTTPTAFTDTFFTYPIQTEPDNRTLLAGILVPLIVLVLAVGVALLWRRRRLAPFAKKAKHAKGDAMSIADSEV--ITSRPVKLIDFGQHYRIMAADSDFRFSEEFELLKNVGRDRACNAADLPV----NRPKNRFTNILPYDHSRIKLMPTDDEEGTDYINANYI-----------PGYNSPREFIVTQGPLHSTRD-------DFWRMVWEQNSRAIVMLTRCIEKGREKCDHYWP---FDMQPVYYGD--IQVILLNESQYHHWTISEFKVSRNDQSRVVRHFHFTTWPDFGVPEPPQILVKFVRSVRERIGNDPKPIVVHCSAGVGRSGTFIALDRVLQHIQKH-DYVDIFGIVFEMRKERVWMVQNEQQYI----CIHQCLL 1523          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: gnl|BL_ORD_ID|17104105 (tr|A0A077Z1H9|A0A077Z1H9_TRITR Y phosphatase domain containing protein OS=Trichuris trichiura OX=36087 GN=TTRE_0000181801 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.529e-43
Identity = 110/302 (36.42%), Postives = 155/302 (51.32%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTS----DFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            +F  H   M  DS+    ++F+ +K   + L      +    N  KNR+ NI PY ++RVKL+ +DD     YINA+ I           S  N    YIATQGP+   R+       DFWRMV E     IVNLTR  E G+EKC QYWP      I    GD  VEV++ N      +T R   +     ++ VK  H T+W D   P       DF+  + A I + V  + ++VHCSAGVGR+G+FI +D+ L  ++   D ++++ T++ +RK R  MVQ+E QY F    IH CL+
Sbjct:   95 DFAKHMMVMSADSDFLFSEEFELLKPVGRTLSMAAADL--PCNRTKNRFTNILPYDYSRVKLSSVDDDEGSDYINANYI-----------SGYNNPREYIATQGPMPSTRD-------DFWRMVWEQQCLAIVNLTRCVEKGREKCDQYWPLDAKTMI---YGD--VEVVVLNESRLPYWTIREFLLQKGGVQRRVKNFHFTAWPDFGVPDQPKVLIDFVRLFRAQINAIV-HKPVVVHCSAGVGRSGTFIALDQLLQHVRSADDVIDVFETVYQMRKERVWMVQSEQQYVF----IHHCLL 366          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: gnl|BL_ORD_ID|27434433 (tr|K9KG28|K9KG28_HORSE Receptor-type tyrosine-protein phosphatase eta-like protein (Fragment) OS=Equus caballus OX=9796 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.631e-43
Identity = 112/310 (36.13%), Postives = 162/310 (52.26%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKL----NKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKV 2030
            NF A+F+  + DSN    ++++D+K  +  +           N  KNRY N+ PY  +RVKL    +  DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E N+  IV LT+  E G+ KC +YWP K     A   GD  + V MT+      +T R  TV   +  ++  ++Q H TSW DH  P T+D    F      Y++   P   ++VHCSAGVGRTG+FI ID  + +I+   + V++Y  +++LR  R  MVQTE QY F+   + + +  +  SKV
Sbjct:   34 NFEAYFKKQQADSNCGFAEEYEDLK--IVGINLPKYAAELAENRGKNRYNNVLPYDISRVKLSIQTHSTDDYINANYMPGYHSKRD-----------FIATQGPLP-------NTLKDFWRMVWEKNIYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGD--ITVAMTSESVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPVLVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIIRSQRDSKV 316          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: gnl|BL_ORD_ID|20329160 (tr|A0A1S3HMA1|A0A1S3HMA1_LINUN receptor-type tyrosine-protein phosphatase eta isoform X3 OS=Lingula unguis OX=7574 GN=LOC106156488 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 6.483e-43
Identity = 108/305 (35.41%), Postives = 162/305 (53.11%), Query Frame = 3
Query: 1125 TFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTS----DFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQ 2012
            T  F  H E   RDS+    D+++ +K+     E       S  N  KNRY NI P+ H+RVKL  +DD     YINA+ +       +           +IA QGPL   ++       DFWRM+ E NV ++V +T+  E G+ KC QYWP    D  A   GD +V+  M +    S +T R+L V + ++ + +KQ H T W DH CP ++    +F++    +I  +     I+VHCSAGVGRTG+FI +D  L  I++  ++V+I+  +  +R+ RC MVQTE QY +I+  I + + Q
Sbjct: 1552 TSQFKEHVEKYHRDSDLLFSDEYKTVKELAPSYEWLEAEKPS--NRCKNRYTNILPFDHSRVKLLPIDDDEGSDYINANYMPGYRSKRE-----------FIAAQGPLPATKD-------DFWRMIWEQNVTLVVMVTQCVERGRIKCEQYWP---KDTEAEYYGDLVVQ--MRSESTLSDYTIRILDVQLGEFSRVLKQFHFTKWPDHGCPESTTLLINFVQNVRMHISHRPNRGPILVHCSAGVGRTGTFIAVDRLLQHIREH-NEVDIFGLVLEMRENRCNMVQTEDQYIYIHECIKDAIAQ 1830          

HSP 2 Score: 78.1814 bits (191), Expect = 6.452e-11
Identity = 68/236 (28.81%), Postives = 121/236 (51.27%), Query Frame = 3
Query:  258 WGFPSKAN--GVILSYTITCKASSVVFNKTLT--DTWINITSSIKPDILYILEISASTSIGAGEK----IYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITK-SSYSEL-TWGACQGVNKCT-YEILLPEP---GSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFT 923
            W  P++ N  G+I  Y I      +  NK +       +  +S+  +  Y ++++A T +G GEK     Y N+T  P   P+ + PA      + S A+V D+R Q+++ +P + F ++ GI+R  +++++ + +    +S + K + +  L TWG  + + K T Y I   EP   G+   R++RA + ++    +IG+    + ++S  CNGPL S   Y I  R YTT G+T
Sbjct: 1231 WEAPTRENKNGIITGYVIYYTDGEISKNKKIDIGSQKSSTITSLSAEKSYQVKVAARTRVGEGEKETAPTYVNLTSGP---PIFVAPANT--FAKVSTASVEDARKQISLQVPSSPFGSENGIVRNISVIVAEDSEAGKPESDVRKDNKFPTLKTWGQVKDLEKITPYAIKEVEPNPWGTAGQRQRRAATPYE---IIIGSQDCSNVATSKYCNGPLPSGRTYCIRIRGYTTNGYT 1458          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: gnl|BL_ORD_ID|20302295 (tr|A0A1S3HM82|A0A1S3HM82_LINUN receptor-type tyrosine-protein phosphatase eta isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156488 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 7.018e-43
Identity = 108/305 (35.41%), Postives = 162/305 (53.11%), Query Frame = 3
Query: 1125 TFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTS----DFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQ 2012
            T  F  H E   RDS+    D+++ +K+     E       S  N  KNRY NI P+ H+RVKL  +DD     YINA+ +       +           +IA QGPL   ++       DFWRM+ E NV ++V +T+  E G+ KC QYWP    D  A   GD +V+  M +    S +T R+L V + ++ + +KQ H T W DH CP ++    +F++    +I  +     I+VHCSAGVGRTG+FI +D  L  I++  ++V+I+  +  +R+ RC MVQTE QY +I+  I + + Q
Sbjct: 1580 TSQFKEHVEKYHRDSDLLFSDEYKTVKELAPSYEWLEAEKPS--NRCKNRYTNILPFDHSRVKLLPIDDDEGSDYINANYMPGYRSKRE-----------FIAAQGPLPATKD-------DFWRMIWEQNVTLVVMVTQCVERGRIKCEQYWP---KDTEAEYYGDLVVQ--MRSESTLSDYTIRILDVQLGEFSRVLKQFHFTKWPDHGCPESTTLLINFVQNVRMHISHRPNRGPILVHCSAGVGRTGTFIAVDRLLQHIREH-NEVDIFGLVLEMRENRCNMVQTEDQYIYIHECIKDAIAQ 1858          

HSP 2 Score: 78.1814 bits (191), Expect = 6.362e-11
Identity = 68/236 (28.81%), Postives = 121/236 (51.27%), Query Frame = 3
Query:  258 WGFPSKAN--GVILSYTITCKASSVVFNKTLT--DTWINITSSIKPDILYILEISASTSIGAGEK----IYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITK-SSYSEL-TWGACQGVNKCT-YEILLPEP---GSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFT 923
            W  P++ N  G+I  Y I      +  NK +       +  +S+  +  Y ++++A T +G GEK     Y N+T  P   P+ + PA      + S A+V D+R Q+++ +P + F ++ GI+R  +++++ + +    +S + K + +  L TWG  + + K T Y I   EP   G+   R++RA + ++    +IG+    + ++S  CNGPL S   Y I  R YTT G+T
Sbjct: 1231 WEAPTRENKNGIITGYVIYYTDGEISKNKKIDIGSQKSSTITSLSAEKSYQVKVAARTRVGEGEKETAPTYVNLTSGP---PIFVAPANT--FAKVSTASVEDARKQISLQVPSSPFGSENGIVRNISVIVAEDSEAGKPESDVRKDNKFPTLKTWGQVKDLEKITPYAIKEVEPNPWGTAGQRQRRAATPYE---IIIGSQDCSNVATSKYCNGPLPSGRTYCIRIRGYTTNGYT 1458          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ENSAMXT00000013855.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000961.1:187509:263844:-1 gene:ENSAMXG00000013469.2 transcript:ENSAMXT00000013855.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.511e-40
Identity = 112/321 (34.89%), Postives = 166/321 (51.71%), Query Frame = 3
Query: 1128 FNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS--RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
              F AH   ++ DSN  L  +++D+K  V + +  +V +    N  KNRY NI PY   RVKL+ +DD     YINAS I   ++  +           YI TQGPL   ++       DFW+MV E NV  IV +T+  E G+ KC  YWP  + D + +   +DL+  +++ S   E +I   ++ +     + + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI +D  L ++  R D V++Y  +F+LR  R  MVQTE QY +++  + + L  R L    E++ P  P
Sbjct: 1392 LQFEAHLTKLQADSNYLLSQEYEDLKD-VGRNQPLDVALLPE-NRGKNRYNNILPYDSTRVKLSCVDDDLCSDYINASYIPGNNFRRE-----------YIGTQGPLPGTKD-------DFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWP-FDQDPLYY---EDLIVQMLSESVLPEWTIREFKICSEDQLNHSRIVRHFHYTVWPDHGVPETTQSLIQFVRTTRDYINRTPGSGPTVVHCSAGVGRTGTFIGLDRILQQLDTR-DTVDVYGAVFDLRLHRSHMVQTERQYTYLHQCVRDVLRARKLRN--EQENPLYP 1685          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ENSAMXT00000031392.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000961.1:187509:307650:-1 gene:ENSAMXG00000013469.2 transcript:ENSAMXT00000031392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 2.642e-40
Identity = 112/321 (34.89%), Postives = 166/321 (51.71%), Query Frame = 3
Query: 1128 FNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS--RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
              F AH   ++ DSN  L  +++D+K  V + +  +V +    N  KNRY NI PY   RVKL+ +DD     YINAS I   ++  +           YI TQGPL   ++       DFW+MV E NV  IV +T+  E G+ KC  YWP  + D + +   +DL+  +++ S   E +I   ++ +     + + V+  H T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI +D  L ++  R D V++Y  +F+LR  R  MVQTE QY +++  + + L  R L    E++ P  P
Sbjct: 1508 LQFEAHLTKLQADSNYLLSQEYEDLKD-VGRNQPLDVALLPE-NRGKNRYNNILPYDSTRVKLSCVDDDLCSDYINASYIPGNNFRRE-----------YIGTQGPLPGTKD-------DFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWP-FDQDPLYY---EDLIVQMLSESVLPEWTIREFKICSEDQLNHSRIVRHFHYTVWPDHGVPETTQSLIQFVRTTRDYINRTPGSGPTVVHCSAGVGRTGTFIGLDRILQQLDTR-DTVDVYGAVFDLRLHRSHMVQTERQYTYLHQCVRDVLRARKLRN--EQENPLYP 1801          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ptprb (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:103042836])

HSP 1 Score: 160.229 bits (404), Expect = 3.749e-40
Identity = 114/319 (35.74%), Postives = 163/319 (51.10%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTE-RVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            +F +H   ++ DSN    ++F+D+K  V + +T +       N  KNRY NI PY   RVKL  L+D     +INAS I    +  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E G+ KC QYWP    DR     G+ +V ++  +     I  E ++       Y + V+  + T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++  R   V+IY ++ +LR  R  MVQTESQY F++  + + L  R L    E++ P  P
Sbjct: 1598 HFESHLSKLQADSNYLFSEEFEDLKD-VGRNQTLDAARLPE-NRCKNRYNNILPYDATRVKLLCLEDDPCSDFINASFIPGNSFGRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWP---TDREPLYYGELVVHMLSESVLSEWIIREFKISREGQLSYPRIVRHFNYTVWPDHGVPETTQSLIQFVRTVRDYIDRAPTSGPTVVHCSAGVGRTGTFIVLDRALQQLDSR-GTVDIYGSVRDLRLHRIHMVQTESQYMFLHQCVRDVLRARKLRC--EQENPLYP 1890          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ptprb (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:103042836])

HSP 1 Score: 160.229 bits (404), Expect = 3.753e-40
Identity = 114/319 (35.74%), Postives = 163/319 (51.10%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTE-RVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            +F +H   ++ DSN    ++F+D+K  V + +T +       N  KNRY NI PY   RVKL  L+D     +INAS I    +  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E G+ KC QYWP    DR     G+ +V ++  +     I  E ++       Y + V+  + T W DH  P TT   ++F      YI     S   +VHCSAGVGRTG+FI++D  L ++  R   V+IY ++ +LR  R  MVQTESQY F++  + + L  R L    E++ P  P
Sbjct: 1598 HFESHLSKLQADSNYLFSEEFEDLKD-VGRNQTLDAARLPE-NRCKNRYNNILPYDATRVKLLCLEDDPCSDFINASFIPGNSFGRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWP---TDREPLYYGELVVHMLSESVLSEWIIREFKISREGQLSYPRIVRHFNYTVWPDHGVPETTQSLIQFVRTVRDYIDRAPTSGPTVVHCSAGVGRTGTFIVLDRALQQLDSR-GTVDIYGSVRDLRLHRIHMVQTESQYMFLHQCVRDVLRARKLRC--EQENPLYP 1890          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ENSAMXT00000012844.2 (receptor-type tyrosine-protein phosphatase S-like [Source:NCBI gene;Acc:103032152])

HSP 1 Score: 158.303 bits (399), Expect = 1.657e-39
Identity = 114/304 (37.50%), Postives = 153/304 (50.33%), Query Frame = 3
Query: 1143 HFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKY----EKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIK-KRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQ 2012
            H E +K + N RL  +++ +   Q    E  N+ V    N  KNRY N+  Y H RV L  +D     DYINA+ I   R  N             YIATQGPL E       T GDFWRMV E     +V +T+ EE  + KC QYWP +  D         LV+V + ++ E + F  R  T S++K      + V+Q   T+W DH  P        +   +++  P +A  + VHCSAGVGRTG FI+ID  L RI+ +RT  V+IY  +  +R  R  MVQTE QY F    IHE L++
Sbjct:  904 HTELLKANDNLRLSQEYESVDPGQQFTWEHSNLEV----NKPKNRYANVIAYDHTRVILAPVDGIMGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TFGDFWRMVWEQRAASVVMMTKLEEKSRIKCDQYWPSRGTDTYG------LVQVTLLDTMELATFCVR--TFSLHKSGCNERREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVAVHCSAGVGRTGCFIVIDAMLERIRHERT--VDIYGHVTLMRSQRNYMVQTEDQYGF----IHEALLE 1170          

HSP 2 Score: 139.043 bits (349), Expect = 2.478e-33
Identity = 97/259 (37.45%), Postives = 128/259 (49.42%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E G+EKC QYWP + + R  +   D + E  M       I  E  +T + +   +TV+Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R++     V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1228 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP----QYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GAVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1463          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 1.824e-35
Identity = 96/249 (38.55%), Postives = 130/249 (52.21%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKN---NDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYE-KTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQ 1970
            N  KNRY NI PY  +RV+L+ ++     DYINAS I         NG      + +IA QGP       K  TI DFWRM+ E N   IV +T  +E    KCSQYWPDK       +  S  D  V V  T  +    F  +++     K++ + V Q H TSW D   P T   M  +   +++  PS +  I+VHCSAGVGRTG+FI+ID  L  I+    +V+++  +  +R  RCQMVQT+ Q
Sbjct:   59 NKDKNRYINILPYDQSRVQLSPIESVPGSDYINASYI---------NGY--REKNKFIAAQGP-------KEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKGCWTYGSVRVSVEDITVLVDYTIRK----FCVQLVGEGPGKHQARLVTQFHFTSWPDFGVPFTPIGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAMLDMIQAE-QRVDVFGFVSRIRAQRCQMVQTDLQ 284          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 142.895 bits (359), Expect = 2.353e-35
Identity = 94/260 (36.15%), Postives = 135/260 (51.92%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYE--KTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIY-TIIHECL 2006
            N  KNRYGNI  Y H+RV LN LD     DYINA+ +   +            T +YIATQGPL +       T+G FWRM+ +     I+ +T   E G+ KC +YWPD ++       GD  ++V + ++   S +  R   V     E  + V+Q H T W DH  P  +  +  +   I++  P  A  ++VHCSAG GRTG +++ID  L  + +    ++IYN +  LR  R  MVQTE QY FI+  ++  CL
Sbjct:  941 NRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYR-----------THHYIATQGPLPD-------TVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDGSD-----VYGD--IKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLD-MAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACL 1174          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 141.739 bits (356), Expect = 2.556e-35
Identity = 95/260 (36.54%), Postives = 132/260 (50.77%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDK-----NNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHE 2000
            N  KNRY NI PY + RV L  L+     DYINAS +         NG      + +IA QG     + PK  T+ D+WRM+ E N   IV +T  +E  + KC+QYWPD+      N R++      LV+  +          + V  +   K  + + Q H TSW D   P     M  +   +++  P  A  I+VHCSAGVGRTG+FI+ID  L  I+    KV+++  +  +R  RCQMVQT+ QY FIY  + E
Sbjct:  211 NKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYV---------NGY--QEKNKFIAAQG-----KGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVDYTI-----RKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTE-RKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLE 448          

HSP 2 Score: 129.028 bits (323), Expect = 2.963e-31
Identity = 95/287 (33.10%), Postives = 141/287 (49.13%), Query Frame = 3
Query: 1179 LIDQFQD---IKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKL-----NKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTSDFMEFYAAYIRSK---VPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHE 2000
            L D+F+    +K Q +++ T N+      N+ KNR   I PY  NRV +      +  DYIN S I                 D ++A QGPL +       T+ DFWRMV E   C IV LT  EE G+EKC++YWP +       + GD ++E+   NS ++  +T R  +VS  +  K+  ++Q H   W +   P     M    A ++ +     +  I VHCSAG GRTG+F  +   L R+K     ++++ T+ +LR  R  MVQT  QY F Y ++ E
Sbjct:  481 LEDEFKKLTTVKIQNEKMRTGNL----PANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFI-----------DGYRQKDAFLAGQGPLQQ-------TVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEG----TITYGDIIIELKQENSHDS--YTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERVKTE-GILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQE 738          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000174.1 (pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 gene:ENSPMAG00000000154.1 transcript:ENSPMAT00000000174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 4.387e-34
Identity = 103/317 (32.49%), Postives = 156/317 (49.21%), Query Frame = 3
Query: 1113 KSPLTFN-FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKY---EKTVKQLHMTSWLDHSCPTTSD----FMEFYAAYIRSKVPSEAIIVHC----SAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQ 2012
            ++P+ F+ F  +++  + DS     +++Q++    K    +   +    N  KNRY NI P+   RVKL  ++D     YINA+ I     + +           YIA QGPL   RE       DFWRMV E  V  IV LT   E G+ KC  YWP    D      GD  + ++M   + +  +T R L V        ++++   H T+W DH  P T+D    F+  +  ++ +      I+VHC    SAGVGRTG+FI +D  L  I K+ + ++IY  + ++R  R  MVQTE QY F    IH+C+++
Sbjct: 1113 RNPVPFSKFPDYYKKREADSGYLFSEEYQELSSVGKGQAMEAATL--AENRTKNRYTNILPFDVTRVKLASVEDIPHSDYINANYIKGHSSSRE-----------YIAAQGPLAGTRE-------DFWRMVWEQKVNQIVMLTNCVERGQPKCECYWP---MDITPVRYGD--IGLVMEWDKPSPEWTIRHLVVKAQHKTDEKRSLYHFHFTAWPDHGVPDTTDSLTNFVRLFRTHVNTTNKGGPIVVHCRCGSSAGVGRTGTFISLDHLLQDIDKKPE-IDIYGIVHDMRMSRVLMVQTEMQYIF----IHKCILK 1399          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003525.1 (pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 gene:ENSPMAG00000003196.1 transcript:ENSPMAT00000003525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 1.816e-33
Identity = 92/253 (36.36%), Postives = 132/253 (52.17%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL--DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT----VKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPS------EAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCF 1979
            N  KNRY +I PY HNRVKL+     DYINAS   V  + + +          YIA QGPL        +T GDFW+M+ E    +IV +T+ EE GK KC QYWP  + D+ A+  GD  V V + + +  +    R L++S +K+       V  + + SW DH  P   + +      +R +V S       A++VHCSAGVGR+G++I +D  L R  +    V++Y  +F LR  R  MVQ E ++  
Sbjct:  429 NTKKNRYSDILPYDHNRVKLSGEGESDYINASY--VDGYKSSIR---------YIAAQGPL-------ENTAGDFWQMIWEKKSSVIVMVTKCEEMGKVKCFQYWPHPDEDKRAY--GD--VTVTIMDEKPYADIVIRTLSISHSKHRGFGAHWVTHVQLVSWPDHGVPEDPNLL----LKLRRRVNSFNGAGCTAVVVHCSAGVGRSGTYIGLD-CLVRQLENEGHVDVYGCVFRLRHQRPLMVQVEVRFAI 654          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 101.679 bits (252), Expect = 6.850e-24
Identity = 92/284 (32.39%), Postives = 123/284 (43.31%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL--DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLEN---NVCIIVNLTRSEENGKEKCSQYWPDKN-----------------NDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVS--MNKYEKTVKQLHMTSWLDHSCPT-TSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDE------ELSRIKKRTDKVE----------IYNTLFNLRKCRCQMVQTESQYCFIY 1985
            N  +NRY NI PY+ NRV L  L  +DYINAS + V     ++ G       YYIATQGP  +       T   FW+M   N   +  +IV +T   E  +EKC QYWP                    ND   F S   +  V +   ++    T+  LT +  +    KTV   +   W D + P      ME  A           IIVHCSAGVGRTG+FI +D       +   I +R+   +          I   +  LR  R +MVQT+ Q+ FIY
Sbjct:   52 NDARNRYVNIMPYERNRVHLKTLSGNDYINASYVKV-----NVPGQSIE-PGYYIATQGPTRK-------TWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIY 322          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 70.0922 bits (170), Expect = 7.610e-13
Identity = 49/143 (34.27%), Postives = 73/143 (51.05%), Query Frame = 3
Query: 1236 VLVFSGGNI-HKNRYGNIKPYQHNRVKLNK-------------------LDDYINASRICVRHWNTDLNGSPCNCTDY-----YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRI 1589
            V++ SG  +  KNRY +I PY+H+RV L K                   LD+YINA+ + +  ++ + N S    T       YIATQ P+        ST+ DF+  +L N V ++++LT   ENG EKC +YW + N + I
Sbjct:  519 VIISSGVELGAKNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMP-------STVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYWQEGNYNGI 654          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 55.4546 bits (132), Expect = 2.288e-8
Identity = 41/134 (30.60%), Postives = 55/134 (41.04%), Query Frame = 3
Query: 1266 KNRYGNIKPYQHNRVKLN----------------------------------KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYW 1565
            KNRY NI PY+H+RVKL                                   K +DYINA+ + +   N D           YIATQ PL        ST+ DFW+++  N V +I++L   +E    K   YW
Sbjct:  411 KNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFK---------YIATQAPLP-------STMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYW 528          

HSP 2 Score: 47.7506 bits (112), Expect = 5.119e-6
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 3
Query: 1800 SEAIIVHCSAGVGRTGSFILIDEELSRIKKRT---DKVEIYNT--------LFNLRKCRCQMVQTESQYCFIY 1985
            S  ++VHCSAG GRTG F+ +D  LS +   T   +K++++N         +  LRK R  MVQ  +QY   Y
Sbjct:  659 SSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACY 731          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 153.295 bits (386), Expect = 2.343e-39
Identity = 104/302 (34.44%), Postives = 144/302 (47.68%), Query Frame = 3
Query: 1134 FHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYE---KTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            F  H   M  D +    ++++ ++   +     + L     N +KNRY NI  Y H+RV L  L+     DYINA+ I              N +  +IA+QGPL E       T  DFWRMV E    IIV LT+ EE G+ KC QYWPD+             + V    +   S +  R   VS  + E   + V+Q H TSW DH  P     +      + S  P  A  +IVHCSAGVGRTG+FI +D  L R  +    ++++  +  +R  R  MVQTESQY FI+  + E +I
Sbjct:    7 FAMHVRRMHMDGDIGFSEEYEMVQPNDETFTWHHSL--HPANKYKNRYANIVAYDHSRVLLTPLEGVLESDYINANYI-----------DGYNRSGAFIASQGPLPE-------TFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRGTRNYG------ALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQE-GTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVI 281          

HSP 2 Score: 128.257 bits (321), Expect = 4.499e-31
Identity = 94/264 (35.61%), Postives = 125/264 (47.35%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERV-----LTVSMNKYEKTVKQLHMTSWLDHSCPTTS----DFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNRY NI PY+  RV L+        DYINAS I   H               YIATQ P+     P+  T  DFWRM+ E    +IV LTR EE GK KC +YWP         S G  L + I+    E   +++ V     LT +  K  + V+Q   T W D   P +     D +     + + +  +  I VHCS GVGRTG F  +   + R+K     ++++ T+ +LR  R  MVQT+ QY F YT I E L
Sbjct:  336 NAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNH-----------RLKAYIATQAPV-----PR--TFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWP---------SDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKW-QQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAE-GLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYL 570          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 144.821 bits (364), Expect = 1.173e-38
Identity = 92/256 (35.94%), Postives = 134/256 (52.34%), Query Frame = 3
Query: 1254 GNIHKNRYGNIKPYQHNRVKLN--KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHM--TSWLDHSCPTTSDFMEFYAAYIRSKVPSEA-IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             N  KNRY N+ PY+  RV+L+    +DYINA+ I V     D      + T +YIATQGPL        +T  DFW+M+ E  V ++  +T  +E GK KC +YWPD  N  +         EV +        F +R + V   +  K+++  H+    W DH  P +   M  + AY+RS   S+A ++VHCSAG+GRTG+ I +D  L  + +R    +I  T+ +LR+ R  M+QT+ QY F Y    E L
Sbjct:   55 ANTDKNRYRNVLPYEATRVRLSGSSGEDYINANHIRVL---VD------DDTYHYIATQGPL-------PNTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLGG---RFEVSLLKQTNYDSFVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPRSPVEMVQFVAYMRSLATSQAPVVVHCSAGIGRTGALIAVDVALG-LMERDKPFDINQTIRDLREQRQGMIQTKDQYIFCYKACLEVL 290          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 149.443 bits (376), Expect = 4.394e-38
Identity = 108/303 (35.64%), Postives = 150/303 (49.50%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTD-YYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYE--KTVKQLHMTSWLDHSCPTT-SDFMEFYAAYIRSKVPSEA-IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLI 2009
            +F  H   M+R  +     +++ I        T ++      N HKNRY NI  Y H+RVKL   +D     YINA            N  P    D  YIA QGPL E       T  DFWRMV E N   I+ LT  +E  ++KC+QYWP +     + S  D  + V + +  E + +  R L+V     +  + VKQ H TSW DH  PT+  + + F     R+  P    ++VHCSAGVGRTG+FI+ID  L +I +    V+I   +  LR+ R  MVQTE QY FI+  + + +I
Sbjct:    5 DFEQHVARMRRSGDLFFTTEYERIPVPEHVTATHSL---DPVNQHKNRYINIVAYDHSRVKLQDFEDEPGSDYINA------------NFLPGYRRDNAYIAAQGPLAE-------TCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRG----SLSYED--ITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEE-KTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAII 278          

HSP 2 Score: 123.25 bits (308), Expect = 1.840e-29
Identity = 93/264 (35.23%), Postives = 128/264 (48.48%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLN-----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERV--LTVSMNKYEKTVKQLHMTSWLDHSCPTTSDF-------MEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            N  KNRY N+ PY   RV+L+     +  DYINA+ I         +G     T  +IATQ P+ E       TI DFWRMV E N C IV L +  E  K K  +YWP K    I F S    + V M +  ++     R+  LT +     + V+Q H TSW + + P            +     Y +++     IIVHCSAGVGRTG F  +   + R+K     V+++ T+  LR+ R  MVQT+ QY F Y ++ E L
Sbjct:  333 NKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYI---------DGYMAKRT--FIATQAPIPE-------TIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQP--ITFGS----LVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEEN-PLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERLKAEA-MVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYL 570          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO31736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX30])

HSP 1 Score: 149.058 bits (375), Expect = 6.069e-38
Identity = 100/263 (38.02%), Postives = 137/263 (52.09%), Query Frame = 3
Query: 1254 GNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTER-----VLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             N +KNRY NI  Y H+RV L +++     DYINAS I         +G+P +    +IA+QGPL    E       DFWRMV E N   IV LT   E GK KC +YWPDK           +    +     ++ IF E      +L+ +     + V+Q H T W D   P  +  +  +   +R+  P +A  +IVHCSAGVGRTG++I+ID  L + KK +  V+I N L  LRK R  MVQT+ QY FI++ + E L
Sbjct:   44 ANKNKNRYANIVAYDHSRVVLERVNGDEDSDYINASFI------HGYDGTPRS----FIASQGPLPPAFE-------DFWRMVWEQNSQSIVMLTNLVELGKTKCHKYWPDKT----------ETYGGVTVTLHQSEIFAEYEIRTFILSKAKQSGSRMVRQFHFTVWPDKGVPQYATAVLAFRRKVRALNPRDAGPVIVHCSAGVGRTGAYIVIDAMLEQAKK-SRTVDIRNYLIALRKDRPHMVQTKEQYSFIHSAVLEAL 278          

HSP 2 Score: 100.138 bits (248), Expect = 5.477e-22
Identity = 83/262 (31.68%), Postives = 126/262 (48.09%), Query Frame = 3
Query: 1254 GNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKT--VKQLHMTSWLDHSCPTTS----DFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
             N +KNRY NI  Y H+R+ L +++     DYINAS I   H +   N         +IATQ PL E       T+ DFWRMV + ++  IV L    E  +E   +YWPD    +     G   V V+    + + I T+  L V+  K  +T  V+ LH  SW D   P  +    D ++  A   + +  +  ++V CS GVGR+G+F  I   L R+K     ++++  +  +R      V++ +QY F Y II + L
Sbjct:  331 ANKNKNRYANIVAYDHSRLVLERVNGNEDSDYINASFI---HAHRGRNA--------FIATQHPLLE-------TVEDFWRMVTDYDIGTIVMLNNLHELDQE-YPKYWPDHGPTKY----GHIGVSVLSKQEQGDVICTK--LKVTRKKVRRTHEVRHLHHVSWPDKCIPEVACSVLDLLD-EAQTSQQQCGNAPVLVQCSNGVGRSGTFCAISSVLERLKTE-QVIDVFQVIKRIRVNLPGAVESPTQYMFCYQIIQKYL 565          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 141.354 bits (355), Expect = 2.447e-37
Identity = 97/260 (37.31%), Postives = 133/260 (51.15%), Query Frame = 3
Query: 1257 NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSD-FMEFYAAYIRSKV------PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHE 2000
            N+ KNRY ++ PY HNRV L +       DYINAS I         +  P N    YIATQGPL         T+ DFW+MV E  V +IVNLTR  + G  +C +YWP+  ++         + E I  +      F  + L  S  +   TV Q H  SW D + PTT    +EF     R KV       S  I+VHCS GVGRTG +ILID  L+++ +   +++I  T+ +LR  R  MV+T++Q+ F  T + E
Sbjct:   56 NVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFIT--------DHDPRNPA--YIATQGPLAH-------TVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPEDGHETYHIYEVHLVSEHIWCDDYLVRSFYLKNLQTSETR---TVTQFHFLSWPDLNVPTTPKPLLEF-----RRKVNKCFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEFALTAVAE 290          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ENSORLT00000023638.2 (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:101169916])

HSP 1 Score: 168.703 bits (426), Expect = 7.138e-43
Identity = 108/308 (35.06%), Postives = 162/308 (52.60%), Query Frame = 3
Query: 1128 FNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGL 2021
             NF +HF  ++ DS+  L ++++D+K   +     + L+    N  KNRY NI PY   RVKL+ +DD     YINAS I   ++  +           YIATQGPL   ++       DFW+MV E NV  +V +T+  E G+ KC  YWP    D+     GD +V+++  +   E +I   R+ +     + + V+Q H T W DH  P  T   ++F      Y+     S   +VHCSAGVGR+G+FI++D  L ++  R D V+IY  +F+LR  R  MVQTE QY +++  + + L  R L
Sbjct: 1372 MNFESHFNKLQADSHYLLSEEYEDLKDVGRNQPLDSALLPE--NRGKNRYNNILPYDSTRVKLSYVDDDPCSDYINASYIPGNNFRRE-----------YIATQGPLPGTKD-------DFWKMVWEQNVHNVVMVTQCVEKGRVKCDHYWP---FDQDPLYYGDLIVQMLSESVLSEWTIREFRICSEEQLSFSRLVRQFHYTVWPDHGIPDNTQSLIQFVRTVRDYVNRSPGSGPTVVHCSAGVGRSGTFIVLDRVLQQLDVR-DTVDIYGAVFDLRLHRSHMVQTEGQYSYLHHCVRDVLRARKL 1655          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ENSORLT00000023642.2 (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:101169916])

HSP 1 Score: 168.318 bits (425), Expect = 1.061e-42
Identity = 108/308 (35.06%), Postives = 162/308 (52.60%), Query Frame = 3
Query: 1128 FNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGL 2021
             NF +HF  ++ DS+  L ++++D+K   +     + L+    N  KNRY NI PY   RVKL+ +DD     YINAS I   ++  +           YIATQGPL   ++       DFW+MV E NV  +V +T+  E G+ KC  YWP    D+     GD +V+++  +   E +I   R+ +     + + V+Q H T W DH  P  T   ++F      Y+     S   +VHCSAGVGR+G+FI++D  L ++  R D V+IY  +F+LR  R  MVQTE QY +++  + + L  R L
Sbjct: 1572 MNFESHFNKLQADSHYLLSEEYEDLKDVGRNQPLDSALLPE--NRGKNRYNNILPYDSTRVKLSYVDDDPCSDYINASYIPGNNFRRE-----------YIATQGPLPGTKD-------DFWKMVWEQNVHNVVMVTQCVEKGRVKCDHYWP---FDQDPLYYGDLIVQMLSESVLSEWTIREFRICSEEQLSFSRLVRQFHYTVWPDHGIPDNTQSLIQFVRTVRDYVNRSPGSGPTVVHCSAGVGRSGTFIVLDRVLQQLDVR-DTVDIYGAVFDLRLHRSHMVQTEGQYSYLHHCVRDVLRARKL 1855          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ptprfa (protein tyrosine phosphatase receptor type F [Source:NCBI gene;Acc:101157606])

HSP 1 Score: 167.162 bits (422), Expect = 2.047e-42
Identity = 116/333 (34.83%), Postives = 164/333 (49.25%), Query Frame = 3
Query: 1110 DKSPLTF-NFHAHFEFMKRDSNGRLIDQFQDIKQ-QVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKY--EKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISH 2072
            D+ P+   +   H E +K     R   +++ I   Q    E  N+ V    N  KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       T+ DFWRMV E   C IV +TR EE  + KC QYWP +  +         +++V + ++ E +    R  T+S N    ++ V+Q    +W DH  P        +   +++  P  A  ++VHCSAGVGRTG FI+ID  L R+ KR   V+IY  +  +R  R  MVQTE QY FI+ ++ E  +  G ++VP     A+ Q +SH
Sbjct: 1223 DRPPVAVCDLAEHVERLKAHECLRFSQEYESIDPGQQFTWENSNLDV----NKAKNRYANVIAYDHSRVTLTAVDGVPGSDYINANYIDGYRRQNA------------YIATQGPLPE-------TLADFWRMVWEQKTCTIVMMTRLEEKSRVKCDQYWPSRGTETYG------MIQVTLLDTVELAAHVIRTFTISKNNSSDKREVRQFQFLAWPDHGVPEYPTPFLAFVHRVKACNPQRAGPMVVHCSAGVGRTGCFIVIDAMLDRL-KREKSVDIYGQVTCMRAQRNYMVQTEDQYVFIHDVLLEAAMC-GSTEVPAHGLYAHVQKLSH 1524          

HSP 2 Score: 134.42 bits (337), Expect = 7.584e-32
Identity = 102/305 (33.44%), Postives = 145/305 (47.54%), Query Frame = 3
Query: 1137 HAHFEFMKRDSNGRLIDQFQDIKQQVKQLET--QNVLVFSGG----NIHKNRYGNIKPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPT-TSDFMEFYAAYIRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECL 2006
            H  +  +++ S+ R  +    ++Q+ K+L     + L F       N  KNR  NI P++  RV L+ +      DYINAS I         +G        YIATQGPL E  E       D WRM+ E+N  I+V LT+  E G+EKC QYWP + + R  + + D + E  M       I  E  +T S +   KT++Q   T W +   P     F++F     ++K        I VHCS GVGRTG FI +   L RI++    ++++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1513 HGLYAHVQKLSHIRPGETATAMEQEFKKLSNYKAHTLRFISASLLCNKFKNRLMNILPFESTRVCLHPIRGLEGSDYINASFI---------DG--YRKQKAYIATQGPLPETTE-------DLWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFTVDPMAEYNMP----EYILREFKVTNSRDGQSKTIRQFQFTGWPEQGVPQRVEGFIDFIGQVHKTKEQFGQDGPITVHCSTGVGRTGVFITLSIVLERIRQE-GVIDVFQTVKVLRTQRPAMVQTEEQYQLCYRAALEYL 1794          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 166.007 bits (419), Expect = 5.687e-42
Identity = 111/319 (34.80%), Postives = 169/319 (52.98%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            +F +H   ++ DSN  L ++F+D+K  V + +T +V      N  KNRY NI PY   R+KL+ L+D     +INAS I   ++  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E G+ KC QYWP    D      GD +++++  +   E +I   +V++ S   Y + ++  H T W DH  P TT   ++F      Y+     + A +VHCSAGVGRTG+FI +D  L ++  +   +++Y  +F+LR  R  MVQTE QY F++  + + L  R      E++ P  P
Sbjct: 1637 HFESHLAKLQADSNYLLSEEFEDLKD-VGRNQTMDVARLPE-NRGKNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNNYRRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWP---ADTEPLYYGDLVIQMLSESVLPEWTIREFKVISESSCSYPRMLRHFHYTVWPDHGVPETTQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSK-GTIDLYGIVFDLRLHRQHMVQTECQYAFLHQCVRDVL--RARKHRSEQENPLYP 1929          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 165.622 bits (418), Expect = 7.854e-42
Identity = 111/319 (34.80%), Postives = 169/319 (52.98%), Query Frame = 3
Query: 1131 NFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNS-RENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCP-TTSDFMEFYAA---YIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANP 2057
            +F +H   ++ DSN  L ++F+D+K  V + +T +V      N  KNRY NI PY   R+KL+ L+D     +INAS I   ++  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E G+ KC QYWP    D      GD +++++  +   E +I   +V++ S   Y + ++  H T W DH  P TT   ++F      Y+     + A +VHCSAGVGRTG+FI +D  L ++  +   +++Y  +F+LR  R  MVQTE QY F++  + + L  R      E++ P  P
Sbjct: 1726 HFESHLAKLQADSNYLLSEEFEDLKD-VGRNQTMDVARLPE-NRGKNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNNYRRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWP---ADTEPLYYGDLVIQMLSESVLPEWTIREFKVISESSCSYPRMLRHFHYTVWPDHGVPETTQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSK-GTIDLYGIVFDLRLHRQHMVQTECQYAFLHQCVRDVL--RARKHRSEQENPLYP 2018          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 1248.42 bits (3229), Expect = 0.000e+0
Identity = 671/701 (95.72%), Postives = 679/701 (96.86%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 2105
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSP P VI+ +KIPDVLR+SIATVNDSR+QLA+TLPYNHFNNDLGIIRKFTLVISTNDDIYPR STITKSSYS+L              ILLPEPGSQITRKKRAISEWQSRPFVIGAT SCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFS GNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRI+KRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE
Sbjct:  855 MPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSRYQLAVTLPYNHFNNDLGIIRKFTLVISTNDDIYPRNSTITKSSYSDL--------------ILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 1541          

HSP 2 Score: 137.887 bits (346), Expect = 3.486e-33
Identity = 74/102 (72.55%), Postives = 81/102 (79.41%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGN SSKTIQT+QYISGPV+N +  +S     +   W  P  +NG I+ Y I
Sbjct:  595 MPDNSTDSCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNLSSKTIQTSQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFI 696          

HSP 3 Score: 134.806 bits (338), Expect = 4.013e-32
Identity = 71/102 (69.61%), Postives = 80/102 (78.43%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MP+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QY SG + N +  +S     +  +W  P  ANG I+ Y I
Sbjct:  465 MPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLI 566          

HSP 4 Score: 132.88 bits (333), Expect = 1.550e-31
Identity = 70/102 (68.63%), Postives = 80/102 (78.43%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            +P+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QY SG + N +  +S     +  +W  P  ANG I+ Y I
Sbjct:  725 IPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLI 826          

HSP 5 Score: 131.339 bits (329), Expect = 4.320e-31
Identity = 70/102 (68.63%), Postives = 79/102 (77.45%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNST+ CYTINGLNFNSN+KSFSM INDGKIL YTNYTIN+RSLNGYGWGN SSKTI+TNQYISGPV+N    +S     +  +W  P   NG I+ Y I
Sbjct:  335 MPDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFI 436          

HSP 6 Score: 51.6026 bits (122), Expect = 2.130e-6
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLN--FNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            + D S   C  IN  +   ++ +K  S+  ND  + P T+Y +   +LN +GWG++ S ++ T+Q+ISGPV+N +  +    + +  +W  P   NG I+ Y I
Sbjct:  206 LQDPSVRNCSQINNASSFVSTADKHLSLATNDSDVKPATSYLVIATALNEFGWGDAQSISLLTDQFISGPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLI 309          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 1248.42 bits (3229), Expect = 0.000e+0
Identity = 671/701 (95.72%), Postives = 679/701 (96.86%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 2105
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSP P VI+ +KIPDVLR+SIATVNDSR+QLA+TLPYNHFNNDLGIIRKFTLVISTNDDIYPR STITKSSYS+L              ILLPEPGSQITRKKRAISEWQSRPFVIGAT SCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFS GNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRI+KRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE
Sbjct:  725 MPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSRYQLAVTLPYNHFNNDLGIIRKFTLVISTNDDIYPRNSTITKSSYSDL--------------ILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 1411          

HSP 2 Score: 138.658 bits (348), Expect = 1.975e-33
Identity = 73/102 (71.57%), Postives = 82/102 (80.39%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MP+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QYISGPV+N +  +S     +   W  P  +NG I+ Y I
Sbjct:  465 MPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFI 566          

HSP 3 Score: 132.88 bits (333), Expect = 1.285e-31
Identity = 70/102 (68.63%), Postives = 80/102 (78.43%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            +P+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QY SG + N +  +S     +  +W  P  ANG I+ Y I
Sbjct:  595 IPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLI 696          

HSP 4 Score: 131.724 bits (330), Expect = 3.553e-31
Identity = 70/102 (68.63%), Postives = 79/102 (77.45%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNST+ CYTINGLNFNSN+KSFSM INDGKIL YTNYTIN+RSLNGYGWGN SSKTI+TNQYISGPV+N    +S     +  +W  P   NG I+ Y I
Sbjct:  335 MPDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFI 436          

HSP 5 Score: 51.9878 bits (123), Expect = 1.699e-6
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLN--FNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            + D S   C  IN  +   ++ +K  S+  ND  + P T+Y +   +LN +GWG++ S ++ T+Q+ISGPV+N +  +    + +  +W  P   NG I+ Y I
Sbjct:  206 LQDPSVRNCSQINNASSFVSTADKHLSLATNDSDVKPATSYLVIATALNEFGWGDAQSISLLTDQFISGPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLI 309          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 1245.72 bits (3222), Expect = 0.000e+0
Identity = 671/701 (95.72%), Postives = 679/701 (96.86%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 2105
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSP P VI+ +KIPDVLR+SIATVNDSR+QLA+TLPYNHFNNDLGIIRKFTLVISTNDDIYPR STITKSSYS+L              ILLPEPGSQITRKKRAISEWQSRPFVIGAT SCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFS GNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRI+KRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE
Sbjct:   62 MPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSRYQLAVTLPYNHFNNDLGIIRKFTLVISTNDDIYPRNSTITKSSYSDL--------------ILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 748          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 1172.53 bits (3032), Expect = 0.000e+0
Identity = 639/701 (91.16%), Postives = 645/701 (92.01%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 2105
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSP P VI+ +KIPDVLR+SIATVNDSR                                                 GACQG+NKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGAT SCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFS GNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRI+KRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE
Sbjct: 1046 MPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSR-----------------------------------------------PGGACQGLNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 1699          

HSP 2 Score: 137.887 bits (346), Expect = 3.718e-33
Identity = 74/102 (72.55%), Postives = 81/102 (79.41%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGN SSKTIQT+QYISGPV+N +  +S     +   W  P  +NG I+ Y I
Sbjct:  795 MPDNSTDSCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNLSSKTIQTSQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFI 896          

HSP 3 Score: 134.806 bits (338), Expect = 4.021e-32
Identity = 71/102 (69.61%), Postives = 80/102 (78.43%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MP+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QY SG + N +  +S     +  +W  P  ANG I+ Y I
Sbjct:  665 MPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLI 766          

HSP 4 Score: 131.339 bits (329), Expect = 4.250e-31
Identity = 70/102 (68.63%), Postives = 79/102 (77.45%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNST+ CYTINGLNFNSN+KSFSM INDGKIL YTNYTIN+RSLNGYGWGN SSKTI+TNQYISGPV+N    +S     +  +W  P   NG I+ Y I
Sbjct:  535 MPDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFI 636          

HSP 5 Score: 111.309 bits (277), Expect = 8.851e-25
Identity = 59/101 (58.42%), Postives = 68/101 (67.33%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPSKANGVILSYTI 305
            +P+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSS+     N  ++               +  +W  P  ANG I+ Y I
Sbjct:  925 IPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSTSGSIMNLSVASSF--------PSFPLSITWEPPGVANGEIVQYLI 1017          

HSP 6 Score: 51.9878 bits (123), Expect = 2.000e-6
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLN--FNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            + D S   C  IN  +   ++ +K  S+  ND  + P T+Y +   +LN +GWG++ S ++ T+Q+ISGPV+N +  +    + +  +W  P   NG I+ Y I
Sbjct:  406 LQDPSVRNCSQINNASSFVSTADKHLSLATNDSDVKPATSYLVIATALNEFGWGDAQSISLLTDQFISGPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLI 509          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 1172.15 bits (3031), Expect = 0.000e+0
Identity = 639/701 (91.16%), Postives = 645/701 (92.01%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXXXXXXXXXWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGIIRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATPXXXXXXXXXXXGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 2105
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSP P VI+ +KIPDVLR+SIATVNDSR                                                 GACQG+NKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGAT SCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFS GNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRI+KRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE
Sbjct:  855 MPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSR-----------------------------------------------PGGACQGLNKCTYEILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 1508          

HSP 2 Score: 137.887 bits (346), Expect = 4.220e-33
Identity = 74/102 (72.55%), Postives = 81/102 (79.41%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTINVRSLNGYGWGN SSKTIQT+QYISGPV+N +  +S     +   W  P  +NG I+ Y I
Sbjct:  595 MPDNSTDSCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNLSSKTIQTSQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFI 696          

HSP 3 Score: 134.42 bits (337), Expect = 4.567e-32
Identity = 71/102 (69.61%), Postives = 80/102 (78.43%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MP+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QY SG + N +  +S     +  +W  P  ANG I+ Y I
Sbjct:  465 MPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLI 566          

HSP 4 Score: 132.494 bits (332), Expect = 1.764e-31
Identity = 70/102 (68.63%), Postives = 80/102 (78.43%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            +P+NSTD CYTINGLNFNSNNKSFSM INDGKILPYTNYTIN+RSLNGYGWGNSSSKTIQT+QY SG + N +  +S     +  +W  P  ANG I+ Y I
Sbjct:  725 IPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLI 826          

HSP 5 Score: 131.339 bits (329), Expect = 4.747e-31
Identity = 70/102 (68.63%), Postives = 79/102 (77.45%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            MPDNST+ CYTINGLNFNSN+KSFSM INDGKIL YTNYTIN+RSLNGYGWGN SSKTI+TNQYISGPV+N    +S     +  +W  P   NG I+ Y I
Sbjct:  335 MPDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFI 436          

HSP 6 Score: 51.6026 bits (122), Expect = 2.412e-6
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 3
Query:    3 MPDNSTDRCYTINGLN--FNSNNKSFSMIINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVXXXXXXXXX-XXXXXXXWGFPSKANGVILSYTI 305
            + D S   C  IN  +   ++ +K  S+  ND  + P T+Y +   +LN +GWG++ S ++ T+Q+ISGPV+N +  +    + +  +W  P   NG I+ Y I
Sbjct:  206 LQDPSVRNCSQINNASSFVSTADKHLSLATNDSDVKPATSYLVIATALNEFGWGDAQSISLLTDQFISGPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLI 309          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRJ1.019e-4336.98protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ1.059e-4336.98protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ1.086e-4336.98protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRS1.648e-4134.59protein tyrosine phosphatase receptor type S [Sour... [more]
PTPN201.690e-4137.22protein tyrosine phosphatase non-receptor type 20 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-35.866e-3834.84Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.905e-3834.84Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-36.032e-3834.84Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-36.097e-3834.84Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-36.143e-3834.84Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp10D1.217e-4827.63gene:FBgn0004370 transcript:FBtr0330394[more]
Ptp10D1.646e-4828.03gene:FBgn0004370 transcript:FBtr0273235[more]
Ptp10D1.646e-4828.03gene:FBgn0004370 transcript:FBtr0331406[more]
Ptp10D2.027e-4828.03gene:FBgn0004370 transcript:FBtr0073522[more]
Ptp10D3.362e-4828.03gene:FBgn0004370 transcript:FBtr0330393[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprb1.373e-4337.00protein tyrosine phosphatase receptor type b [Sour... [more]
ptprb1.373e-4337.00protein tyrosine phosphatase receptor type b [Sour... [more]
ptprjb.25.615e-4033.55protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprsa1.271e-3934.56protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprsa4.359e-3935.45protein tyrosine phosphatase receptor type Sa [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprb1.712e-4235.40protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb1.787e-4235.40protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb2.113e-4235.40protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb2.409e-4235.40protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb2.485e-4235.40protein tyrosine phosphatase, receptor type B [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpn202.915e-4437.95protein tyrosine phosphatase, non-receptor type 20... [more]
Ptprj5.328e-4437.10protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj6.849e-4437.10protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj1.054e-4337.10protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprs7.079e-4035.40protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55082|PTN20_MOUSE2.039e-4337.95Tyrosine-protein phosphatase non-receptor type 20 ... [more]
sp|Q64455|PTPRJ_MOUSE4.315e-4337.10Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q12913|PTPRJ_HUMAN4.893e-4336.98Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q13332|PTPRS_HUMAN7.913e-4134.59Receptor-type tyrosine-protein phosphatase S OS=Ho... [more]
sp|P35992|PTP10_DROME1.635e-4034.65Tyrosine-protein phosphatase 10D OS=Drosophila mel... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|221102099.929e-4527.43tr|A0A4Y2C1H8|A0A4Y2C1H8_ARAVE Tyrosine-protein ph... [more]
gnl|BL_ORD_ID|171041051.529e-4336.42tr|A0A077Z1H9|A0A077Z1H9_TRITR Y phosphatase domai... [more]
gnl|BL_ORD_ID|274344335.631e-4336.13tr|K9KG28|K9KG28_HORSE Receptor-type tyrosine-prot... [more]
gnl|BL_ORD_ID|203291606.483e-4335.41tr|A0A1S3HMA1|A0A1S3HMA1_LINUN receptor-type tyros... [more]
gnl|BL_ORD_ID|203022957.018e-4335.41tr|A0A1S3HM82|A0A1S3HM82_LINUN receptor-type tyros... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000013855.21.511e-4034.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031392.12.642e-4034.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ptprb3.749e-4035.74receptor-type tyrosine-protein phosphatase beta [S... [more]
ptprb3.753e-4035.74receptor-type tyrosine-protein phosphatase beta [S... [more]
ENSAMXT00000012844.21.657e-3937.50receptor-type tyrosine-protein phosphatase S-like ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008162.11.824e-3538.55pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ptprk2.353e-3536.15protein tyrosine phosphatase receptor type K [Sour... [more]
ptpra2.556e-3536.54protein tyrosine phosphatase receptor type A [Sour... [more]
ENSPMAT00000000174.14.387e-3432.49pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 g... [more]
ENSPMAT00000003525.11.816e-3336.36pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 ge... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP16.850e-2432.39Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP37.610e-1334.27Phosphotyrosine-specific protein phosphatase; invo... [more]
PTP22.288e-830.60Nuclear phosphotyrosine-specific phosphatase invol... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438542.343e-3934.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383041.173e-3835.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481874.394e-3835.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317366.069e-3838.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489492.447e-3737.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023638.27.138e-4335.06receptor-type tyrosine-protein phosphatase beta [S... [more]
ENSORLT00000023642.21.061e-4235.06receptor-type tyrosine-protein phosphatase beta [S... [more]
ptprfa2.047e-4234.83protein tyrosine phosphatase receptor type F [Sour... [more]
PTPRB5.687e-4234.80protein tyrosine phosphatase receptor type B [Sour... [more]
PTPRB7.854e-4234.80protein tyrosine phosphatase receptor type B [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005237.13.486e-3395.72SMESG000005237.1[more]
SMESG000005237.11.975e-3395.72SMESG000005237.1[more]
SMESG000005237.10.000e+095.72SMESG000005237.1[more]
SMESG000005237.13.718e-3391.16SMESG000005237.1[more]
SMESG000005237.14.220e-3391.16SMESG000005237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001036 ID=SMED30001036|Name=Receptor-type tyrosine-protein phosphatase beta|organism=Schmidtea mediterranea sexual|type=transcript|length=2154bp
CAATGCCAGATAATAGCACTGATAGGTGTTATACAATAAATGGATTAAAC
TTTAACTCAAATAACAAATCATTTTCCATGATCATCAATGATGGAAAGAT
TTTGCCTTATACAAATTATACAATTAATGTAAGATCATTGAACGGGTATG
GATGGGGCAATTCATCTAGTAAGACAATTCAGACAAATCAATATATTTCT
GGCCCAGTTTCAAATTTCAATTGTTATAATTCTTCATTCAATTCAATATT
CTGCTCCTGGGGATTTCCGAGCAAAGCGAATGGCGTAATCCTTAGTTACA
CTATAACATGCAAAGCCAGTTCCGTTGTTTTTAATAAAACCTTGACAGAT
ACTTGGATCAACATTACCAGTAGTATTAAGCCAGATATATTATATATTCT
TGAGATTTCGGCATCTACGAGTATTGGAGCTGGAGAGAAAATATATTTTA
ATATAACAATTTCTCCATCACCCGTTCCTCTTGTGATAGATCCTGCCAAA
ATTCCCGATGTCCTACGAGATTCTATCGCAACTGTCAATGATTCTCGGTT
TCAATTGGCTATCACTCTCCCCTATAATCACTTTAATAATGATTTGGGAA
TTATTCGCAAATTCACACTCGTCATATCCACCAATGATGACATTTATCCA
AGGAAAAGCACCATTACGAAATCATCTTATTCAGAATTAACCTGGGGAGC
ATGTCAAGGAGTTAACAAATGTACTTACGAGATCCTGTTACCTGAACCCG
GAAGCCAAATCACTCGAAAGAAACGAGCTATTTCTGAATGGCAAAGTAGG
CCATTTGTGATTGGAGCAACGCCAAGCTGCAGTAACAGTTCGAGCAACAC
TTGCAATGGGCCCCTATTGAGCGCAACAGCATATATAATAGGATTTCGAG
TATATACGACTGCCGGGTTCACAACCGAGGGAGTTATCACCGTTAGAACG
GCTATTAATTGGGCTATTCTTGTGGGATTTTTCGTCTTCCTGCTTCTTTC
AGGTGGTATTGGTTTTGCAGCGTTCTATTTCTACAGGCGCTACAGACGTC
TCAATCGCTCAGATTCAGATATCGTTGTAATACATGGTGATATATGTCCA
GATGACAATGATAAATCACCGTTGACATTTAACTTTCACGCACATTTTGA
ATTCATGAAACGTGACAGTAACGGTAGATTAATTGATCAGTTTCAGGACA
TTAAGCAGCAGGTGAAACAGTTAGAAACCCAAAACGTATTGGTATTTTCG
GGAGGAAACATACATAAAAATAGATATGGCAATATTAAACCTTACCAACA
CAACCGAGTGAAACTGAATAAACTTGATGATTATATCAACGCCAGTAGGA
TTTGTGTCAGACATTGGAACACGGATCTTAATGGGAGCCCATGTAATTGC
ACTGATTATTATATAGCTACCCAAGGCCCGTTAGGCGAAGACAGAGAGCC
GAAAGTTTCAACTATTGGAGATTTCTGGCGGATGGTTTTGGAGAACAATG
TTTGTATCATAGTTAATCTGACCAGATCTGAAGAGAATGGAAAAGAGAAA
TGCAGCCAGTATTGGCCTGATAAGAATAACGACCGAATAGCATTTTCCAG
TGGTGACGACCTAGTTGAAGTCATAATGACGAACTCGAGAGAAAACAGTA
TATTTACTGAAAGAGTTCTTACAGTATCAATGAACAAATATGAGAAAACT
GTCAAGCAATTACACATGACATCATGGCTTGATCATAGCTGTCCCACAAC
CTCTGATTTCATGGAATTCTATGCTGCTTACATAAGATCCAAGGTACCGT
CAGAAGCTATTATAGTGCATTGCAGTGCTGGAGTCGGTCGGACTGGATCA
TTTATTTTGATTGATGAGGAACTCTCGAGAATCAAAAAGAGAACCGATAA
AGTTGAAATTTATAATACTTTGTTTAACCTAAGAAAATGTCGATGCCAGA
TGGTGCAAACTGAATCTCAATATTGCTTCATATACACAATCATCCATGAG
TGCCTCATTCAGAGAGGTCTTTCAAAAGTTCCTGAGCGTGACCGCCCCGC
AAATCCCCAAAGTATCTCCCATTCCCAGTCGTACATTAATCCGATTTTCG
CTGAATAGGGAGCGAGACAGATCTTATTTTTCATTTATTATGATAACATA
TTAT
back to top

protein sequence of SMED30001036-orf-1

>SMED30001036-orf-1 ID=SMED30001036-orf-1|Name=SMED30001036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MPDNSTDRCYTINGLNFNSNNKSFSMIINDGKILPYTNYTINVRSLNGYG
WGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYT
ITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFN
ITISPSPVPLVIDPAKIPDVLRDSIATVNDSRFQLAITLPYNHFNNDLGI
IRKFTLVISTNDDIYPRKSTITKSSYSELTWGACQGVNKCTYEILLPEPG
SQITRKKRAISEWQSRPFVIGATPSCSNSSSNTCNGPLLSATAYIIGFRV
YTTAGFTTEGVITVRTAINWAILVGFFVFLLLSGGIGFAAFYFYRRYRRL
NRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDI
KQQVKQLETQNVLVFSGGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRI
CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNV
CIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSI
FTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPS
EAIIVHCSAGVGRTGSFILIDEELSRIKKRTDKVEIYNTLFNLRKCRCQM
VQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFA
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR013783Ig-like_fold
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR003961FN3_dom
IPR000387TYR_PHOSPHATASE_dom
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0005515protein binding
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 6..26
NoneNo IPR availablePANTHERPTHR19134:SF483PROTEIN TYROSINE PHOSPHATASE 4E, ISOFORM A-RELATEDcoord: 1..284
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 1..284
NoneNo IPR availableCDDcd14548R3-PTPccoord: 40..277
e-value: 9.75838E-66
score: 204.125
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 59..66
score: 70.51
coord: 181..198
score: 36.37
coord: 250..265
score: 27.13
coord: 93..113
score: 37.62
coord: 218..236
score: 66.87
coord: 266..276
score: 63.05
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 8..285
e-value: 7.2E-82
score: 288.0
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 35..281
e-value: 1.9E-63
score: 214.2
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 9..283
score: 39.828
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 182..282
e-value: 3.1E-29
score: 113.1
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1..295
e-value: 1.2E-77
score: 263.2
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 2..284
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 221..231
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 200..274
score: 18.162