TNF receptor-associated factor 1-like

Overview
NameTNF receptor-associated factor 1-like
Smed IDSMED30001022
Length (bp)730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor 1-like (SMED30001022) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor 1-like (SMED30001022) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 1-like (SMED30001022) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 1-like (SMED30001022) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001022

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30001022SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30001022SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30001022SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30001022SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30001022SMESG000049895.1 dd_Smed_v4_6017_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.929 bits (154), Expect = 3.132e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  244 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 456          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.929 bits (154), Expect = 4.080e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  302 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 514          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.929 bits (154), Expect = 4.080e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  302 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 514          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.929 bits (154), Expect = 4.231e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  327 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 539          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.929 bits (154), Expect = 4.231e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  327 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 539          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 47.3654 bits (111), Expect = 4.376e-6
Identity = 28/81 (34.57%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  343 WQIDKISQQKRKE------WIYSKPFYSESSGYKM--CLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTD 561
            W+IDK+ Q+  +        I+S PF S   GYKM  C  +          I +   L++G+FD  LEWPF  A+ I++ D
Sbjct:  267 WKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLD 347          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 75.0998 bits (183), Expect = 4.516e-15
Identity = 56/230 (24.35%), Postives = 111/230 (48.26%), Query Frame = 1
Query:   10 LQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQL-RVNKKLEIEKCDNDIRL------IQTFGNEIFIKFGFFEWQIDKISQQKRKEWI------YSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            L+QK+  M+     ++  + E   E++ L+   R++R E+ET  G++  +R  +  ++ +    +     +   +QQL R +  + +    +D+RL      +Q      F   G   W+I    ++K++  +      YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L+WPFK  VT+ + D G   K +   +   P+ + + +P+   N+ 
Sbjct:  314 LEQKLVSMQMLMSSHSEKLLEVEMELRELR-PLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSV----HDVRLAEMDLKLQVLETASF--NGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIA 536          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.424e-8
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I   S+++      R   ++S  FY+   GYKMCL I  N        ++ + F +MRG  D  L+WPF   VT+ + D  N    I  + RP  + + + +P ++ N+ 
Sbjct:  126 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID-AFRPDISSSSFQRPVSDMNIA 240          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.424e-8
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I   S+++      R   ++S  FY+   GYKMCL I  N        ++ + F +MRG  D  L+WPF   VT+ + D  N    I  + RP  + + + +P ++ N+ 
Sbjct:  126 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID-AFRPDISSSSFQRPVSDMNIA 240          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 55.4546 bits (132), Expect = 1.797e-8
Identity = 49/207 (23.67%), Postives = 92/207 (44.44%), Query Frame = 1
Query:   58 RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            + +E +   M+A+  ++R  + ++E  +  + Q+   +   ++          Q+ E +Q LR     E++ C  D               G F W+I + S+++      R   ++S  FYS   GYKMCL +  N        ++ + F +M+GK+D  L+WPF   VT+ + D  N    I  + RP  +   + +P +  N+ 
Sbjct:  322 KEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDL----------QLAESEQSLR-----ELQFCTYD---------------GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID-AFRPDVSSTSFQRPISEMNIA 497          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 55.4546 bits (132), Expect = 1.797e-8
Identity = 49/207 (23.67%), Postives = 92/207 (44.44%), Query Frame = 1
Query:   58 RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            + +E +   M+A+  ++R  + ++E  +  + Q+   +   ++          Q+ E +Q LR     E++ C  D               G F W+I + S+++      R   ++S  FYS   GYKMCL +  N        ++ + F +M+GK+D  L+WPF   VT+ + D  N    I  + RP  +   + +P +  N+ 
Sbjct:  322 KEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDL----------QLAESEQSLR-----ELQFCTYD---------------GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIID-AFRPDVSSTSFQRPISEMNIA 497          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 65.4698 bits (158), Expect = 1.062e-11
Identity = 60/235 (25.53%), Postives = 107/235 (45.53%), Query Frame = 1
Query:   16 QKMCEMEAKELENA----RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEF--KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            Q++ E +A +L++     RN+ +T  E   +K+ Y SL++ +            Q+E +  N    +      QI  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  V++ + D G   + +   +   P  + + KP+   N+  G  V + 
Sbjct:  290 QRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLS-----------QLEVMAKNAASWNPGVLETQINRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 507          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 65.0846 bits (157), Expect = 1.292e-11
Identity = 60/235 (25.53%), Postives = 107/235 (45.53%), Query Frame = 1
Query:   16 QKMCEMEAKELENA----RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEF--KQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            Q++ E +A +L++     RN+ +T  E   +K+ Y SL++ +            Q+E +  N    +      QI  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  V++ + D G   + +   +   P  + + KP+   N+  G  V + 
Sbjct:  315 QRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLS-----------QLEVMAKNAASWNPGVLETQINRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 532          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 56.6102 bits (135), Expect = 7.786e-9
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I  ++ +       R   +YS  FY+   GYK+CL I  N        ++ + F +M+G++D  L WPFK+ VT  + D  N   ++  + RP  T A + +P N+ NV 
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNR-DSVFDAFRPDVTSASFQRPINDMNVA 344          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 50.8322 bits (120), Expect = 8.793e-7
Identity = 34/116 (29.31%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I +  +++      R   ++S PFY+   GYKMCL I  N      + ++ + F +M+G  D  L WPF   VT+ + D  N    I  + RP  + + + +P +  N+ 
Sbjct:  305 GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVID-AFRPDVSSSSFQRPISEMNIA 419          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 50.447 bits (119), Expect = 1.103e-6
Identity = 34/116 (29.31%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I +  +++      R   ++S PFY+   GYKMCL I  N      + ++ + F +M+G  D  L WPF   VT+ + D  N    I  + RP  + + + +P +  N+ 
Sbjct:  332 GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVID-AFRPDVSSSSFQRPISEMNIA 446          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.1586 bits (152), Expect = 4.542e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  326 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 538          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.1586 bits (152), Expect = 4.547e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  301 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 513          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.1586 bits (152), Expect = 4.547e-11
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  301 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 513          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 55.4546 bits (132), Expect = 1.765e-8
Identity = 49/221 (22.17%), Postives = 103/221 (46.61%), Query Frame = 1
Query:   28 EMEAKELENARNMEETNKEMKALKNEYRSLRSEMETN----TGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            E+  + L   + + +  ++++   N    L  E+E +      +I+Q ++  E + ++ +++  E +Q    + Q+       + K ++ +RL++    +     G F W+I  ++++       R   ++S  FY+   GYK+CL +  N        ++ +   +MRG++D  L WPF+  VT  + D  N    I  + RP  + A + +P + TNV 
Sbjct:  168 ELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHI-LSLEQRVVELQQTLAQKDQV-------LGKLEHSLRLMEEASFD-----GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID-AFRPDLSSASFQRPQSETNVA 374          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 55.4546 bits (132), Expect = 1.765e-8
Identity = 49/221 (22.17%), Postives = 103/221 (46.61%), Query Frame = 1
Query:   28 EMEAKELENARNMEETNKEMKALKNEYRSLRSEMETN----TGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            E+  + L   + + +  ++++   N    L  E+E +      +I+Q ++  E + ++ +++  E +Q    + Q+       + K ++ +RL++    +     G F W+I  ++++       R   ++S  FY+   GYK+CL +  N        ++ +   +MRG++D  L WPF+  VT  + D  N    I  + RP  + A + +P + TNV 
Sbjct:  168 ELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHI-LSLEQRVVELQQTLAQKDQV-------LGKLEHSLRLMEEASFD-----GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID-AFRPDLSSASFQRPQSETNVA 374          
BLAST of TNF receptor-associated factor 1-like vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 2.032e-10
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  327 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQVARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 539          
BLAST of TNF receptor-associated factor 1-like vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 3.177e-10
Identity = 54/220 (24.55%), Postives = 104/220 (47.27%), Query Frame = 1
Query:   55 ARNMEETNKEMKALKN---EYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFK-QIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNV--GVQVIIG 666
            A  ++E +KE++  +    E  S++S +E+    + ++   ++K      + +   + Q+  H Q L V+   +I   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G+  + +   +   P  + + KP+   N+  G  V + 
Sbjct:  326 AEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELE-SVDKSAGQAARNTGLLESQLSRHDQMLSVH---DIRLADMDLRF-QVLETASY--NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA 538          
BLAST of TNF receptor-associated factor 1-like vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.234e-7
Identity = 49/221 (22.17%), Postives = 103/221 (46.61%), Query Frame = 1
Query:   28 EMEAKELENARNMEETNKEMKALKNEYRSLRSEMETN----TGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            E+  + L   + + +  ++++   N    L  E+E +      +I+Q ++  E + ++ +++  E +Q    + Q+       + K ++ +RL++    +     G F W+I  ++++       R   ++S  FY+   GYK+CL +  N        ++ +   +MRG++D  L WPF+  VT  + D  N    I  + RP  + A + +P + TNV 
Sbjct:  168 ELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHI-LSLEQRVVELQQTLAQKDQV-------LGKLEHSLRLMEEASFD-----GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID-AFRPDLSSASFQRPQSETNVA 374          
BLAST of TNF receptor-associated factor 1-like vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 4.368e-7
Identity = 27/110 (24.55%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  331 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSD-RPTDAGWMKPS 630
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP +  + + V D   G   I+  + +P    + +P+
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPT 484          
BLAST of TNF receptor-associated factor 1-like vs. UniProt/SwissProt
Match: sp|Q13077|TRAF1_HUMAN (TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.547e-7
Identity = 49/205 (23.90%), Postives = 95/205 (46.34%), Query Frame = 1
Query:   64 MEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            + E   +++  +N    L  E+E +  A+      I + +++ ++     +++ E QQ L   K   + K +  +RL++    +     G F W+I  ++++       R   ++S  FY+   GYK+CL +  N        ++ +   +MRG++D  L WPF+  VT  + D  N    I  + RP  + A + +P + TNV 
Sbjct:  187 LAELEGKLRVFENIVAVLNKEVEASHLALA---TSIHQSQLDRERILSLEQRVVELQQTL-AQKDQALGKLEQSLRLMEEASFD-----GTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID-AFRPDLSSASFQRPQSETNVA 381          
BLAST of TNF receptor-associated factor 1-like vs. TrEMBL
Match: Q6DEG0 (TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf3 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.010e-11
Identity = 56/230 (24.35%), Postives = 111/230 (48.26%), Query Frame = 1
Query:   10 LQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQL-RVNKKLEIEKCDNDIRL------IQTFGNEIFIKFGFFEWQIDKISQQKRKEWI------YSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            L+QK+  M+     ++  + E   E++ L+   R++R E+ET  G++  +R  +  ++ +    +     +   +QQL R +  + +    +D+RL      +Q      F   G   W+I    ++K++  +      YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L+WPFK  VT+ + D G   K +   +   P+ + + +P+   N+ 
Sbjct:  314 LEQKLVSMQMLMSSHSEKLLEVEMELRELR-PLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSV----HDVRLAEMDLKLQVLETASF--NGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIA 536          
BLAST of TNF receptor-associated factor 1-like vs. TrEMBL
Match: A0A060WD36 (MATH domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00068560001 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.476e-11
Identity = 56/195 (28.72%), Postives = 91/195 (46.67%), Query Frame = 1
Query:  109 RSLRSEMETNTGAINQIRMQIEKVE-----INFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            RS+R E+ET  G +  IR ++  +E      N    + E  Q+  H   L V+   EI   D D+R  Q      F   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G   K +   +   P  + + +P+   N+ 
Sbjct:    9 RSVREEVETLRGTVESIRSRVATLEGGRGGANPATHTLE-TQLSRHDDMLSVH---EIRLADMDLRF-QVLETASF--NGMLIWKIRDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLLWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTAEMNIA 196          
BLAST of TNF receptor-associated factor 1-like vs. TrEMBL
Match: A0A0P7UB07 (TNF receptor-associated factor 3-like (Fragment) OS=Scleropages formosus OX=113540 GN=Z043_109866 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.056e-10
Identity = 57/227 (25.11%), Postives = 107/227 (47.14%), Query Frame = 1
Query:   10 LQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKL----EIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            ++QK+  M+     +   M E   E+++L    RS+R E+E+   ++  IR ++  +E+     S   + +   +QQ+  +  +    EI   D D+R  Q      +   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G   K +   +   P  + + +P+   N+ 
Sbjct:  261 VEQKLSSMQKVLSSHTEKMLEIELELRSL----RSMRDEVESLRNSVENIRSRVTALELGQVGTSSGTQTLKTLEQQMSRHDDMLSVHEIRLADMDLRF-QVLETASY--NGTLIWKIRDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPAGEMNIA 480          
BLAST of TNF receptor-associated factor 1-like vs. TrEMBL
Match: A0A1S3R8U3 (TNF receptor-associated factor OS=Salmo salar OX=8030 GN=LOC106600975 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.152e-10
Identity = 56/195 (28.72%), Postives = 91/195 (46.67%), Query Frame = 1
Query:  109 RSLRSEMETNTGAINQIRMQIEKVE-----INFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            RS+R E+ET  G +  IR ++  +E      N    + E  Q+  H   L V+   EI   D D+R  Q      F   G   W+I    ++K++        +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G   K +   +   P  + + +P+   N+ 
Sbjct:  349 RSVREEVETLRGTVESIRSRVATLEGGRGGANPATHTLE-TQLSRHDDMLSVH---EIRLADMDLRF-QVLETASF--NGMLIWKICDYKRRKQEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTAEMNIA 536          
BLAST of TNF receptor-associated factor 1-like vs. TrEMBL
Match: S4RA88 (TNF receptor-associated factor OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.853e-10
Identity = 47/209 (22.49%), Postives = 104/209 (49.76%), Query Frame = 1
Query:   64 MEETNKEMKALKNEYRSLRSEMETNTGAINQ----IRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIK--YSDRPTDAGWMKPSNNTNVG 648
            + + N+++++L    R+   + + +T A+ +    +R ++  +E          ++ + H+Q+L ++  L ++  +  +++++T G       G   W+I   +++K      R   +YS+PFY+   GYKMC    +N        ++ + F +MRG++D  LEWPF+  VT+++ D G   + +   ++  P    + +P  + NV 
Sbjct:  183 LTQHNEQLQSLHVAQRA--PQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGL-LDTAERRLQVLETAGYS-----GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVA 383          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 58.5362 bits (140), Expect = 1.139e-9
Identity = 56/223 (25.11%), Postives = 97/223 (43.50%), Query Frame = 1
Query:   10 LQQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            +QQKM  +E       R +E T   ++AL  + +  + ++E  +  + Q+   +   ++          Q+ E +Q LR     E++ C  D               G F W+I   S+++      R   ++S  FYS   GYKMCL +  N        ++ + F +MRGK+D  L+WPF   VT+ + D  N    I  + RP  +   + +P +  N+ 
Sbjct:  305 VQQKMTALENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDL----------QLAESEQALR-----ELQFCTYD---------------GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIID-AFRPDISSTSFQRPISEMNIA 496          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 5.809e-9
Identity = 29/92 (31.52%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  385 IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G   K +   +   P  + + +P+   N+ 
Sbjct:   28 LYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTGEMNIA 119          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 54.299 bits (129), Expect = 3.301e-8
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I   S+++      R   ++S  FY+   GYKMCL I  N        ++ + F +MRG  D  L+WPF   VT+ + D  N    I  + RP  + + + +P ++ N+ 
Sbjct:  423 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID-AFRPDISSSSFQRPVSDMNIA 537          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 53.9138 bits (128), Expect = 5.258e-8
Identity = 48/216 (22.22%), Postives = 89/216 (41.20%), Query Frame = 1
Query:   58 RNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVE-INFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFE------------WQIDKISQQKRK-EWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFH--LMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRPTDAG--WMKPSNNTNVGV 651
            R++EE  + + ++K E + LR  +E +          + K E ++ +   D  ++     Q LR +     + C +  RL+     ++      F+            W++    ++K     + S PFY+  SGYK+   + +          +  +  LMRG FD  L WPF+  VT+ V D       +  S  P  A   + +P++ TN  +
Sbjct:  306 RSVEEQRELVSSVKRELKDLRDVLEAD----------LTKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNNFRRPTSETNAAL 511          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 53.5286 bits (127), Expect = 5.528e-8
Identity = 27/114 (23.68%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  331 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXX---XXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSD-RPTDAGWMKPSNNTN 642
            G + W+++  S   R +       ++S PFY+   GYK+CL ++++            +  H M+G+FD +L WP +  + + V D   G   ++  + +P    + +P+   N
Sbjct:  375 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDLQAFQRPTVQRN 488          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.192e-14
Identity = 47/209 (22.49%), Postives = 104/209 (49.76%), Query Frame = 1
Query:   64 MEETNKEMKALKNEYRSLRSEMETNTGAINQ----IRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIK--YSDRPTDAGWMKPSNNTNVG 648
            + + N+++++L    R+   + + +T A+ +    +R ++  +E          ++ + H+Q+L ++  L ++  +  +++++T G       G   W+I   +++K      R   +YS+PFY+   GYKMC    +N        ++ + F +MRG++D  LEWPF+  VT+++ D G   + +   ++  P    + +P  + NV 
Sbjct:  183 LTQHNEQLQSLHVAQRA--PQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGL-LDTAERRLQVLETAGYS-----GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVA 383          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.749e-10
Identity = 31/116 (26.72%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIK--YSDRPTDAGWMKPSNNTNVG 648
            G   W+I   +++K      R   +YS+PFY+   GY+MC    +N        ++ + F +MRG++D  L WPF+  VT+ + D G   + +   +   P  + + +P+++ N+ 
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIA 440          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 65.4698 bits (158), Expect = 2.580e-12
Identity = 41/115 (35.65%), Postives = 59/115 (51.30%), Query Frame = 1
Query:  331 GFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDR-PTDAGWMKPSNNTNVG 648
            G F W+IDK +++           IYS PFY+   GYK+C  L  N      D+Y+ I   LMRG++D  L WPF+  +TI + D  NG+   +  D  P    + +P+ N NV 
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISETFDPDPCSISFQRPTRNINVA 494          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 57.3806 bits (137), Expect = 1.196e-9
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  331 GFFEWQIDKISQQ------KRKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDR--PTDAGWMKPSNNTNVG 648
            G + W+ID+ +++       +   IYS PFY    GYK C  +  N        ++ + F LMRG+FD  L WPF+  VT  + D  + V  I  + R  PT + + +P++N N+ 
Sbjct:  378 GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ-DRVHDIGDTFRPDPTSSSFKRPTSNMNIA 492          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 55.8398 bits (133), Expect = 3.302e-9
Identity = 42/185 (22.70%), Postives = 87/185 (47.03%), Query Frame = 1
Query:  145 AINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVN------KKLEIEKCDNDIRLIQ--TFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI-KYSDRPTDAGWMKPSNNTNVG 648
            A++++R ++ ++ +  Q+  D  +++   ++QL ++      + L I   +  +  +Q  TF + +        W+I  ++ ++      R    YS  F++   GYKMC  I  N      + ++ + F +MRG+FD  L WPF+  VT+ + D  N    I  +   P+ + + +P    N+ 
Sbjct:  273 AVDELRREVGRLNVKLQESDDIIRRL---ERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLL-------WKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHVIDAFRPDPSSSSFQRPRAEMNIA 447          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 53.9138 bits (128), Expect = 1.559e-8
Identity = 28/92 (30.43%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  331 GFFEWQIDKISQQKRKE------WIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXF--HLMRGKFDYKLEWPFKYAVTINVTDTGNGVKT 582
            G F W++D   Q +          I+S PFY+   GYKMCL +N+          +    H+M+G +D  LEWPF   +T+++ D  + + +
Sbjct:  332 GTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDS 423          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 44.669 bits (104), Expect = 1.886e-6
Identity = 29/87 (33.33%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  310 NEIFI-KFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLA--INVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTD 561
            N IF+ K   ++ Q D+      +  I+S PFY+   GYK+ L   +N RD     ++ +   +M+G +D  LEWPFK  +T  + D
Sbjct:    1 NGIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLID 87          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 68.5514 bits (166), Expect = 5.467e-13
Identity = 52/192 (27.08%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  109 RSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIR--LIQTFGNEIFIKFGFFEWQIDKISQQKRKEW------IYSKPFYSESSGYKMC--LAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTI--KYSDRPTDAGWMKPSNNTNVG 648
            R LR EME+  G ++ +R ++  +E   +   +   Q+  H   L V+   EI   D D+R  +++T         G   W+I    ++K+         +YS+PFY+   GYKMC  + +N        ++ + F +MRG++D  L WPFK  VT+ + D G   K +   +   P+ + + +P    N+ 
Sbjct:  232 RQLRDEMESLRGTLDTVRTRLSALEQGGRASLE--TQLNRHDDMLSVH---EIRLADMDLRFQVLETASYN-----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIA 413          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 58.5362 bits (140), Expect = 1.167e-9
Identity = 56/207 (27.05%), Postives = 100/207 (48.31%), Query Frame = 1
Query:   70 ETNKEMKALKNEYRSLRSEMETNTGAI----NQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            + +K++ AL+N    L  E+E ++  +    +Q R+  EK+E      S++ +Q+   ++ L V K L++ + +  +R +Q    +     G F W+I   S ++      R   ++S  FYS   GYKMCL +  N        ++ + F +MR K+D  L+WPF   VT+ + D  N    I  + RP  T   + +P +  N+ 
Sbjct:  296 DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIE----NLSNKIRQL---ERSLTV-KDLQLSEAEQMVRELQYCTYD-----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIID-AFRPDITSTSFQRPVSEMNIA 488          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 58.5362 bits (140), Expect = 1.239e-9
Identity = 56/207 (27.05%), Postives = 100/207 (48.31%), Query Frame = 1
Query:   70 ETNKEMKALKNEYRSLRSEMETNTGAI----NQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            + +K++ AL+N    L  E+E ++  +    +Q R+  EK+E      S++ +Q+   ++ L V K L++ + +  +R +Q    +     G F W+I   S ++      R   ++S  FYS   GYKMCL +  N        ++ + F +MR K+D  L+WPF   VT+ + D  N    I  + RP  T   + +P +  N+ 
Sbjct:  289 DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIE----NLSNKIRQL---ERSLTV-KDLQLSEAEQMVRELQYCTYD-----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIID-AFRPDITSTSFQRPVSEMNIA 481          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 53.5286 bits (127), Expect = 6.970e-8
Identity = 34/116 (29.31%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I   ++++      R   ++S  FY+   GYKMCL I  N        ++ + F +MRG  D  L+WPF   VT+ + D  N    I  + RP  + + + +P ++ N+ 
Sbjct:  420 GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIID-AFRPDISSSSFQRPVSDMNIA 534          
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 51.9878 bits (123), Expect = 2.114e-7
Identity = 35/116 (30.17%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  331 GFFEWQIDKISQQK------RKEWIYSKPFYSESSGYKMCLAI--NVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRP--TDAGWMKPSNNTNVG 648
            G F W+I   ++++      R   ++S  FY+   GYKMCL I  N        ++ + F +MRG  D  L+WPF   VT+ + D  N    I  + RP  T + + +P +  N+ 
Sbjct:  447 GVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIID-AFRPDVTSSSFQRPVSEMNIA 561          
BLAST of TNF receptor-associated factor 1-like vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 375.17 bits (962), Expect = 1.093e-129
Identity = 194/219 (88.58%), Postives = 202/219 (92.24%), Query Frame = 1
Query:   13 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGN----GVKTIKYSDRPTDAGWMKPSNNTNVGVQV 657
            QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKY VT++  D+ N      K+IKYSD P  AGW KPSN+ N  +++
Sbjct:  224 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRI 442          
BLAST of TNF receptor-associated factor 1-like vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 374.015 bits (959), Expect = 3.056e-129
Identity = 194/219 (88.58%), Postives = 202/219 (92.24%), Query Frame = 1
Query:   13 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGN----GVKTIKYSDRPTDAGWMKPSNNTNVGVQV 657
            QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKY VT++  D+ N      K+IKYSD P  AGW KPSN+ N  +++
Sbjct:  231 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMRGKFDYKLEWPFKYTVTVDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRI 449          
BLAST of TNF receptor-associated factor 1-like vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 330.102 bits (845), Expect = 2.890e-112
Identity = 179/219 (81.74%), Postives = 187/219 (85.39%), Query Frame = 1
Query:   13 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRXXXXXXXXXXXFHLMRGKFDYKLEWPFKYAVTINVTDTGN----GVKTIKYSDRPTDAGWMKPSNNTNVGVQV 657
            QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMR                ++  D+ N      K+IKYSD P  AGW KPSN+ N  +++
Sbjct:  224 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDYIDIDFHLMR----------------VDAVDSANRNLICSKSIKYSDYPYLAGWRKPSNDRNNPIRI 426          
BLAST of TNF receptor-associated factor 1-like vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 295.434 bits (755), Expect = 8.870e-100
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
Query:   13 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAIN 444
            QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAIN
Sbjct:  224 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAIN 367          
BLAST of TNF receptor-associated factor 1-like vs. Planmine SMEST
Match: SMESG000049895.1 (SMESG000049895.1)

HSP 1 Score: 294.664 bits (753), Expect = 2.447e-99
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
Query:   13 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAIN 444
            QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAIN
Sbjct:  231 QQKMCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQIEKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIFIKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAIN 374          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF33.132e-1124.55TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.080e-1124.55TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.080e-1124.55TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.231e-1124.55TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.231e-1124.55TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trf-14.376e-634.57TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf34.516e-1524.35TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
BX901915.11.424e-830.17pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.11.424e-830.17pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf2b1.797e-823.67Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.797e-823.67Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.062e-1125.53slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.292e-1125.53slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
hspb67.786e-931.90heat shock protein family B (small) member 6 [Sour... [more]
TRAF28.793e-729.31TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF21.103e-629.31TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf34.542e-1124.55TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf34.547e-1124.55TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf34.547e-1124.55TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf11.765e-822.17TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf11.765e-822.17TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13114|TRAF3_HUMAN2.032e-1024.55TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE3.177e-1024.55TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|P39428|TRAF1_MOUSE1.234e-722.17TNF receptor-associated factor 1 OS=Mus musculus O... [more]
sp|Q6IWL4|TRAF6_DANRE4.368e-724.55TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
sp|Q13077|TRAF1_HUMAN4.547e-723.90TNF receptor-associated factor 1 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q6DEG01.010e-1124.35TNF receptor-associated factor OS=Danio rerio OX=7... [more]
A0A060WD364.476e-1128.72MATH domain-containing protein OS=Oncorhynchus myk... [more]
A0A0P7UB071.056e-1025.11TNF receptor-associated factor 3-like (Fragment) O... [more]
A0A1S3R8U32.152e-1028.72TNF receptor-associated factor OS=Salmo salar OX=8... [more]
S4RA882.853e-1022.49TNF receptor-associated factor OS=Petromyzon marin... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.139e-925.11TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSAMXT00000035169.15.809e-931.52pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2a3.301e-830.17TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf55.258e-822.22TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf65.528e-823.68TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002130.12.192e-1422.49pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.749e-1026.72pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352372.580e-1235.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494641.196e-931.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.302e-922.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487731.559e-830.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291451.886e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.467e-1327.08TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b1.167e-927.05TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.239e-927.05TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.26.970e-829.31TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8082.114e-730.17TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049895.11.093e-12988.58SMESG000049895.1[more]
SMESG000049895.13.056e-12988.58SMESG000049895.1[more]
SMESG000049895.12.890e-11281.74SMESG000049895.1[more]
SMESG000049895.18.870e-100100.00SMESG000049895.1[more]
SMESG000049895.12.447e-99100.00SMESG000049895.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001022 ID=SMED30001022|Name=TNF receptor-associated factor 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=730bp
TATTTGTGATTGCAGCAGAAAATGTGTGAGATGGAAGCGAAAGAACTGGA
AAACGCCAGGAATATGGAGGAAACAAATAAAGAAATGAAGGCATTAAAAA
ATGAGTATCGATCATTGAGAAGCGAAATGGAGACAAATACTGGAGCAATC
AATCAAATCCGGATGCAGATCGAGAAGGTTGAGATAAATTTCCAAAAGCA
AAGTGATGAATTTAAACAAATATATGAGCATCAGCAGCAGTTACGAGTCA
ATAAAAAACTGGAAATAGAGAAATGTGACAATGACATTCGGCTTATTCAA
ACATTTGGAAATGAAATTTTTATAAAATTTGGATTTTTTGAATGGCAAAT
TGATAAAATTTCACAGCAAAAGAGAAAGGAATGGATATACAGCAAGCCAT
TTTATTCTGAGTCATCCGGGTACAAAATGTGTTTGGCGATTAATGTTAGG
GATTATTATATTGATGATTATATTGATATTGATTTCCATTTGATGCGTGG
TAAATTCGATTATAAATTGGAATGGCCATTTAAATATGCAGTAACAATTA
ATGTGACCGATACAGGAAATGGAGTTAAAACAATAAAATATTCTGATAGA
CCTACTGATGCCGGATGGATGAAACCATCAAATAATACAAATGTTGGAGT
TCAAGTTATCATTGGCTTGATATTCAATTAGATTCACAAGCAATAAAAAA
TGATCAGCTGCTGATGAAATGCAGAGTGGA
back to top

protein sequence of SMED30001022-orf-1

>SMED30001022-orf-1 ID=SMED30001022-orf-1|Name=SMED30001022-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
MCEMEAKELENARNMEETNKEMKALKNEYRSLRSEMETNTGAINQIRMQI
EKVEINFQKQSDEFKQIYEHQQQLRVNKKLEIEKCDNDIRLIQTFGNEIF
IKFGFFEWQIDKISQQKRKEWIYSKPFYSESSGYKMCLAINVRDYYIDDY
IDIDFHLMRGKFDYKLEWPFKYAVTINVTDTGNGVKTIKYSDRPTDAGWM
KPSNNTNVGVQVIIGLIFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0001878response to yeast
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0016567protein ubiquitination
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..63
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 2..168
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 60..168
e-value: 7.4E-15
score: 56.8
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 104..168
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 2..168