Innexin

Overview
NameInnexin
Smed IDSMED30001004
Length (bp)507
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001004

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30001004h1SMcG0001582 AY067506smed_ncbi_20240424PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30001004h1SMcG0001582 OX_Smed_1.0.14398ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30001004h1SMcG0001582 dd_Smed_v4_15239_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 50.447 bits (119), Expect = 1.241e-7
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   64 EDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPA---TEQXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSI 489
            +DF DK N+++T  +L    L+V+ KQYV  PI C++                CW+Q T  +     IP    + +  +I   + +  +L++ +  F    ++W+ L Y H+G ++Q LV  A  A     E + + V  +A+ +
Sbjct:   19 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENY-CWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM 162          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 50.0618 bits (118), Expect = 1.580e-7
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   64 EDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPA---TEQXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSI 489
            +DF DK N+++T  +L    L+V+ KQYV  PI C++                CW+Q T  +     IP    + +  +I   + +  +L++ +  F    ++W+ L Y H+G ++Q LV  A  A     E + + V  +A+ +
Sbjct:   80 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENY-CWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM 223          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 50.0618 bits (118), Expect = 1.587e-7
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   64 EDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPA---TEQXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSI 489
            +DF DK N+++T  +L    L+V+ KQYV  PI C++                CW+Q T  +     IP    + +  +I   + +  +L++ +  F    ++W+ L Y H+G ++Q LV  A  A     E + + V  +A+ +
Sbjct:   71 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENY-CWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM 214          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 50.0618 bits (118), Expect = 1.593e-7
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   64 EDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPA---TEQXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSI 489
            +DF DK N+++T  +L    L+V+ KQYV  PI C++                CW+Q T  +     IP    + +  +I   + +  +L++ +  F    ++W+ L Y H+G ++Q LV  A  A     E + + V  +A+ +
Sbjct:   80 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENY-CWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM 223          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 50.0618 bits (118), Expect = 1.683e-7
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   64 EDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPA---TEQXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSI 489
            +DF DK N+++T  +L    L+V+ KQYV  PI C++                CW+Q T  +     IP    + +  +I   + +  +L++ +  F    ++W+ L Y H+G ++Q LV  A  A     E + + V  +A+ +
Sbjct:   93 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENY-CWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM 236          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.329e-6
Identity = 38/145 (26.21%), Postives = 69/145 (47.59%), Query Frame = 1
Query:   64 EDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPA---TEQXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSI 489
            +DF DK N+++T  +L    L+V+ KQYV  PI C++                CW+Q T  +     IP    + +  +I   + +  +L++ +  F    ++W+ L Y H+G ++Q LV  A  A     E + + V  +A+ +
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENY-CWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHM 282          
BLAST of Innexin vs. TrEMBL
Match: A0A430QT10 (Innexin OS=Schistosoma bovis OX=6184 GN=inx PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.015e-49
Identity = 96/175 (54.86%), Postives = 131/175 (74.86%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATEQXXXXXXXXXXRN------LLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            M+  EFLD+LSKFQV  Y G+EDFADKFNF  TV+VL+L T +VT+KQY++KPISCYM+TD+GG NLL+Y+ENYCW+QGT+PI+Y+G++P T++    LE+ K+        +L +    F    LIWQ++CYN  GTD+ HLV  ANQAVH+++E R KMV +LAK++ Q  +Q
Sbjct:    1 MIGTEFLDYLSKFQVATYVGVEDFADKFNFLITVMVLMLCTTIVTIKQYMMKPISCYMATDLGGKNLLDYVENYCWVQGTVPIAYSGRVPETDEGWAELEKHKLLYYQWVPFVLGLQCILFYLPRLIWQMICYNRVGTDVHHLVLCANQAVHANDEQRTKMVQHLAKTLEQLLFQ 175          
BLAST of Innexin vs. TrEMBL
Match: A0A183JFJ2 (Innexin OS=Schistosoma curassoni OX=6186 GN=inx PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.579e-49
Identity = 96/175 (54.86%), Postives = 131/175 (74.86%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATEQXXXXXXXXXXRN------LLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            M+  EFLD+LSKFQV  Y G+EDFADKFNF  TV+VL+L T +VT+KQY++KPISCYM+TD+GG NLL+Y+ENYCW+QGT+PI+Y+G++P T++    LE+ K+        +L +    F    LIWQ++CYN  GTD+ HLV  ANQAVH+++E R KMV +LAK++ Q  +Q
Sbjct:    1 MIGTEFLDYLSKFQVATYVGVEDFADKFNFLITVMVLMLCTTIVTIKQYMMKPISCYMATDLGGKNLLDYVENYCWVQGTVPIAYSGRVPETDEGWAELEKHKLLYYQWVPFVLGLQCILFYLPRLIWQMICYNRVGTDVHHLVLCANQAVHANDEQRTKMVQHLAKTLEQLLFQ 175          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LNY2 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 6.009e-47
Identity = 98/175 (56.00%), Postives = 130/175 (74.29%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPAT----EQXXXXXXXXXXRNLLSMGSFCFGFAI--LIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            MV  EFLD++SKFQV  Y G+EDFADKFNF  TV++LLL T VVTVKQY++KPISCYM+TD+GG NLL+Y+ENYCW+QGTIPI+Y GK+P T    E+  +            +G  C  F +  +IWQ++CYN TGTDIQHLV SANQAVH++++ R KM+ ++A+++ Q  +Q
Sbjct:    1 MVGSEFLDYISKFQVATYVGVEDFADKFNFLITVMILLLCTTVVTVKQYMMKPISCYMATDIGGKNLLDYVENYCWVQGTIPIAYAGKMPETDAAWEEMEKHKLLYYQWVPFVLGLQCIMFYVPRVIWQMICYNRTGTDIQHLVLSANQAVHATDDQRTKMIQHVARTLEQMLFQ 175          
BLAST of Innexin vs. TrEMBL
Match: G7YJJ0 (Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.587e-47
Identity = 98/175 (56.00%), Postives = 130/175 (74.29%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPAT----EQXXXXXXXXXXRNLLSMGSFCFGFAI--LIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            MV  EFLD++SKFQV  Y G+EDFADKFNF  TV++LLL T VVTVKQY++KPISCYM+TD+GG NLL+Y+ENYCW+QGTIPI+Y GK+P T    E+  +            +G  C  F +  +IWQ++CYN TGTDIQHLV SANQAVH++++ R KM+ ++A+++ Q  +Q
Sbjct:    1 MVGSEFLDYISKFQVATYVGVEDFADKFNFLVTVMILLLCTTVVTVKQYMMKPISCYMATDIGGKNLLDYVENYCWVQGTIPIAYAGKMPETDAAWEEMEKHKLLYYQWVPFVLGLQCIMFYVPRVIWQMICYNRTGTDIQHLVLSANQAVHATDDQRTKMIQHVARTLEQMLFQ 175          
BLAST of Innexin vs. TrEMBL
Match: A0A419PWC8 (Innexin OS=Clonorchis sinensis OX=79923 GN=unc-9 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.519e-46
Identity = 98/175 (56.00%), Postives = 130/175 (74.29%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPAT----EQXXXXXXXXXXRNLLSMGSFCFGFAI--LIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            MV  EFLD++SKFQV  Y G+EDFADKFNF  TV++LLL T VVTVKQY++KPISCYM+TD+GG NLL+Y+ENYCW+QGTIPI+Y GK+P T    E+  +            +G  C  F +  +IWQ++CYN TGTDIQHLV SANQAVH++++ R KM+ ++A+++ Q  +Q
Sbjct:    1 MVGSEFLDYISKFQVATYVGVEDFADKFNFLVTVMILLLCTTVVTVKQYMMKPISCYMATDIGGKNLLDYVENYCWVQGTIPIAYAGKMPETDAAWEEMEKHKLLYYQWVPFVLGLQCIMFYVPRVIWQMICYNRTGTDIQHLVLSANQAVHATDDQRTKMIQHVARTLEQMLFQ 175          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000069482.1 (SMESG000069482.1)

HSP 1 Score: 175.252 bits (443), Expect = 6.776e-56
Identity = 104/175 (59.43%), Postives = 129/175 (73.71%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATE------QXXXXXXXXXXRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            MVA EFLD +SKFQ+TNY G+EDFADKFNF  T IV  +   VV+VK YVLKPISCY++ D  G NLLNY+ENYCW+QGT+PI Y+GKIP  +      Q+ +IL  + +  +LS+    F    +IWQ+ CYN TGTDIQHL+TSAN AVHSSEEAR KMV++LAKS+ Q  +Q
Sbjct:    1 MVAQEFLDQISKFQITNYVGVEDFADKFNFLLTTIVFSICASVVSVKLYVLKPISCYLAVDSSGTNLLNYVENYCWVQGTVPIKYDGKIPTNDAEWNQLQKNKILYYQWVPFVLSLQCIMFYIPRIIWQMFCYNRTGTDIQHLITSANHAVHSSEEARKKMVIHLAKSLEQLLFQ 175          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 158.688 bits (400), Expect = 7.191e-47
Identity = 97/175 (55.43%), Postives = 128/175 (73.14%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATEQXXXXXXXXXXRN------LLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            MVA EFLD+LSK QV+   G+ED  D+ NF F+VIVL++  L+VTVKQYV KPISCY+  ++GG NLL+Y+EN CW+QGTI +S   K P+T++E + LE+ K+        +L +    F    L+WQ++CYN TGTDIQHLV SANQAVHSS+EAR+KMV YL+K++ Q  YQ
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQ 175          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000031895.1 (SMESG000031895.1)

HSP 1 Score: 146.362 bits (368), Expect = 7.079e-46
Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATEQ 282
            MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFTVIVLLLSTLVVTVKQYVLKPISCYMSTDVGGLNLLNYLENYCWIQGTIPISYNGKIPATEQ
Sbjct:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFTVIVLLLSTLVVTVKQYVLKPISCYMSTDVGGLNLLNYLENYCWIQGTIPISYNGKIPATEQ 94          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000070496.1 (SMESG000070496.1)

HSP 1 Score: 146.362 bits (368), Expect = 7.454e-42
Identity = 101/209 (48.33%), Postives = 126/209 (60.29%), Query Frame = 1
Query:    1 MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFXXXXXXXXXXXXXXKQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATE------------------------------QXXXXXXXXXXRN---------LLSMGS-FCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            M A +F D L+KFQ   Y G++D ADK NF  TVI+LL+   VVTV+QYVLKPISCY+STD+GG+NLL+Y+EN+CW+ GTIPISYNG  P TE                              +   I   K I+N         L S+ S F F    L+W L+C N TGTDIQH++TSANQAVHS EEA+ KM +Y+AK+I    YQ
Sbjct:    1 MAANQFFDSLNKFQWNTYVGVDDLADKLNFLLTVIILLVCISVVTVRQYVLKPISCYLSTDIGGVNLLDYVENFCWVHGTIPISYNGSTPTTEIEWQEMEKFKILMWKTRVICEARAIWKPQTKIRLIFWLKSIKNSFYIINGCHLFSVFSAFLFHLPHLLWTLICRNQTGTDIQHVITSANQAVHSGEEAKEKMTIYIAKTIEHMLYQ 209          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000070656.1 (SMESG000070656.1)

HSP 1 Score: 130.568 bits (327), Expect = 1.702e-36
Identity = 78/129 (60.47%), Postives = 95/129 (73.64%), Query Frame = 1
Query:  139 KQYVLKPISCYMSTDVGGXXXXXXXXXXCWIQGTIPISYNGKIPATEQXXXXXXXXXXRN------LLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEEARNKMVLYLAKSIAQTCYQ 507
            KQY+LKPISCY+ST + G NLL Y+ENYCW++GTIPISY+GKIP+T +E   L + KI        LLS+ +  F    LIWQ+ CYN TGTDI HL+ SANQAVHSS+EAR KMV Y+AK+I Q  YQ
Sbjct:    2 KQYILKPISCYIST-ISGTNLLEYVENYCWVEGTIPISYDGKIPSTNEEWAELNKYKILYYQWVPFLLSLQAIMFYIPRLIWQIFCYNTTGTDIHHLIVSANQAVHSSDEARTKMVNYIAKTIEQMLYQ 129          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-71.241e-726.21Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.580e-726.21Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.587e-726.21Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.593e-726.21Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.683e-726.21Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q03412|UNC7_CAEEL3.329e-626.21Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QT103.015e-4954.86Innexin OS=Schistosoma bovis OX=6184 GN=inx PE=3 S... [more]
A0A183JFJ24.579e-4954.86Innexin OS=Schistosoma curassoni OX=6186 GN=inx PE... [more]
A0A4S2LNY26.009e-4756.00Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
G7YJJ07.587e-4756.00Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=... [more]
A0A419PWC84.519e-4656.00Innexin OS=Clonorchis sinensis OX=79923 GN=unc-9 P... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069482.16.776e-5659.43SMESG000069482.1[more]
SMESG000065083.17.191e-4755.43SMESG000065083.1[more]
SMESG000031895.17.079e-46100.00SMESG000031895.1[more]
SMESG000070496.17.454e-4248.33SMESG000070496.1[more]
SMESG000070656.11.702e-3660.47SMESG000070656.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001004 ID=SMED30001004|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=507bp
ATGGTTGCCCTTGAATTTCTGGACTTCCTCAGTAAGTTCCAAGTAACAAA
TTATGCTGGAATAGAGGATTTTGCGGATAAATTTAATTTCCATTTCACTG
TCATCGTTTTGTTGTTGTCTACCCTTGTTGTTACAGTGAAACAATATGTA
TTGAAACCGATCTCATGCTACATGTCGACAGATGTCGGAGGATTAAATTT
GCTGAACTATTTGGAGAACTATTGCTGGATCCAAGGAACGATACCAATAT
CATACAATGGGAAAATTCCAGCGACTGAACAGGAGTTGGAAATTTTAGAA
GAAAAAAAAATACGCAATTTATTATCAATGGGTTCCTTTTGCTTTGGGTT
TGCAATACTGATTTGGCAACTTTTATGTTATAACCACACAGGAACCGACA
TTCAGCATCTTGTCACAAGTGCCAACCAAGCGGTTCACTCAAGTGAAGAG
GCTAGGAACAAAATGGTCCTTTATTTAGCAAAATCAATAGCCCAAACATG
TTATCAA
back to top

protein sequence of SMED30001004-orf-1

>SMED30001004-orf-1 ID=SMED30001004-orf-1|Name=SMED30001004-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MVALEFLDFLSKFQVTNYAGIEDFADKFNFHFTVIVLLLSTLVVTVKQYV
LKPISCYMSTDVGGLNLLNYLENYCWIQGTIPISYNGKIPATEQELEILE
EKKIRNLLSMGSFCFGFAILIWQLLCYNHTGTDIQHLVTSANQAVHSSEE
ARNKMVLYLAKSIAQTCYQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport