Glutamate decarboxylase 1

Overview
NameGlutamate decarboxylase 1
Smed IDSMED30001003
Length (bp)1252
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate decarboxylase 1 (SMED30001003) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate decarboxylase 1 (SMED30001003) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate decarboxylase 1 (SMED30001003) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate decarboxylase 1 (SMED30001003) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30001003

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30001003SMESG000050934.1 SMESG000050924.1 dd_Smed_v4_12653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30001003SMESG000050934.1 SMESG000050924.1 dd_Smed_v4_12653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30001003SMESG000050934.1 SMESG000050924.1 dd_Smed_v4_12653_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30001003SMESG000050934.1 SMESG000050924.1 dd_Smed_v4_12653_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate decarboxylase 1 vs. Ensembl Human
Match: GAD2 (glutamate decarboxylase 2 [Source:HGNC Symbol;Acc:HGNC:4093])

HSP 1 Score: 327.02 bits (837), Expect = 1.072e-107
Identity = 143/279 (51.25%), Postives = 202/279 (72.40%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             GKM    L+  I E  + G +P +V AT GTTV GAFDP+  ++ ICK + IW+HVD AWG G+L+S++H++ L G+E A+SVTWNPHK MGV LQCS +L + E +++NCN + A YLFQ+DKHYD SYDTGDK++QCGR  DVFKLWLMWR+KG  GF+  +++   L EYL  ++K ++G+ MV D KP++ N+CFWY P   R +E  +E+   L+KV   IK  M+E GTTM++YQPL  K NFFR+++SN A   +D+DF+++EI ++G+++
Sbjct:  193 RGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 471          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Human
Match: GAD2 (glutamate decarboxylase 2 [Source:HGNC Symbol;Acc:HGNC:4093])

HSP 1 Score: 326.25 bits (835), Expect = 6.787e-106
Identity = 143/279 (51.25%), Postives = 202/279 (72.40%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             GKM    L+  I E  + G +P +V AT GTTV GAFDP+  ++ ICK + IW+HVD AWG G+L+S++H++ L G+E A+SVTWNPHK MGV LQCS +L + E +++NCN + A YLFQ+DKHYD SYDTGDK++QCGR  DVFKLWLMWR+KG  GF+  +++   L EYL  ++K ++G+ MV D KP++ N+CFWY P   R +E  +E+   L+KV   IK  M+E GTTM++YQPL  K NFFR+++SN A   +D+DF+++EI ++G+++
Sbjct:  307 RGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Human
Match: GAD2 (glutamate decarboxylase 2 [Source:HGNC Symbol;Acc:HGNC:4093])

HSP 1 Score: 326.25 bits (835), Expect = 6.787e-106
Identity = 143/279 (51.25%), Postives = 202/279 (72.40%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             GKM    L+  I E  + G +P +V AT GTTV GAFDP+  ++ ICK + IW+HVD AWG G+L+S++H++ L G+E A+SVTWNPHK MGV LQCS +L + E +++NCN + A YLFQ+DKHYD SYDTGDK++QCGR  DVFKLWLMWR+KG  GF+  +++   L EYL  ++K ++G+ MV D KP++ N+CFWY P   R +E  +E+   L+KV   IK  M+E GTTM++YQPL  K NFFR+++SN A   +D+DF+++EI ++G+++
Sbjct:  307 RGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Human
Match: GAD1 (glutamate decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:4092])

HSP 1 Score: 324.324 bits (830), Expect = 4.122e-105
Identity = 144/278 (51.80%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+     +  I E  + G++P  V AT GTTV GAFDPI+EI+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L K + +L+ CN +CA YLFQ DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+NQIN+   L EYL   +K ++ F MV + +PE+ N+CFWY P+  R +    ++ + L+KV  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  + D+DF+++EI ++G+++
Sbjct:  317 GKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 594          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Human
Match: CSAD (cysteine sulfinic acid decarboxylase [Source:HGNC Symbol;Acc:HGNC:18966])

HSP 1 Score: 298.13 bits (762), Expect = 5.005e-98
Identity = 134/286 (46.85%), Postives = 201/286 (70.28%), Query Frame = 2
Query:  260 RFVKLIE-GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNES-VLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            R VK  E GKM  + L+  I      G +P +V AT GTTVLGAFDP+E I+ +C+  G+WLHVD AWG  VLLS+ HR+LL GI+ ADSV WNPHK +   LQCS +L ++ S +L+ C+G  A YLFQ+DK YD + DTGDK +QCGRR D  KLWLMW+++GD+G + +I++ F+L  YL + +K+++GF +V++ PE++N+CFW+ P   R  +   + H+ L+KV   +K+ M++ G+ MI YQP   + NFFR++++N+A    D+DF+L+E+ ++G+++
Sbjct:   62 RVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVME-PEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL 346          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Celegans
Match: unc-25 (Glutamic acid decarboxylase [Source:UniProtKB/TrEMBL;Acc:G5EDB7])

HSP 1 Score: 332.028 bits (850), Expect = 1.731e-110
Identity = 152/277 (54.87%), Postives = 197/277 (71.12%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L+  I E  K G  P   C T G+TV GAFDP+E ++ IC+   +W HVD AWG G+LLS  HRY L GIE A+SVTWNPHK MG  LQCS  LF+ + +L  CN + ADYLFQ+DK YD S+DTGDK+IQCGR NDVFKLWLMW+SKG EG++ QIN+L  L  Y  + +KE +GF ++++ PE+LNICFWY P K R++E  + + + L K+  KIK  M++ GTTM+ YQP   +PNFFR+I+SN A  +EDLDF++ EIV IGE +
Sbjct:  157 GKMIPEALEAKIIECKKEGLTPFFACCTAGSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPEHRYKLAGIERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQMSADYLFQQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLANYFTRRIKETEGFELIIENPEFLNICFWYVPSKIRNLEPAEMRAR-LEKIAPKIKAGMMQRGTTMVGYQPDKQRPNFFRMIISNQAITREDLDFLIKEIVDIGESL 432          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Celegans
Match: unc-25 (Glutamic acid decarboxylase [Source:UniProtKB/TrEMBL;Acc:G5EDB7])

HSP 1 Score: 332.798 bits (852), Expect = 6.261e-110
Identity = 152/277 (54.87%), Postives = 197/277 (71.12%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L+  I E  K G  P   C T G+TV GAFDP+E ++ IC+   +W HVD AWG G+LLS  HRY L GIE A+SVTWNPHK MG  LQCS  LF+ + +L  CN + ADYLFQ+DK YD S+DTGDK+IQCGR NDVFKLWLMW+SKG EG++ QIN+L  L  Y  + +KE +GF ++++ PE+LNICFWY P K R++E  + + + L K+  KIK  M++ GTTM+ YQP   +PNFFR+I+SN A  +EDLDF++ EIV IGE +
Sbjct:  232 GKMIPEALEAKIIECKKEGLTPFFACCTAGSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPEHRYKLAGIERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQMSADYLFQQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLANYFTRRIKETEGFELIIENPEFLNICFWYVPSKIRNLEPAEMRAR-LEKIAPKIKAGMMQRGTTMVGYQPDKQRPNFFRMIISNQAITREDLDFLIKEIVDIGESL 507          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Celegans
Match: unc-25 (Glutamic acid decarboxylase [Source:UniProtKB/TrEMBL;Acc:G5EDB7])

HSP 1 Score: 332.798 bits (852), Expect = 6.261e-110
Identity = 152/277 (54.87%), Postives = 197/277 (71.12%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L+  I E  K G  P   C T G+TV GAFDP+E ++ IC+   +W HVD AWG G+LLS  HRY L GIE A+SVTWNPHK MG  LQCS  LF+ + +L  CN + ADYLFQ+DK YD S+DTGDK+IQCGR NDVFKLWLMW+SKG EG++ QIN+L  L  Y  + +KE +GF ++++ PE+LNICFWY P K R++E  + + + L K+  KIK  M++ GTTM+ YQP   +PNFFR+I+SN A  +EDLDF++ EIV IGE +
Sbjct:  232 GKMIPEALEAKIIECKKEGLTPFFACCTAGSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPEHRYKLAGIERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQMSADYLFQQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLANYFTRRIKETEGFELIIENPEFLNICFWYVPSKIRNLEPAEMRAR-LEKIAPKIKAGMMQRGTTMVGYQPDKQRPNFFRMIISNQAITREDLDFLIKEIVDIGESL 507          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Celegans
Match: unc-25 (Glutamic acid decarboxylase [Source:UniProtKB/TrEMBL;Acc:G5EDB7])

HSP 1 Score: 235.343 bits (599), Expect = 7.620e-73
Identity = 110/203 (54.19%), Postives = 139/203 (68.47%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPE 889
            GKM  + L+  I E  K G  P   C T G+TV GAFDP+E ++ IC+   +W HVD AWG G+LLS  HRY L GIE A+SVTWNPHK MG  LQCS  LF+ + +L  CN + ADYLFQ+DK YD S+DTGDK+IQCGR NDVFKLWLMW+SKG EG++ QIN+L  L  Y  + +KE +GF ++++     N+ F   PE
Sbjct:  232 GKMIPEALEAKIIECKKEGLTPFFACCTAGSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPEHRYKLAGIERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQMSADYLFQQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLANYFTRRIKETEGFELIIE-----NVSFARIPE 429          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Celegans
Match: bas-1 (Biogenic Amine Synthesis related [Source:UniProtKB/TrEMBL;Acc:O45137])

HSP 1 Score: 92.8189 bits (229), Expect = 3.228e-20
Identity = 59/192 (30.73%), Postives = 95/192 (49.48%), Query Frame = 2
Query:  302 LKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNI-CF 874
            L+  I E    G+IP M  AT GTT     D ++E+  +C   G++LHVD A+     L +  +YL++G+E+ DS  +N HKA  V   CS + FKN + +     + A YL    ++  T+ D     +  GRR    K+W + R+ G +  +  +    LL     K++ E   F   +  P++L + CF
Sbjct:  262 LQNAIKEDRARGYIPFMFLATVGTTCSCGVDQVDELGPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDCSPMWFKNGTHVSRYFNVDAVYLAH--EYQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDKIREYLRRTELLAAEFSKLILENGKFEHFV--PQHLGLTCF 449          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Fly
Match: b (gene:FBgn0000153 transcript:FBtr0342712)

HSP 1 Score: 300.442 bits (768), Expect = 4.519e-97
Identity = 134/277 (48.38%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM    L++ +   ++ G  P MV AT GTTVLGAFD +  IS++CK + +W+HVD AWG G L+SK++R+LL GIE ADSVTWNPHK +  + QCS  L +++ VL  C+   A YLFQKDK YDTS+DTGDK IQCGRR DVFK W MW++KG +G +  + ++F + E+    ++E+ GF +VL+ PE  NI FWY P   R +E  +E +  L+KV  K+K+ M++ G+ MI YQPL   PNFFRL+L N+   + D+ + LDEI  + + +
Sbjct:  238 GKMRLSDLEKQVKLCLENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFELVLESPECTNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPLRQLPNFFRLVLQNSCLEESDMVYFLDEIESLAQNL 514          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Fly
Match: b (gene:FBgn0000153 transcript:FBtr0309960)

HSP 1 Score: 301.597 bits (771), Expect = 7.600e-97
Identity = 134/277 (48.38%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM    L++ +   ++ G  P MV AT GTTVLGAFD +  IS++CK + +W+HVD AWG G L+SK++R+LL GIE ADSVTWNPHK +  + QCS  L +++ VL  C+   A YLFQKDK YDTS+DTGDK IQCGRR DVFK W MW++KG +G +  + ++F + E+    ++E+ GF +VL+ PE  NI FWY P   R +E  +E +  L+KV  K+K+ M++ G+ MI YQPL   PNFFRL+L N+   + D+ + LDEI  + + +
Sbjct:  299 GKMRLSDLEKQVKLCLENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFELVLESPECTNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPLRQLPNFFRLVLQNSCLEESDMVYFLDEIESLAQNL 575          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Fly
Match: b (gene:FBgn0000153 transcript:FBtr0080542)

HSP 1 Score: 301.597 bits (771), Expect = 7.600e-97
Identity = 134/277 (48.38%), Postives = 187/277 (67.51%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM    L++ +   ++ G  P MV AT GTTVLGAFD +  IS++CK + +W+HVD AWG G L+SK++R+LL GIE ADSVTWNPHK +  + QCS  L +++ VL  C+   A YLFQKDK YDTS+DTGDK IQCGRR DVFK W MW++KG +G +  + ++F + E+    ++E+ GF +VL+ PE  NI FWY P   R +E  +E +  L+KV  K+K+ M++ G+ MI YQPL   PNFFRL+L N+   + D+ + LDEI  + + +
Sbjct:  299 GKMRLSDLEKQVKLCLENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGGGALMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFELVLESPECTNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPLRQLPNFFRLVLQNSCLEESDMVYFLDEIESLAQNL 575          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Fly
Match: Gad1 (gene:FBgn0004516 transcript:FBtr0073277)

HSP 1 Score: 293.123 bits (749), Expect = 2.561e-94
Identity = 139/279 (49.82%), Postives = 192/279 (68.82%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRY-LLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKG-FNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM +  L+ LI E    G IP  V AT GTTVLGAFD I  I+ IC+ +  W+H+D AWG G+L+S++HR+    G+E ADSVTWNPHK MG  LQCS + FK + +L +CN + A+YLF  DK YD SYDTGDK IQCGR ND+FKLWL WR+KG EGF+ Q + L  L +Y  K ++E+   F+++L+ PE +N+ FWY P++ R +  + +K   L K+   IK  M++ GT M+ YQP   +PNFFR I+S+AA  + D+DF+LDEI ++G+++
Sbjct:  233 GKMITSELERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYDISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHLILE-PECVNVSFWYVPKRLRGVPHDAKKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPNFFRSIISSAAVNEADVDFMLDEIHRLGDDL 510          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Fly
Match: Gad1 (gene:FBgn0004516 transcript:FBtr0332980)

HSP 1 Score: 293.123 bits (749), Expect = 2.561e-94
Identity = 139/279 (49.82%), Postives = 192/279 (68.82%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRY-LLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKG-FNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM +  L+ LI E    G IP  V AT GTTVLGAFD I  I+ IC+ +  W+H+D AWG G+L+S++HR+    G+E ADSVTWNPHK MG  LQCS + FK + +L +CN + A+YLF  DK YD SYDTGDK IQCGR ND+FKLWL WR+KG EGF+ Q + L  L +Y  K ++E+   F+++L+ PE +N+ FWY P++ R +  + +K   L K+   IK  M++ GT M+ YQP   +PNFFR I+S+AA  + D+DF+LDEI ++G+++
Sbjct:  233 GKMITSELERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYDISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHLILE-PECVNVSFWYVPKRLRGVPHDAKKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPNFFRSIISSAAVNEADVDFMLDEIHRLGDDL 510          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Zebrafish
Match: zgc:163121 (zgc:163121 [Source:ZFIN;Acc:ZDB-GENE-070424-80])

HSP 1 Score: 325.865 bits (834), Expect = 1.149e-108
Identity = 155/278 (55.76%), Postives = 196/278 (70.50%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM S  L   I E    G +P  V AT GTTV GAFDP+ +I+ IC+  G+W+HVD AWG G+LLS +HR  L GIE A SVTWNPHK MGV LQCS +L K + +L+ CN LCA+YLFQ DKHY+ SYDTGDKSIQCGR  D+FKLWLMW++KG EGF++Q+N      EYL   LK +  F +V   KPE+ N+CFWY P++ ++I +  E+ K L+ V  KIK  M+E G TMI YQPL  K NFFR + SN A ++ED+DF+LDEIV++G E+
Sbjct:  105 GKMISSELNSSIEEAKSKGLVPFYVNATAGTTVYGAFDPLHKIADICEHHGLWMHVDAAWGGGLLLSNKHRVKLHGIERAHSVTWNPHKMMGVPLQCSTILVKRKGLLQQCNQLCAEYLFQPDKHYEVSYDTGDKSIQCGRHVDIFKLWLMWKAKGSEGFESQVNHCLENAEYLYYKLKRRTDFQLVFKGKPEHSNVCFWYLPKRVQNIPLGPEREKELHMVAPKIKTKMMEEGFTMIGYQPLEDKVNFFRCVFSNPATQREDVDFLLDEIVRLGCEL 382          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Zebrafish
Match: zgc:163121 (zgc:163121 [Source:ZFIN;Acc:ZDB-GENE-070424-80])

HSP 1 Score: 327.02 bits (837), Expect = 6.081e-107
Identity = 155/278 (55.76%), Postives = 196/278 (70.50%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM S  L   I E    G +P  V AT GTTV GAFDP+ +I+ IC+  G+W+HVD AWG G+LLS +HR  L GIE A SVTWNPHK MGV LQCS +L K + +L+ CN LCA+YLFQ DKHY+ SYDTGDKSIQCGR  D+FKLWLMW++KG EGF++Q+N      EYL   LK +  F +V   KPE+ N+CFWY P++ ++I +  E+ K L+ V  KIK  M+E G TMI YQPL  K NFFR + SN A ++ED+DF+LDEIV++G E+
Sbjct:  269 GKMISSELNSSIEEAKSKGLVPFYVNATAGTTVYGAFDPLHKIADICEHHGLWMHVDAAWGGGLLLSNKHRVKLHGIERAHSVTWNPHKMMGVPLQCSTILVKRKGLLQQCNQLCAEYLFQPDKHYEVSYDTGDKSIQCGRHVDIFKLWLMWKAKGSEGFESQVNHCLENAEYLYYKLKRRTDFQLVFKGKPEHSNVCFWYLPKRVQNIPLGPEREKELHMVAPKIKTKMMEEGFTMIGYQPLEDKVNFFRCVFSNPATQREDVDFLLDEIVRLGCEL 546          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Zebrafish
Match: gad1b (glutamate decarboxylase 1b [Source:ZFIN;Acc:ZDB-GENE-030909-3])

HSP 1 Score: 313.538 bits (802), Expect = 1.903e-101
Identity = 137/278 (49.28%), Postives = 196/278 (70.50%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            G++    L+  + +  + G++P  V AT GTTV GAFDPI +I+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I+    L EYL   +K ++G+ MV + +P++ N+CFWY P   R +    E+ + L++V  KIK  M+E GTTM+ YQP   K NFFR+++SN A  K D+DF++DEI ++G+++
Sbjct:  289 GRVIPADLEAKVIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGILQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDRCLELSEYLYNKIKNREGYEMVFEGQPQHTNVCFWYIPPSLRGMPNGDERREKLHRVAPKIKAMMMECGTTMVGYQPQGDKVNFFRMVVSNHAVTKSDIDFLIDEIERLGQDL 566          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Zebrafish
Match: gad2 (glutamate decarboxylase 2 [Source:ZFIN;Acc:ZDB-GENE-030909-9])

HSP 1 Score: 313.153 bits (801), Expect = 4.158e-101
Identity = 141/278 (50.72%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM    L+  I E  + G++P  V AT GTTV GAFDP+  I+ ICK   +W+HVD AWG  +L+S++HR+ L G+E A+S+TWNPHK M V LQCS +L + E ++++CN + A YLFQ+DKHYD  YDTGDK++QCGR  D+FKLWLMWR+KG  GF+ QI++   L EYL   +K+++G+ MV D KP++ N+CFWY P   R++E + E+ K L+KV   IK  M+E GTTM++YQP   K NFFR+++SN A   ED+DF+++EI ++G+++
Sbjct:  306 GKMIPSDLERRIIEAKQKGYVPFFVSATAGTTVYGAFDPLIAIADICKKHDVWMHVDGAWGGSLLMSRKHRWKLNGVERANSMTWNPHKMMAVPLQCSALLVREEGLMQSCNQMQACYLFQQDKHYDLQYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDKCLELSEYLYNKIKDREGYQMVFDGKPQHTNVCFWYLPPGVRYLEDKVERMKRLHKVAPVIKARMMEYGTTMVSYQPQGDKVNFFRMVISNPAATFEDIDFLIEEIERLGQDL 583          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Zebrafish
Match: gad1b (glutamate decarboxylase 1b [Source:ZFIN;Acc:ZDB-GENE-030909-3])

HSP 1 Score: 313.153 bits (801), Expect = 5.378e-101
Identity = 137/279 (49.10%), Postives = 196/279 (70.25%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             G++    L+  + +  + G++P  V AT GTTV GAFDPI +I+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I+    L EYL   +K ++G+ MV + +P++ N+CFWY P   R +    E+ + L++V  KIK  M+E GTTM+ YQP   K NFFR+++SN A  K D+DF++DEI ++G+++
Sbjct:  309 RGRVIPADLEAKVIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGILQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDRCLELSEYLYNKIKNREGYEMVFEGQPQHTNVCFWYIPPSLRGMPNGDERREKLHRVAPKIKAMMMECGTTMVGYQPQGDKVNFFRMVVSNHAVTKSDIDFLIDEIERLGQDL 587          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Xenopus
Match: cdh22 (cadherin 22 [Source:Xenbase;Acc:XB-GENE-922905])

HSP 1 Score: 328.561 bits (841), Expect = 5.039e-108
Identity = 151/276 (54.71%), Postives = 195/276 (70.65%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVL-DKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGE 1105
            GKM    L++ I +  + G  P  V AT GTTV GAFDP+  I+ ICK +G+W+HVD AWG G+LLSK+HRY + GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN  CADYLFQ DK YDT+YDTGDK+IQCGR  D+FKLWLMW++KG  GF+ QIN    L EYL   L+ K  F +V  DKPEY N+CFWY P    H+  +KE    L+K+  +IK  M+E GT M++YQP   KPNFFR++ SN A +K D+DF+L+EI ++G+
Sbjct:  211 GKMIPSDLEDKILKAKRQGQHPFYVSATAGTTVYGAFDPLITIADICKRYGLWMHVDAAWGGGLLLSKKHRYKMNGIERANSVTWNPHKIMGVPLQCSAILIRQKGLLQACNQQCADYLFQMDKPYDTAYDTGDKTIQCGRHVDIFKLWLMWKAKGSCGFELQINRCLELSEYLYNKLQSKSNFELVFRDKPEYTNVCFWYIPPSLEHVPRDKEWKARLHKIAPQIKARMMEEGTVMVSYQPQGDKPNFFRMVFSNPASKKSDVDFLLEEIERLGK 486          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Xenopus
Match: cdh22 (cadherin 22 [Source:Xenbase;Acc:XB-GENE-922905])

HSP 1 Score: 328.561 bits (841), Expect = 3.148e-107
Identity = 151/276 (54.71%), Postives = 195/276 (70.65%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVL-DKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGE 1105
            GKM    L++ I +  + G  P  V AT GTTV GAFDP+  I+ ICK +G+W+HVD AWG G+LLSK+HRY + GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN  CADYLFQ DK YDT+YDTGDK+IQCGR  D+FKLWLMW++KG  GF+ QIN    L EYL   L+ K  F +V  DKPEY N+CFWY P    H+  +KE    L+K+  +IK  M+E GT M++YQP   KPNFFR++ SN A +K D+DF+L+EI ++G+
Sbjct:  277 GKMIPSDLEDKILKAKRQGQHPFYVSATAGTTVYGAFDPLITIADICKRYGLWMHVDAAWGGGLLLSKKHRYKMNGIERANSVTWNPHKIMGVPLQCSAILIRQKGLLQACNQQCADYLFQMDKPYDTAYDTGDKTIQCGRHVDIFKLWLMWKAKGSCGFELQINRCLELSEYLYNKLQSKSNFELVFRDKPEYTNVCFWYIPPSLEHVPRDKEWKARLHKIAPQIKARMMEEGTVMVSYQPQGDKPNFFRMVFSNPASKKSDVDFLLEEIERLGK 552          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Xenopus
Match: mxra5 (matrix-remodelling associated 5 [Source:Xenbase;Acc:XB-GENE-923372])

HSP 1 Score: 326.635 bits (836), Expect = 4.574e-107
Identity = 143/266 (53.76%), Postives = 195/266 (73.31%), Query Frame = 2
Query:  317 NETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDK-PEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            +E + +G++P  V AT GTTV GAFDPI EI+ IC+ + +WLHVD AWG G+L+S+RHR+ L GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN +CA YLFQ+DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+ QIN+   L EYL   +  ++GF MV +  PE+ N+CFWY P   R +   +EK + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  K D+DF+++EI ++G+E+
Sbjct:  245 SENVIMGYVPLYVNATAGTTVYGAFDPISEIADICEKYNLWLHVDAAWGGGLLMSRRHRHKLDGIERANSVTWNPHKMMGVLLQCSAILLREKGILQGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEAQINKCLELAEYLYSKIYNREGFEMVFNGVPEHTNVCFWYIPPSLRGMPNNEEKQEKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLVEEIERLGQEL 510          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Xenopus
Match: mxra5 (matrix-remodelling associated 5 [Source:Xenbase;Acc:XB-GENE-923372])

HSP 1 Score: 328.176 bits (840), Expect = 5.949e-107
Identity = 147/278 (52.88%), Postives = 199/278 (71.58%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDK-PEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+    L+  I E  + G++P  V AT GTTV GAFDPI EI+ IC+ + +WLHVD AWG G+L+S+RHR+ L GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN +CA YLFQ+DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+ QIN+   L EYL   +  ++GF MV +  PE+ N+CFWY P   R +   +EK + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  K D+DF+++EI ++G+E+
Sbjct:  292 GKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPISEIADICEKYNLWLHVDAAWGGGLLMSRRHRHKLDGIERANSVTWNPHKMMGVLLQCSAILLREKGILQGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEAQINKCLELAEYLYSKIYNREGFEMVFNGVPEHTNVCFWYIPPSLRGMPNNEEKQEKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLVEEIERLGQEL 569          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Xenopus
Match: mxra5 (matrix-remodelling associated 5 [Source:Xenbase;Acc:XB-GENE-923372])

HSP 1 Score: 326.25 bits (835), Expect = 6.582e-107
Identity = 143/266 (53.76%), Postives = 195/266 (73.31%), Query Frame = 2
Query:  317 NETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDK-PEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            +E + +G++P  V AT GTTV GAFDPI EI+ IC+ + +WLHVD AWG G+L+S+RHR+ L GIE A+SVTWNPHK MGV LQCS +L + + +L+ CN +CA YLFQ+DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+ QIN+   L EYL   +  ++GF MV +  PE+ N+CFWY P   R +   +EK + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  K D+DF+++EI ++G+E+
Sbjct:  246 SENVIMGYVPLYVNATAGTTVYGAFDPISEIADICEKYNLWLHVDAAWGGGLLMSRRHRHKLDGIERANSVTWNPHKMMGVLLQCSAILLREKGILQGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEAQINKCLELAEYLYSKIYNREGFEMVFNGVPEHTNVCFWYIPPSLRGMPNNEEKQEKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLVEEIERLGQEL 511          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Mouse
Match: Gad1 (glutamate decarboxylase 1 [Source:MGI Symbol;Acc:MGI:95632])

HSP 1 Score: 325.865 bits (834), Expect = 6.594e-106
Identity = 144/278 (51.80%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+    L+  I +  + G++P  V AT GTTV GAFDPI+EI+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L K + +L+ CN +CA YLFQ DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+NQIN+   L +YL   +K ++ F MV D +PE+ N+CFWY P+  R +    E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  + D+DF+++EI ++G+++
Sbjct:  316 GKIIPADLEAKILDAKQKGYVPLYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELADYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 593          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Mouse
Match: Gad2 (glutamic acid decarboxylase 2 [Source:MGI Symbol;Acc:MGI:95634])

HSP 1 Score: 322.783 bits (826), Expect = 8.963e-105
Identity = 142/279 (50.90%), Postives = 202/279 (72.40%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             GKM    L+  I E  + G +P +V AT GTTV GAFDP+  ++ ICK + IW+HVD AWG G+L+S++H++ L G+E A+SVTWNPHK MGV LQCS +L + E ++++CN + A YLFQ+DKHYD SYDTGDK++QCGR  DVFKLWLMWR+KG  GF+  I++   L EYL  ++K ++G+ MV D KP++ N+CFW+ P   R +E  +E+   L+KV   IK  M+E GTTM++YQPL  K NFFR+++SN A   +D+DF+++EI ++G+++
Sbjct:  307 RGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEYLYTIIKNREGYEMVFDGKPQHTNVCFWFVPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Mouse
Match: Gadl1 (glutamate decarboxylase-like 1 [Source:MGI Symbol;Acc:MGI:1920998])

HSP 1 Score: 289.271 bits (739), Expect = 8.679e-93
Identity = 131/278 (47.12%), Postives = 189/278 (67.99%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNES-VLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L++ I +  + G +P +VCAT GTTVLGAFDP++EI+++C+  G+WLHVD +WG   L+S++HR LL GI  ADSV WNPHK +   +QCS +L K++S +L+ C    A YLFQ+DK YD SYDTGDKSIQC RR D FK W+ W++ G  G + ++N  F L  YL   +K+++GF ++++ PEY N+CFWY P   R +E   E  + L+ V   IK+ M++ G+ M+ YQP  GK NFFR ++ +    +ED+DF+LDEI  +G ++
Sbjct:  226 GKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSALVSRKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKSDLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLME-PEYTNVCFWYIPPSLREMEEGPEFWRKLSLVAPAIKEKMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM 502          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Mouse
Match: Gadl1 (glutamate decarboxylase-like 1 [Source:MGI Symbol;Acc:MGI:1920998])

HSP 1 Score: 289.271 bits (739), Expect = 8.679e-93
Identity = 131/278 (47.12%), Postives = 189/278 (67.99%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNES-VLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L++ I +  + G +P +VCAT GTTVLGAFDP++EI+++C+  G+WLHVD +WG   L+S++HR LL GI  ADSV WNPHK +   +QCS +L K++S +L+ C    A YLFQ+DK YD SYDTGDKSIQC RR D FK W+ W++ G  G + ++N  F L  YL   +K+++GF ++++ PEY N+CFWY P   R +E   E  + L+ V   IK+ M++ G+ M+ YQP  GK NFFR ++ +    +ED+DF+LDEI  +G ++
Sbjct:  226 GKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSALVSRKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKSDLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLME-PEYTNVCFWYIPPSLREMEEGPEFWRKLSLVAPAIKEKMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM 502          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Mouse
Match: Csad (cysteine sulfinic acid decarboxylase [Source:MGI Symbol;Acc:MGI:2180098])

HSP 1 Score: 276.559 bits (706), Expect = 7.284e-88
Identity = 125/274 (45.62%), Postives = 185/274 (67.52%), Query Frame = 2
Query:  260 RFVKLIE-GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNES-VLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDF 1075
            R VK  E G+M  + L+  I      G +P +V AT GTTVLGAFDP++ I+ +C+  G+W HVD AWG  VLLS+ HR+LL GI+ ADSV WNPHK +   LQCS +L ++ S +L+ C+G  A YLFQ+DK YD + DTGDK +QCGRR D  KLWLMW+++G +G + +I++ F L  YL + +K+++GF +V++ PE++N+CFW+ P   R  +   +  + L++V   +K+ M++ GT MI YQP   + NFFR++++N    + D+DF
Sbjct:  209 RVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVME-PEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDF 481          
BLAST of Glutamate decarboxylase 1 vs. UniProt/SwissProt
Match: sp|P48319|DCE1_PIG (Glutamate decarboxylase 1 OS=Sus scrofa OX=9823 GN=GAD1 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 6.088e-107
Identity = 148/278 (53.24%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+    L+  I E  + G+IP  V AT GTTV GAFDPI+EI+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE ADSVTWNPHK MGV LQCS +L K + +L+ CN +CA YLFQ DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+NQIN+   L EYL   +K ++ F MV D +PE+ N+CFWY P+  R +    E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  + D+DF+++EI ++G+++
Sbjct:  317 GKIIPADLEAKILEAKQKGYIPLYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERADSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 594          
BLAST of Glutamate decarboxylase 1 vs. UniProt/SwissProt
Match: sp|A0PA85|DCE1_CANLF (Glutamate decarboxylase 1 OS=Canis lupus familiaris OX=9615 GN=GAD1 PE=2 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.438e-106
Identity = 147/278 (52.88%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+    L+  I E  + G++P  V AT GTTV GAFDPI+EI+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L K + +L+ CN +CA YLFQ DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+NQIN+   L EYL   +K ++ F MV D +PE+ N+CFWY P+  R I    E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  + D+DF+++EI ++G+++
Sbjct:  317 GKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 594          
BLAST of Glutamate decarboxylase 1 vs. UniProt/SwissProt
Match: sp|P14748|DCE1_FELCA (Glutamate decarboxylase 1 OS=Felis catus OX=9685 GN=GAD1 PE=2 SV=3)

HSP 1 Score: 329.331 bits (843), Expect = 2.834e-106
Identity = 147/278 (52.88%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+    L+  I E  + G++P  V AT GTTV GAFDPI+EI+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L K + +L+ CN +CA YLFQ DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+NQIN+   L EYL   +K ++ F MV D +PE+ N+CFWY P+  R I    E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  + D+DF+++EI ++G+++
Sbjct:  317 GKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 594          
BLAST of Glutamate decarboxylase 1 vs. UniProt/SwissProt
Match: sp|Q0VCA1|DCE1_BOVIN (Glutamate decarboxylase 1 OS=Bos taurus OX=9913 GN=GAD1 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 6.993e-106
Identity = 146/278 (52.52%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GK+    L+  I E  + G++P  V AT GTTV GAFDPI+EI+ IC+ + +WLHVD AWG G+L+S++HR+ L GIE A+SVTWNPHK MGV LQCS +L K + +L+ CN +CA YLFQ DK YD SYDTGDK+IQCGR  D+FK WLMW++KG  GF+NQIN+   L EYL   +K ++ F MV D +PE+ N+CFWY P+  R +    E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN A  + D+DF+++EI ++G+++
Sbjct:  317 GKIIPADLETKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 594          
BLAST of Glutamate decarboxylase 1 vs. UniProt/SwissProt
Match: sp|Q05329|DCE2_HUMAN (Glutamate decarboxylase 2 OS=Homo sapiens OX=9606 GN=GAD2 PE=1 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 3.259e-105
Identity = 143/279 (51.25%), Postives = 202/279 (72.40%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             GKM    L+  I E  + G +P +V AT GTTV GAFDP+  ++ ICK + IW+HVD AWG G+L+S++H++ L G+E A+SVTWNPHK MGV LQCS +L + E +++NCN + A YLFQ+DKHYD SYDTGDK++QCGR  DVFKLWLMWR+KG  GF+  +++   L EYL  ++K ++G+ MV D KP++ N+CFWY P   R +E  +E+   L+KV   IK  M+E GTTM++YQPL  K NFFR+++SN A   +D+DF+++EI ++G+++
Sbjct:  307 RGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585          
BLAST of Glutamate decarboxylase 1 vs. TrEMBL
Match: B2ZX20 (Glutamic acid decarboxylase OS=Dugesia japonica OX=6161 GN=DjGAD PE=2 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.176e-167
Identity = 230/288 (79.86%), Postives = 262/288 (90.97%), Query Frame = 2
Query:  266 VKLIE----GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVL 1117
            VKL++    GKMD+++L ELINE+I+  +IPCMVC+TGGTTVLGAFDPI+EISKICK FG+WLHVDCAWGSG LLSK HRYLL GIENADSVTWNPHKAM VTLQCSV+LFK ES+LENCNGLCADYLFQKDK+YDT YDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELF+LK+YLCK++KEK GF MV++KPEYLNICFWY PEK+R I+  KEK  +L++VTAKIKQSMLE+GTTMI+YQPLF KPNFFRLILSN +C+ ED+DFV+DEIVK+GEEI L
Sbjct:  294 VKLVKCNERGKMDTENLIELINESIENKNIPCMVCSTGGTTVLGAFDPIDEISKICKRFGLWLHVDCAWGSGALLSKSHRYLLNGIENADSVTWNPHKAMAVTLQCSVILFKKESILENCNGLCADYLFQKDKNYDTRYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFILKDYLCKIIKEKNGFEMVIEKPEYLNICFWYIPEKYRKIDTAKEKFTMLHEVTAKIKQSMLESGTTMISYQPLFEKPNFFRLILSNPSCKVEDIDFVVDEIVKLGEEINL 581          
BLAST of Glutamate decarboxylase 1 vs. TrEMBL
Match: A0A267G9L4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010169g2 PE=4 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 3.311e-117
Identity = 163/282 (57.80%), Postives = 211/282 (74.82%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESV--LENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVLD 1120
            GKM  +HL++LI      G  P  V ATGGTTVLGAFDP++ I+ +C+  G+W HVD AWG GVLLS+RHR+LL G++ ADSVTWNPHK MGVTLQCSV+L     +  L+ CNG+ ADYLFQ+DK YD SYDTGDKSIQCGRRND+FKLWL WR+KGDEG+  Q++ L  L  YLC+ LK++ G+ MV++KP+++N+CFWY PEKFR ++   E+  ++N+V  K+K  M+E+GTTM+ YQPL   PNFFR+I+SN A  + D+DF+LD I K   EI  D
Sbjct:  401 GKMLPEHLEQLIGLARSRGQEPFFVSATGGTTVLGAFDPLDAIADVCERHGLWFHVDTAWGGGVLLSQRHRHLLAGVQRADSVTWNPHKLMGVTLQCSVILLPERHIGLLQGCNGMQADYLFQQDKQYDVSYDTGDKSIQCGRRNDIFKLWLSWRAKGDEGYGEQVDYLIDLANYLCQQLKKRPGYEMVMEKPDFVNVCFWYVPEKFRSMKPGPERDSVINEVAPKVKALMMESGTTMVGYQPLGNLPNFFRMIVSNPAATEADIDFLLDCIEKYSAEIFDD 682          
BLAST of Glutamate decarboxylase 1 vs. TrEMBL
Match: A0A267ELR0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010169g1 PE=4 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.369e-116
Identity = 163/282 (57.80%), Postives = 210/282 (74.47%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESV--LENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVLD 1120
            GKM  +HL++LI      G  P  V ATGGTTVLGAFDP++ I+ +C+  G+W HVD AWG GVLLS+RHR+LL G++ ADSVTWNPHK MGVTLQCSV+L     +  L+ CNG+ ADYLFQ+DK YD SYDTGDKSIQCGRRND+FKLWL WR+KGDEG+  Q++ L  L  YLC+ LK++ G+ MV++KP+++N+CFWY PEKFR ++   E+   +N+V  K+K  M+E+GTTM+ YQPL   PNFFR+I+SN A  + D+DF+LD I K   EI  D
Sbjct:  412 GKMLPEHLEQLIGLARSRGQEPFFVSATGGTTVLGAFDPLDAIADVCERHGLWFHVDTAWGGGVLLSQRHRHLLAGVQRADSVTWNPHKLMGVTLQCSVILLPERHIGLLQGCNGMQADYLFQQDKQYDVSYDTGDKSIQCGRRNDIFKLWLSWRAKGDEGYGEQVDYLIDLANYLCQQLKKRPGYEMVMEKPDFVNVCFWYVPEKFRSMKPGPERDSAINEVAPKVKALMMESGTTMVGYQPLGNLPNFFRMIVSNPAATEADIDFLLDCIEKYSAEIFDD 693          
BLAST of Glutamate decarboxylase 1 vs. TrEMBL
Match: A0A267FCJ6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013230g1 PE=4 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.917e-116
Identity = 163/282 (57.80%), Postives = 210/282 (74.47%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESV--LENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVLD 1120
            GKM  +HL++LI      G  P  V ATGGTTVLGAFDP++ I+ +C+  G+W HVD AWG GVLLS+RHR+LL G++ ADSVTWNPHK MGVTLQCSV+L     +  L+ CNG+ ADYLFQ+DK YD SYDTGDKSIQCGRRND+FKLWL WR+KGDEG+  Q++ L  L  YLC+ LK++ G+ MV++KP+++N+CFWY PEKFR ++   E+   +N+V  K+K  M+E+GTTM+ YQPL   PNFFR+I+SN A  + D+DF+LD I K   EI  D
Sbjct:  415 GKMLPEHLEQLIGLARSRGQEPFFVSATGGTTVLGAFDPLDAIADVCERHGLWFHVDTAWGGGVLLSQRHRHLLAGVQRADSVTWNPHKLMGVTLQCSVILLPERHIGLLQGCNGMQADYLFQQDKQYDVSYDTGDKSIQCGRRNDIFKLWLSWRAKGDEGYGEQVDYLIDLANYLCQQLKKRPGYEMVMEKPDFVNVCFWYVPEKFRSMKPGPERDSAINEVAPKVKALMMESGTTMVGYQPLGNLPNFFRMIVSNPAATEADIDFLLDCIEKYSAEIFDD 696          
BLAST of Glutamate decarboxylase 1 vs. TrEMBL
Match: A0A2R2MMY6 (glutamate decarboxylase 1-like OS=Lingula unguis OX=7574 GN=LOC106178949 PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 5.812e-115
Identity = 157/276 (56.88%), Postives = 202/276 (73.19%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEE 1108
            GKM    L++ I      G +P  V ATGGTTV GA+DPI+EI+ +C+   IWLHVDCAWG GVL+S +H++L+KGI  ADSVTWNPHK +GVTLQCS +L K++ +L +CN +CADYLFQ+DK+YD SYDTGDK+IQCGR ND+FK WLMWR+KGD G ++ IN LF LK Y+   L  ++GF MVL++PE  NICFWY P   R +    ++   LN V  ++K  M+E GTTMI YQP   +PNFFR+I+SN A  K D+DF+LDEI ++GEE
Sbjct:    1 GKMIPAELEKAIVAAKIDGAVPFFVNATGGTTVYGAYDPIDEIADVCEKHNIWLHVDCAWGGGVLVSSKHKHLVKGIHRADSVTWNPHKMLGVTLQCSAILLKHKDLLAHCNSMCADYLFQQDKNYDVSYDTGDKAIQCGRHNDIFKFWLMWRAKGDAGLESHINRLFDLKRYMLDRLAAREGFEMVLEEPECTNICFWYVPRSMRKMAPGPDRDYKLNLVAPRVKGLMMEAGTTMIGYQPHGNQPNFFRMIISNNASTKSDIDFLLDEIERLGEE 276          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Cavefish
Match: zgc:163121 (glutamate decarboxylase 1-like [Source:NCBI gene;Acc:103030265])

HSP 1 Score: 329.331 bits (843), Expect = 6.019e-108
Identity = 153/278 (55.04%), Postives = 194/278 (69.78%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVL-DKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L+  I      G +P  V AT GTTV GAFDP+ EI+ IC   G+W+HVD AWG G+LLS+RHR  L+GI+ A S+TWNPHK MGV LQCS +L + + +L+ CN LCA+YLFQ DKHYD SYDTGDKSIQCGR  DVFKLWLMW++KG EGF++QIN      EYL   LK +  F +V   KPE+ N+CFW+ P   R++    E+ + L+ V  KIK  M+E G TMI YQPL  K NFFR + SN A ++ED+DF+LDEIV++G E+
Sbjct:  258 GKMIPEELESSIRRAETKGLVPFYVNATAGTTVYGAFDPLNEIADICARCGLWMHVDAAWGGGLLLSRRHRMKLQGIDRASSITWNPHKMMGVPLQCSAILVRKKGLLQECNQLCAEYLFQPDKHYDVSYDTGDKSIQCGRHVDVFKLWLMWKAKGSEGFESQINHCLENAEYLYHKLKSRTDFQLVFQSKPEHSNVCFWHLPSHVRNMPAGPERDRELHMVAPKIKAKMMEEGVTMIGYQPLQDKVNFFRCVFSNPATQREDVDFLLDEIVRLGREV 535          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Cavefish
Match: zgc:163121 (glutamate decarboxylase 1-like [Source:NCBI gene;Acc:103030265])

HSP 1 Score: 329.331 bits (843), Expect = 6.019e-108
Identity = 153/278 (55.04%), Postives = 194/278 (69.78%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVL-DKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L+  I      G +P  V AT GTTV GAFDP+ EI+ IC   G+W+HVD AWG G+LLS+RHR  L+GI+ A S+TWNPHK MGV LQCS +L + + +L+ CN LCA+YLFQ DKHYD SYDTGDKSIQCGR  DVFKLWLMW++KG EGF++QIN      EYL   LK +  F +V   KPE+ N+CFW+ P   R++    E+ + L+ V  KIK  M+E G TMI YQPL  K NFFR + SN A ++ED+DF+LDEIV++G E+
Sbjct:  258 GKMIPEELESSIRRAETKGLVPFYVNATAGTTVYGAFDPLNEIADICARCGLWMHVDAAWGGGLLLSRRHRMKLQGIDRASSITWNPHKMMGVPLQCSAILVRKKGLLQECNQLCAEYLFQPDKHYDVSYDTGDKSIQCGRHVDVFKLWLMWKAKGSEGFESQINHCLENAEYLYHKLKSRTDFQLVFQSKPEHSNVCFWHLPSHVRNMPAGPERDRELHMVAPKIKAKMMEEGVTMIGYQPLQDKVNFFRCVFSNPATQREDVDFLLDEIVRLGREV 535          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Cavefish
Match: zgc:163121 (glutamate decarboxylase 1-like [Source:NCBI gene;Acc:103030265])

HSP 1 Score: 328.946 bits (842), Expect = 2.105e-107
Identity = 153/278 (55.04%), Postives = 194/278 (69.78%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVL-DKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM  + L+  I      G +P  V AT GTTV GAFDP+ EI+ IC   G+W+HVD AWG G+LLS+RHR  L+GI+ A S+TWNPHK MGV LQCS +L + + +L+ CN LCA+YLFQ DKHYD SYDTGDKSIQCGR  DVFKLWLMW++KG EGF++QIN      EYL   LK +  F +V   KPE+ N+CFW+ P   R++    E+ + L+ V  KIK  M+E G TMI YQPL  K NFFR + SN A ++ED+DF+LDEIV++G E+
Sbjct:  295 GKMIPEELESSIRRAETKGLVPFYVNATAGTTVYGAFDPLNEIADICARCGLWMHVDAAWGGGLLLSRRHRMKLQGIDRASSITWNPHKMMGVPLQCSAILVRKKGLLQECNQLCAEYLFQPDKHYDVSYDTGDKSIQCGRHVDVFKLWLMWKAKGSEGFESQINHCLENAEYLYHKLKSRTDFQLVFQSKPEHSNVCFWHLPSHVRNMPAGPERDRELHMVAPKIKAKMMEEGVTMIGYQPLQDKVNFFRCVFSNPATQREDVDFLLDEIVRLGREV 572          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Cavefish
Match: gad2 (glutamate decarboxylase 2 [Source:ZFIN;Acc:ZDB-GENE-030909-9])

HSP 1 Score: 318.161 bits (814), Expect = 9.466e-106
Identity = 143/279 (51.25%), Postives = 202/279 (72.40%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             GKM    L+  I E  + G++P  V AT GTTV GAFDP+  +S ICK + +W+HVD AWG  +L+S++HR+ L G+E A+S+TWNPHK M V LQCS +L + E ++++CN + A YLFQ+DKHYD SYDTGDK++QCGR  D+FKLWLMWR+KG  GF+ QI++   L EYL   +K+++G+ MV D KP++ N+CFWY P   R++E + EK K L+KV   IK  M+E GTTM++YQP   K NFFR+++SN A   ED+DF+++EI ++G+++
Sbjct:  100 RGKMIPSDLERRILEAKQKGYVPFFVSATAGTTVYGAFDPLIAVSDICKKYDVWMHVDGAWGGSLLMSRKHRWKLNGVERANSMTWNPHKMMAVPLQCSALLVREEGLMQSCNQMHACYLFQQDKHYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDKCLELSEYLYNKIKDREGYEMVFDGKPQHTNVCFWYLPPGVRYLEDKVEKMKRLHKVAPTIKARMMEYGTTMVSYQPQGDKVNFFRMVISNPAATFEDIDFLIEEIERLGQDL 378          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Cavefish
Match: gad1b (glutamate decarboxylase 1-like [Source:NCBI gene;Acc:103023147])

HSP 1 Score: 313.538 bits (802), Expect = 1.776e-101
Identity = 136/279 (48.75%), Postives = 194/279 (69.53%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             G++    L+  I +  + G++P  V AT GTTV GAFDPI +I+ IC+ + +WLHVD AWG G+L+S++HR+ L G+  A+SVTWNPHK MGV LQCS +L + + +L+ CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I+    L EYL   +K + G+ MV   +P++ N+CFWY P   R++   +E+ + L+KV  KIK  M+E GTTM+ YQP   K NFFR+++SN A  + D+DF++DEI ++G ++
Sbjct:  288 RGRVIPADLEAKIIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGVHRANSVTWNPHKMMGVPLQCSAILVREKGILQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDRCLELSEYLYNKIKNRPGYEMVFQGEPQHTNVCFWYIPPGMRNMPHGEERRERLHKVAPKIKAMMMEAGTTMVGYQPQGNKVNFFRMVISNHAATRSDIDFLIDEIERLGHDL 566          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 97.0561 bits (240), Expect = 3.271e-22
Identity = 58/188 (30.85%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  275 IEGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNM 838
            +E  +  + L+  + E    G +P  VCAT GTT +  FD + E+  IC+  G+WLHVD A+     L    R  L+G+E ADS   NP K M V L C+V    ++  L++    C +  + + +H  +  D     I    R    KLW + RS G +G Q  +     L  Y   +++E   F +
Sbjct:  207 LEFSLRGETLRRAVEEDRAQGLVPFFVCATLGTTGVCTFDNMAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPGKWMMVNLDCAVFWVADKRSLQST--FCVEPHYLQHEHSGSVTDFMHWQIPLTVRFRSLKLWFVIRSFGLDGLQEHVRRTNKLARYFESLVREDPHFEI 392          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 92.8189 bits (229), Expect = 4.558e-21
Identity = 56/168 (33.33%), Postives = 81/168 (48.21%), Query Frame = 2
Query:  275 IEGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINE 778
            +E  +  + L+  + E    G +P  VCAT G+T + AFD + E+  IC+  G+WLHVD A+     L    R  L GIE ADS   NP K M V L C+V    ++  L++    C +  + K +H  +  D     I    R    KLW + RS G +G Q  +  
Sbjct:  216 LEFSLRGETLRRAVEEDRAQGLVPFFVCATLGSTGVCAFDNLSELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLHGIEIADSFVVNPGKWMMVNLDCTVFWVADKRSLQST--FCVEPHYLKHEHSGSVTDLMHWQIPLTVRFRSLKLWFVIRSFGLDGLQEHVRR 381          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 81.6481 bits (200), Expect = 3.614e-17
Identity = 45/133 (33.83%), Postives = 70/133 (52.63%), Query Frame = 2
Query:  275 IEGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYD 673
            +E  +  + L+  ++E    G +P  VCAT GTT + AFD + E+  IC+  G+WLHVD A+     L    R  L+G+E ADS   NP K M V L C+V    ++  L++    C +  + + +H  +  D
Sbjct:  217 LEFSLRGETLRRAVDEDRAQGLVPFFVCATLGTTGVCAFDNMAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPGKWMMVNLDCAVFWVADKRSLQST--FCVEPHYLQHEHSGSVTD 347          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 71.633 bits (174), Expect = 3.529e-14
Identity = 39/101 (38.61%), Postives = 53/101 (52.48%), Query Frame = 2
Query:  275 IEGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSV 577
            +E  +  + L+  + E    G +P  V  T GTT L AFD + E+  IC+  G+WLHVD A+     L    R  L+G+E ADS   NP K M V L  +V
Sbjct:  211 LEFSLRGETLRRAVEEDRAQGLVPFFVSVTLGTTGLCAFDNLAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPSKWMMVNLDSAV 311          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Nematostella
Match: EDO43411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYR9])

HSP 1 Score: 95.5153 bits (236), Expect = 1.674e-21
Identity = 61/200 (30.50%), Postives = 92/200 (46.00%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWY 880
            G +  +   E +    + G IP  +CAT GTT L ++D ++E+  +     +WLHVD A+          R  ++GIE ADS   N HK M     C+ +  K+   L     L   Y    D    T +   +  I  GRR    KLW + RS G EG Q +I E   L +   +++K+   F +V+D   +  +CF Y
Sbjct:  220 GSLRGEQFLECLKADKEAGLIPFFLCATLGTTTLCSYDNLKELGPLAVKEKMWLHVDAAYAGPAFTCPEMRAPMQGIELADSFNCNAHKMMMTNFDCAPMWVKDRDALMRAFTLERIYYPDDDTGVVTEFR--NWQIPLGRRFRSLKLWFVIRSYGIEGIQKEIREHVRLAKVFEEMVKQDDDFELVVDT-NFGLVCFRY 416          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Nematostella
Match: EDO43392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV7])

HSP 1 Score: 89.3521 bits (220), Expect = 2.181e-19
Identity = 52/185 (28.11%), Postives = 89/185 (48.11%), Query Frame = 2
Query:  287 MDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMV 841
            M+   L++ +     +G  P  +CA+ GTT   AFD +++I  IC+   IW+H+D A+     +    R LL G+E A+S  +NPHK M     CS +  K+  +L+    +  D ++ + + +    ++ D  I  GR     KLW + R+ G EG Q  +     + +    +L +   F  V
Sbjct:  222 MNVVALEKAVKVDEAMGLHPFYLCASLGTTSTCAFDDLKKIGPICQRESIWMHIDAAYSGPAFMCPEFRPLLDGVEFAESFNFNPHKLMLTNFDCSALWVKHRDMLK--KAMHVDPIYLRKRSF--MGESKDWEIPLGRSMRALKLWFVLRTYGLEGIQKHVRNHVKMAKLFESLLAQDSRFEQV 402          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Medaka
Match: GAD1 (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101168897])

HSP 1 Score: 315.079 bits (806), Expect = 2.108e-104
Identity = 136/279 (48.75%), Postives = 197/279 (70.61%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDK-PEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             G++    L+  I +  + G++P  V AT G+TV GAFDPI EI+ IC+ + +WLHVD AWG G+L+S++HR+ L G+E A+SVTWNPHK MGV LQCS +L + + +L  CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I++   L +YL   +  ++GF MV D  P++ N+CFWY P   R +   +E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN+A  + D+DF++DEI ++G+++
Sbjct:  104 RGRVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLYNKINNREGFQMVFDGVPQHTNVCFWYVPPSLRGMSDSEERREKLHRVAPKIKAMMMESGTTMVGYQPQGNKVNFFRMVVSNSAVTQSDIDFLVDEIERLGQDL 382          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Medaka
Match: gad2 (glutamate decarboxylase 2 [Source:NCBI gene;Acc:101169246])

HSP 1 Score: 319.316 bits (817), Expect = 1.768e-103
Identity = 148/278 (53.24%), Postives = 197/278 (70.86%), Query Frame = 2
Query:  281 GKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            GKM    L+  I E  + G +P  V AT GTTV GAFDP+  IS ICK + IW+HVD AWG  +L+S+RHR+ L G+E A+SVTWNPHK M V LQCS +L + E +++NCN + A YLFQ+DK YD SYDTGDK++QCGR  D+FKLWLMWR+KG  GF+ QI+    L EYL   +K++ G+ MV D KP++ N+CFWY P   R+IE + EK K L+KV   IK  M+E GTTM++YQP   K NFFR+++SN A   ED+DF+++EI ++G ++
Sbjct:  309 GKMIPADLERRILEAKQKGFVPFFVSATAGTTVYGAFDPLIAISDICKKYNIWMHVDGAWGGSLLMSRRHRWKLDGVERANSVTWNPHKMMSVPLQCSALLVREEGLMQNCNQMHACYLFQQDKQYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDRCLELSEYLYNKIKDRDGYEMVFDGKPQHTNVCFWYLPPGMRYIEDKDEKKKRLHKVAPVIKARMMEYGTTMVSYQPQGDKVNFFRMVISNPAATFEDIDFLIEEIERLGHDL 586          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Medaka
Match: GAD1 (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101168897])

HSP 1 Score: 315.464 bits (807), Expect = 2.467e-102
Identity = 136/279 (48.75%), Postives = 197/279 (70.61%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDK-PEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             G++    L+  I +  + G++P  V AT G+TV GAFDPI EI+ IC+ + +WLHVD AWG G+L+S++HR+ L G+E A+SVTWNPHK MGV LQCS +L + + +L  CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I++   L +YL   +  ++GF MV D  P++ N+CFWY P   R +   +E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN+A  + D+DF++DEI ++G+++
Sbjct:  286 RGRVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLYNKINNREGFQMVFDGVPQHTNVCFWYVPPSLRGMSDSEERREKLHRVAPKIKAMMMESGTTMVGYQPQGNKVNFFRMVVSNSAVTQSDIDFLVDEIERLGQDL 564          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Medaka
Match: GAD1 (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101168897])

HSP 1 Score: 315.079 bits (806), Expect = 6.352e-102
Identity = 136/279 (48.75%), Postives = 197/279 (70.61%), Query Frame = 2
Query:  278 EGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDK-PEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
             G++    L+  I +  + G++P  V AT G+TV GAFDPI EI+ IC+ + +WLHVD AWG G+L+S++HR+ L G+E A+SVTWNPHK MGV LQCS +L + + +L  CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I++   L +YL   +  ++GF MV D  P++ N+CFWY P   R +   +E+ + L++V  KIK  M+E+GTTM+ YQP   K NFFR+++SN+A  + D+DF++DEI ++G+++
Sbjct:  305 RGRVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLYNKINNREGFQMVFDGVPQHTNVCFWYVPPSLRGMSDSEERREKLHRVAPKIKAMMMESGTTMVGYQPQGNKVNFFRMVVSNSAVTQSDIDFLVDEIERLGQDL 583          
BLAST of Glutamate decarboxylase 1 vs. Ensembl Medaka
Match: gad1a (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101159146])

HSP 1 Score: 307.76 bits (787), Expect = 5.847e-99
Identity = 133/260 (51.15%), Postives = 185/260 (71.15%), Query Frame = 2
Query:  335 GHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLD-KPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEI 1111
            G++P  V AT GTTV GAFDPI EI+ IC+ + IWLHVD AWG G+L+S++H++ L GI  A+SVTWNPHK MGV LQCS ++ +   +L+ CN +CA YLFQ DK YD +YDTGDK+IQCGR  D+FK WLMW++KG  GF+  I++   L  Y    +K ++GF MV   +P++ N+CFWY P   R +    E+ + L+KV  KIK  M+E+GTTM+ YQP   K NFFR+++SN+A  + D+DF+++EI ++G E+
Sbjct:  337 GYVPLFVNATAGTTVYGAFDPINEIADICEKYNIWLHVDGAWGGGLLMSRKHKHKLDGIHRANSVTWNPHKMMGVPLQCSAIMVRERGLLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDKCLDLSAYFYSKIKNREGFEMVFSGEPQHTNVCFWYIPPSLRGMPDGTERRERLHKVAPKIKALMMESGTTMVGYQPQGDKVNFFRMVISNSAATQSDIDFLIEEIERLGHEL 596          
BLAST of Glutamate decarboxylase 1 vs. Planmine SMEST
Match: SMESG000050934.1 (SMESG000050934.1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 278/279 (99.64%), Postives = 278/279 (99.64%), Query Frame = 2
Query:  287 MDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVLDF 1123
            MDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIE EKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVLDF
Sbjct:    1 MDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTPEKFRHIEGEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLILSNAACRKEDLDFVLDEIVKIGEEIVLDF 279          
BLAST of Glutamate decarboxylase 1 vs. Planmine SMEST
Match: SMESG000066844.1 (SMESG000066844.1)

HSP 1 Score: 112.464 bits (280), Expect = 8.792e-27
Identity = 71/194 (36.60%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  260 RFVKLIEGKMDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMV 841
            R VK I+ KM    L+E+I E ++ G  P    AT GTT   AFD ++EI  IC+   IWLHVD A+    L+ + +R+LL GIE A S  +NPHK M V   CS V FK+   +        D ++ K K      D     IQ GRR    K+W + R  G +G Q  I     L     K++     F +V
Sbjct:  231 REVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFV--VETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIV 422          
BLAST of Glutamate decarboxylase 1 vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 107.457 bits (267), Expect = 8.154e-25
Identity = 67/195 (34.36%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  263 FVKLIEGKMDSQH------LKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQI-NELFLLKEYLCKVLKEKK 826
            FVK+ +  +D ++      L+E I    ++G IP MV AT GTT   +FD +EEIS +CK + IWLHVD A+     +    ++ LKGIEN DS+++N +K + V   CS++  +  S +   + +  D ++ + KH   + D     I   RR    KLW   R+ G EG Q  I N + L  E+   V K  +
Sbjct:  247 FVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQI--TDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDR 439          
BLAST of Glutamate decarboxylase 1 vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 107.457 bits (267), Expect = 8.565e-25
Identity = 67/195 (34.36%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  263 FVKLIEGKMDSQH------LKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQI-NELFLLKEYLCKVLKEKK 826
            FVK+ +  +D ++      L+E I    ++G IP MV AT GTT   +FD +EEIS +CK + IWLHVD A+     +    ++ LKGIEN DS+++N +K + V   CS++  +  S +   + +  D ++ + KH   + D     I   RR    KLW   R+ G EG Q  I N + L  E+   V K  +
Sbjct:  250 FVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQI--TDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDR 442          
BLAST of Glutamate decarboxylase 1 vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 107.457 bits (267), Expect = 8.730e-25
Identity = 67/195 (34.36%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  263 FVKLIEGKMDSQH------LKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGIWLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLFKNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMWRSKGDEGFQNQI-NELFLLKEYLCKVLKEKK 826
            FVK+ +  +D ++      L+E I    ++G IP MV AT GTT   +FD +EEIS +CK + IWLHVD A+     +    ++ LKGIEN DS+++N +K + V   CS++  +  S +   + +  D ++ + KH   + D     I   RR    KLW   R+ G EG Q  I N + L  E+   V K  +
Sbjct:  218 FVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQI--TDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDR 410          
The following BLAST results are available for this feature:
BLAST of Glutamate decarboxylase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAD21.072e-10751.25glutamate decarboxylase 2 [Source:HGNC Symbol;Acc:... [more]
GAD26.787e-10651.25glutamate decarboxylase 2 [Source:HGNC Symbol;Acc:... [more]
GAD26.787e-10651.25glutamate decarboxylase 2 [Source:HGNC Symbol;Acc:... [more]
GAD14.122e-10551.80glutamate decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
CSAD5.005e-9846.85cysteine sulfinic acid decarboxylase [Source:HGNC ... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-251.731e-11054.87Glutamic acid decarboxylase [Source:UniProtKB/TrE... [more]
unc-256.261e-11054.87Glutamic acid decarboxylase [Source:UniProtKB/TrE... [more]
unc-256.261e-11054.87Glutamic acid decarboxylase [Source:UniProtKB/TrE... [more]
unc-257.620e-7354.19Glutamic acid decarboxylase [Source:UniProtKB/TrE... [more]
bas-13.228e-2030.73Biogenic Amine Synthesis related [Source:UniProtK... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4.519e-9748.38gene:FBgn0000153 transcript:FBtr0342712[more]
b7.600e-9748.38gene:FBgn0000153 transcript:FBtr0309960[more]
b7.600e-9748.38gene:FBgn0000153 transcript:FBtr0080542[more]
Gad12.561e-9449.82gene:FBgn0004516 transcript:FBtr0073277[more]
Gad12.561e-9449.82gene:FBgn0004516 transcript:FBtr0332980[more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1631211.149e-10855.76zgc:163121 [Source:ZFIN;Acc:ZDB-GENE-070424-80][more]
zgc:1631216.081e-10755.76zgc:163121 [Source:ZFIN;Acc:ZDB-GENE-070424-80][more]
gad1b1.903e-10149.28glutamate decarboxylase 1b [Source:ZFIN;Acc:ZDB-GE... [more]
gad24.158e-10150.72glutamate decarboxylase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
gad1b5.378e-10149.10glutamate decarboxylase 1b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh225.039e-10854.71cadherin 22 [Source:Xenbase;Acc:XB-GENE-922905][more]
cdh223.148e-10754.71cadherin 22 [Source:Xenbase;Acc:XB-GENE-922905][more]
mxra54.574e-10753.76matrix-remodelling associated 5 [Source:Xenbase;Ac... [more]
mxra55.949e-10752.88matrix-remodelling associated 5 [Source:Xenbase;Ac... [more]
mxra56.582e-10753.76matrix-remodelling associated 5 [Source:Xenbase;Ac... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gad16.594e-10651.80glutamate decarboxylase 1 [Source:MGI Symbol;Acc:M... [more]
Gad28.963e-10550.90glutamic acid decarboxylase 2 [Source:MGI Symbol;A... [more]
Gadl18.679e-9347.12glutamate decarboxylase-like 1 [Source:MGI Symbol;... [more]
Gadl18.679e-9347.12glutamate decarboxylase-like 1 [Source:MGI Symbol;... [more]
Csad7.284e-8845.62cysteine sulfinic acid decarboxylase [Source:MGI S... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48319|DCE1_PIG6.088e-10753.24Glutamate decarboxylase 1 OS=Sus scrofa OX=9823 GN... [more]
sp|A0PA85|DCE1_CANLF2.438e-10652.88Glutamate decarboxylase 1 OS=Canis lupus familiari... [more]
sp|P14748|DCE1_FELCA2.834e-10652.88Glutamate decarboxylase 1 OS=Felis catus OX=9685 G... [more]
sp|Q0VCA1|DCE1_BOVIN6.993e-10652.52Glutamate decarboxylase 1 OS=Bos taurus OX=9913 GN... [more]
sp|Q05329|DCE2_HUMAN3.259e-10551.25Glutamate decarboxylase 2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B2ZX201.176e-16779.86Glutamic acid decarboxylase OS=Dugesia japonica OX... [more]
A0A267G9L43.311e-11757.80Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267ELR01.369e-11657.80Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FCJ61.917e-11657.80Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A2R2MMY65.812e-11556.88glutamate decarboxylase 1-like OS=Lingula unguis O... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1631216.019e-10855.04glutamate decarboxylase 1-like [Source:NCBI gene;A... [more]
zgc:1631216.019e-10855.04glutamate decarboxylase 1-like [Source:NCBI gene;A... [more]
zgc:1631212.105e-10755.04glutamate decarboxylase 1-like [Source:NCBI gene;A... [more]
gad29.466e-10651.25glutamate decarboxylase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
gad1b1.776e-10148.75glutamate decarboxylase 1-like [Source:NCBI gene;A... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hdc3.271e-2230.85histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc4.558e-2133.33histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc3.614e-1733.83histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc3.529e-1438.61histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434111.674e-2130.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433922.181e-1928.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAD12.108e-10448.75glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
gad21.768e-10353.24glutamate decarboxylase 2 [Source:NCBI gene;Acc:10... [more]
GAD12.467e-10248.75glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
GAD16.352e-10248.75glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
gad1a5.847e-9951.15glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Glutamate decarboxylase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050934.10.000e+099.64SMESG000050934.1[more]
SMESG000066844.18.792e-2736.60SMESG000066844.1[more]
SMESG000019737.18.154e-2534.36SMESG000019737.1[more]
SMESG000019737.18.565e-2534.36SMESG000019737.1[more]
SMESG000019737.18.730e-2534.36SMESG000019737.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30001003 ID=SMED30001003|Name=Glutamate decarboxylase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1252bp
TTCATCTTCGTGTAGTGTTCATCATGTTTATTCAGCACATTTAAACTAAC
CCAAAGTTCAAGTTTTAGCTCGGTATTTATCAAAATAGGTCAGGGCCAGG
TTTAATGTCGAATAACTAAAAAGTAGCAAAATGGACAGACAAAAGAGCGT
TGAAAGATTTATAAATATTTTCATTTTGAAATTTAATATTTTTTGAAAGA
CATCAAGTGAAAAGAAACTTGAAAGAAAGATTCAATTAGAAGAGTAAAGA
GAAGGGGAGAGATTTGTTAAATTAATAGAAGGTAAAATGGATAGTCAACA
TTTGAAAGAATTAATTAATGAAACCATAAAAGTTGGTCATATTCCTTGTA
TGGTTTGTGCAACAGGTGGAACAACAGTTCTTGGAGCTTTTGATCCGATT
GAAGAAATTTCCAAAATTTGTAAATGCTTTGGCATATGGCTTCATGTCGA
TTGTGCATGGGGAAGTGGAGTTCTTTTGTCAAAGAGACATCGTTATCTAT
TGAAGGGAATTGAAAATGCTGACTCTGTCACATGGAATCCTCATAAGGCT
ATGGGTGTCACATTGCAGTGTTCTGTAGTCTTATTTAAAAATGAATCTGT
TCTGGAAAATTGCAATGGACTATGCGCTGATTATTTATTTCAAAAGGATA
AACATTATGATACAAGTTATGATACGGGTGACAAAAGTATTCAATGTGGA
CGAAGAAATGATGTTTTCAAGTTATGGTTAATGTGGCGGTCAAAAGGAGA
TGAAGGATTTCAAAATCAGATAAACGAACTCTTCTTGCTGAAAGAATATC
TCTGTAAAGTTTTAAAAGAGAAAAAGGGATTCAACATGGTTTTAGATAAG
CCCGAATATCTCAATATATGTTTCTGGTACACACCTGAAAAATTTCGACA
CATTGAAGTGGAGAAAGAGAAACATAAAATTCTTAATAAAGTAACTGCAA
AAATCAAGCAGTCAATGCTTGAAACTGGAACGACAATGATAAATTATCAA
CCTCTCTTTGGAAAGCCAAACTTTTTTAGGTTGATTTTATCAAACGCGGC
TTGCAGAAAAGAGGACCTTGATTTCGTTTTAGACGAAATTGTCAAAATAG
GCGAAGAAATAGTTTTGGATTTCTAAAACCATTTCTTGGAAATTAGATGG
CGGCGTTTTTGAAACGATTTATTAAATAGTTTATAATTACTGTTTATCTA
TATATTAGTTAGAGAAAAAACTTTCGCATTCCTTTGTTTTAATGTACGTC
CT
back to top

protein sequence of SMED30001003-orf-1

>SMED30001003-orf-1 ID=SMED30001003-orf-1|Name=SMED30001003-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=280bp
MDSQHLKELINETIKVGHIPCMVCATGGTTVLGAFDPIEEISKICKCFGI
WLHVDCAWGSGVLLSKRHRYLLKGIENADSVTWNPHKAMGVTLQCSVVLF
KNESVLENCNGLCADYLFQKDKHYDTSYDTGDKSIQCGRRNDVFKLWLMW
RSKGDEGFQNQINELFLLKEYLCKVLKEKKGFNMVLDKPEYLNICFWYTP
EKFRHIEVEKEKHKILNKVTAKIKQSMLETGTTMINYQPLFGKPNFFRLI
LSNAACRKEDLDFVLDEIVKIGEEIVLDF*
back to top
Aliases
The feature 'Glutamate decarboxylase 1' has the following synonyms
Synonym
Dj-GADA
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR002129PyrdxlP-dep_de-COase
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016831carboxy-lyase activity
GO:0030170pyridoxal phosphate binding
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0019752carboxylic acid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 1..124
e-value: 4.6E-21
score: 77.0
NoneNo IPR availableGENE3DG3DSA:3.90.1150.170coord: 125..274
e-value: 2.4E-49
score: 169.6
NoneNo IPR availablePANTHERPTHR45677FAMILY NOT NAMEDcoord: 1..275
NoneNo IPR availablePANTHERPTHR45677:SF10GLUTAMATE DECARBOXYLASEcoord: 1..275
IPR002129Pyridoxal phosphate-dependent decarboxylasePFAMPF00282Pyridoxal_deCcoord: 3..198
e-value: 1.7E-68
score: 231.0
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 1..275