Pyruvate kinase

Overview
NamePyruvate kinase
Smed IDSMED30000995
Length (bp)1940
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyruvate kinase (SMED30000995) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyruvate kinase (SMED30000995) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyruvate kinase (SMED30000995) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyruvate kinase (SMED30000995) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000995

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000995SMESG000052083.1 Contig25527newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000995SMESG000052083.1 Contig25527uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000995SMESG000052083.1 Contig49617newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000995SMESG000052083.1 Contig49617uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000995SMESG000052083.1 Contig51218newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000995SMESG000052083.1 Contig51218uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v6_605_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30000995SMESG000052083.1 Contig27053newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000995SMESG000052083.1 Contig27053uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Category 3 cellSMED30000995SMESG000052083.1 SMESG000048475.1 dd_Smed_v4_605_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 343/522 (65.71%), Postives = 410/522 (78.54%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  K FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 343/522 (65.71%), Postives = 410/522 (78.54%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  K FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 343/522 (65.71%), Postives = 410/522 (78.54%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  K FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 343/522 (65.71%), Postives = 410/522 (78.54%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  K FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 342/522 (65.52%), Postives = 412/522 (78.93%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A++  + FE+L+     ++D T +TA+ AVEA+ +C + AI+V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 312/519 (60.12%), Postives = 390/519 (75.14%), Query Frame = 3
Query:  108 NYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
            +YF Q Q +    + +H+E +C LDI   P +VR + IICTIGPAC +V  L+K+I +GMNIAR+NFSHGSHEYHA TI  VREA ++F+   R + +ALDTKGPEIRTGL+ G  + E+ L +G  I+L  D  +++S     L+VDYKNI K+L  G R+Y+DDGLISLIV E   D + C VENGG LGS+KGVNLPG  VDLPAVS+KD  DL FGVEQGVD++FASFIR    +  IR +LGEKGK I II+KIEN EGV   DEI+  SDG+MVARGDLGIEIPAEKVFLAQKM+I +CNR GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YP++A++IMH+IC+EAE+AV+  + F++L       TD +H+ AIAA  AA  C ASAI+++TTTGRSA   SRY+P  PILT++R     RQ HL+RGV P+ Y A+R  +W TD+DNRIN A      RGF+  GD+++VVTGW+ G+G+TNT+R+I  E
Sbjct:   41 DYFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDK-RVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 558          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 312/519 (60.12%), Postives = 390/519 (75.14%), Query Frame = 3
Query:  108 NYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
            +YF Q Q +    + +H+E +C LDI   P +VR + IICTIGPAC +V  L+K+I +GMNIAR+NFSHGSHEYHA TI  VREA ++F+   R + +ALDTKGPEIRTGL+ G  + E+ L +G  I+L  D  +++S     L+VDYKNI K+L  G R+Y+DDGLISLIV E   D + C VENGG LGS+KGVNLPG  VDLPAVS+KD  DL FGVEQGVD++FASFIR    +  IR +LGEKGK I II+KIEN EGV   DEI+  SDG+MVARGDLGIEIPAEKVFLAQKM+I +CNR GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YP++A++IMH+IC+EAE+AV+  + F++L       TD +H+ AIAA  AA  C ASAI+++TTTGRSA   SRY+P  PILT++R     RQ HL+RGV P+ Y A+R  +W TD+DNRIN A      RGF+  GD+++VVTGW+ G+G+TNT+R+I  E
Sbjct:   45 DYFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDK-RVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 562          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 312/519 (60.12%), Postives = 390/519 (75.14%), Query Frame = 3
Query:  108 NYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
            +YF Q Q +    + +H+E +C LDI   P +VR + IICTIGPAC +V  L+K+I +GMNIAR+NFSHGSHEYHA TI  VREA ++F+   R + +ALDTKGPEIRTGL+ G  + E+ L +G  I+L  D  +++S     L+VDYKNI K+L  G R+Y+DDGLISLIV E   D + C VENGG LGS+KGVNLPG  VDLPAVS+KD  DL FGVEQGVD++FASFIR    +  IR +LGEKGK I II+KIEN EGV   DEI+  SDG+MVARGDLGIEIPAEKVFLAQKM+I +CNR GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YP++A++IMH+IC+EAE+AV+  + F++L       TD +H+ AIAA  AA  C ASAI+++TTTGRSA   SRY+P  PILT++R     RQ HL+RGV P+ Y A+R  +W TD+DNRIN A      RGF+  GD+++VVTGW+ G+G+TNT+R+I  E
Sbjct:  396 DYFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDK-RVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 913          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 312/523 (59.66%), Postives = 390/523 (74.57%), Query Frame = 3
Query:   96 FEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
             E + Y  Q Q +    + +H+E +C LDI   P +VR + IICTIGPAC +V  L+K+I +GMNIAR+NFSHGSHEYHA TI  VREA ++F+   R + +ALDTKGPEIRTGL+ G  + E+ L +G  I+L  D  +++S     L+VDYKNI K+L  G R+Y+DDGLISLIV E   D + C VENGG LGS+KGVNLPG  VDLPAVS+KD  DL FGVEQGVD++FASFIR    +  IR +LGEKGK I II+KIEN EGV   DEI+  SDG+MVARGDLGIEIPAEKVFLAQKM+I +CNR GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YP++A++IMH+IC+EAE+AV+  + F++L       TD +H+ AIAA  AA  C ASAI+++TTTGRSA   SRY+P  PILT++R     RQ HL+RGV P+ Y A+R  +W TD+DNRIN A      RGF+  GD+++VVTGW+ G+G+TNT+R+I  E
Sbjct:   10 LEASGYDKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDK-RVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 531          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 312/523 (59.66%), Postives = 390/523 (74.57%), Query Frame = 3
Query:   96 FEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
             E + Y  Q Q +    + +H+E +C LDI   P +VR + IICTIGPAC +V  L+K+I +GMNIAR+NFSHGSHEYHA TI  VREA ++F+   R + +ALDTKGPEIRTGL+ G  + E+ L +G  I+L  D  +++S     L+VDYKNI K+L  G R+Y+DDGLISLIV E   D + C VENGG LGS+KGVNLPG  VDLPAVS+KD  DL FGVEQGVD++FASFIR    +  IR +LGEKGK I II+KIEN EGV   DEI+  SDG+MVARGDLGIEIPAEKVFLAQKM+I +CNR GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YP++A++IMH+IC+EAE+AV+  + F++L       TD +H+ AIAA  AA  C ASAI+++TTTGRSA   SRY+P  PILT++R     RQ HL+RGV P+ Y A+R  +W TD+DNRIN A      RGF+  GD+++VVTGW+ G+G+TNT+R+I  E
Sbjct:   10 LEASGYDKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDK-RVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 531          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: PyK (gene:FBgn0267385 transcript:FBtr0084214)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 324/517 (62.67%), Postives = 400/517 (77.37%), Query Frame = 3
Query:  126 QNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDL-KGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
            QN+  G + + LE +C L  D+    VR S I+CTIGPA  +V  L+KM+A+GMNIARMNFSHGSHEYHA T+  VR+AV+ ++    Y  PVA+ALDTKGPEIRTGLI GSGT E+ L KG KIKL  ++++ +  + EI++VDY+NIV ++  G R++VDDGLISLIV E GKD L CEVENGG+LGS+KGVNLPG  VDLPAVS+KD SDL FGVEQ VDM+FASFIR  AA+ EIR +LGEKGK+I IISKIEN +G+   DEI++A DGIMVARGDLGIEIPAEKVFLAQK MI RCN+ GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YPLE V  M   C+EAE+A++    F DL +G   G+ D +H+ AIAAVEAA + +ASAIVV+TT+G+SA+ +S+YRPRCPI+ VTR   TARQ HL+RG+ PL+Y    L +W  D+D R+ +      + GF+K GD V+VVTGWK GSG TNT+R++ +E
Sbjct:   20 QNMAAG-ADTQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDLVRG--AGTIDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVE 533          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: PyK (gene:FBgn0267385 transcript:FBtr0084213)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 321/508 (63.19%), Postives = 395/508 (77.76%), Query Frame = 3
Query:  153 SHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDL-KGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLE 1664
            + LE +C L  D+    VR S I+CTIGPA  +V  L+KM+A+GMNIARMNFSHGSHEYHA T+  VR+AV+ ++    Y  PVA+ALDTKGPEIRTGLI GSGT E+ L KG KIKL  ++++ +  + EI++VDY+NIV ++  G R++VDDGLISLIV E GKD L CEVENGG+LGS+KGVNLPG  VDLPAVS+KD SDL FGVEQ VDM+FASFIR  AA+ EIR +LGEKGK+I IISKIEN +G+   DEI++A DGIMVARGDLGIEIPAEKVFLAQK MI RCN+ GKP+ICATQMLESM+ KPRPTRAE SDVANA+LDGADCVMLSGETAKG YPLE V  M   C+EAE+A++    F DL +G   G+ D +H+ AIAAVEAA + +ASAIVV+TT+G+SA+ +S+YRPRCPI+ VTR   TARQ HL+RG+ PL+Y    L +W  D+D R+ +      + GF+K GD V+VVTGWK GSG TNT+R++ +E
Sbjct:    7 TQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDLVRG--AGTIDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVE 512          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG2964 (gene:FBgn0031462 transcript:FBtr0077722)

HSP 1 Score: 475.707 bits (1223), Expect = 1.264e-161
Identity = 236/517 (45.65%), Postives = 343/517 (66.34%), Query Frame = 3
Query:  153 SHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF---TPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIM 1694
            + L  IC LD+  +    R  S+I TI  + R   T+  MI  G+NI R+NFSH SHE H++TI+L+ EA+E     T   R VA+A DT+GP+IRTGL+ G    +V L  G+ ++L I+    D  N+E ++VDY NI+ +   G R+++DDG + L ++E G D L CEV +GG L +   V LP  ++DLPAVS+KD+ D+ F ++  VD +FAS +R    V E+R +LGEKGKHI II+K+++   + RF EIL+A+DG++++R DLG +IP EK+F+ QK ++G+CN++GKP+I A+ +LESM T P PTRAE  D+ANAI+DGADC+MLS E A G++P E V     +CREAE  ++    F DL  E+ G  D  HS AIAAVE A+R  A+ I+V+TT+GRSA L+S++RPRCPI+ +TR   TAR  +L RGV P+LY  +   ++ TD+D R+ +A   A + G + +GD +++V+ WK G G TN +RV+    +A+  D + 
Sbjct:   14 TQLSHICELDLAQQASHQRLVSLIATISVSSRNADTIYTMIMRGVNIFRLNFSHESHEMHSKTIELINEALERIHKETGQIRTVAIAADTRGPQIRTGLLDG----DVFLRSGDNLRLSINRDLYDKGNKEAVYVDYPNIINLTKTGDRLFIDDGRLLLHILEVGVDGLLCEVIHGGQLNNNCNVILPEIEIDLPAVSEKDMFDIQFSIKANVDFLFASAVRSAKNVKELRTVLGEKGKHIKIIAKMDSKIALSRFSEILRAADGLLLSRADLGTQIPIEKLFITQKSILGQCNKVGKPVIVASHILESMRTLPHPTRAECFDLANAIIDGADCIMLSSEVAIGSFPKETVATCDTLCREAEKVLWFRDLFSDLVSEVRGELDAAHSLAIAAVETAKRTNATLIIVLTTSGRSATLVSKFRPRCPIMAITRCERTARWVYLHRGVLPILYTLEPSTDYATDVDARVQFAMTSAKKWGIIDDGDPIVIVSAWKDGGGFTNNVRVVYAFFEADRVDCLF 526          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG7069 (gene:FBgn0038952 transcript:FBtr0084215)

HSP 1 Score: 430.254 bits (1105), Expect = 1.970e-141
Identity = 216/409 (52.81%), Postives = 284/409 (69.44%), Query Frame = 3
Query:  285 MNIARMNFSHGSHEYHAETIKLVREAVETF---TPYYRPVALALDTKGPEIRTG-LIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEI-VGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYD 1496
            M + RMNFSHGSHEYH +TI+  R+A+  +   T   R +A+ALDTKGPEIRTG L  G+   E+ L  G+K+ L   ++ AD  N++ ++VDY+ + +++  G R++VDDGLI+LIV E+  D + C+VENGG LGS KG+NLPG  VDLP+V++KD  DL FG EQ VDM+FASFIR   A+ EIR +LG  G  I IISKIENH+G+   D+I++ SDGIMVARGD+GIEIP E V LAQK ++ +CN++GKP+ICATQM+ESM  KPRPTRAE+SDVANAI DG D VMLSGETAKG YP+E VQ M  IC + E+ ++       LK EI   + D   +   A  EAA   +A AIVV +     A ++S  RP CPI+ +T +   A Q  L+RG++PLL +
Sbjct:    1 MRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGNDRAEIELKTGDKVTLSTKKEMADKSNKDNIYVDYQRLPQLVKPGNRVFVDDGLIALIVKESKGDEVICQVENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDMIFASFIRDANALKEIRQVLGPAGACIKIISKIENHQGLVNIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGCDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKREIRTSAADHISAVTTAIAEAATVGQARAIVVASPCSMVAQMVSHMRPPCPIVMLTGNESEAAQSLLFRGIYPLLVE 409          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG7362 (gene:FBgn0038258 transcript:FBtr0331700)

HSP 1 Score: 261.536 bits (667), Expect = 9.607e-77
Identity = 134/268 (50.00%), Postives = 180/268 (67.16%), Query Frame = 3
Query:  696 VNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILG--EKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEI-VGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLL 1490
            +N  G   DL A++++D  DL FG +Q VDM+FASFIR   A+ EIR  LG     +HI IISKIE+ + +   DEI++ SDGIMVA G++G EI  E V LAQK ++ +CN++GKP+ICA QM+ SMITKPRPTRAESSDVANAILDG D ++LS ETAKG YP++ VQ M  IC + ES ++      +LK E+ + + D   + + A  EAA   +A AIVV +     + ++S+ RP CPI+ +T  P  A Q  L+RGV+PLL
Sbjct:  109 INPQGVAADLNAITEQDKLDLKFGADQKVDMIFASFIRDAKALKEIRQALGACPSSEHIKIISKIESQQALANIDEIIRESDGIMVALGNMGNEIALEAVPLAQKSIVAKCNKVGKPVICANQMMNSMITKPRPTRAESSDVANAILDGCDALVLSDETAKGKYPVQCVQCMARICAKVESVLWYESIQNNLKSEVRINAADHISAVSTAIAEAATVSQAQAIVVASPCSIVSQMVSQMRPPCPIVLLTGCPHEAAQSLLFRGVYPLL 376          

HSP 2 Score: 67.3958 bits (163), Expect = 2.646e-11
Identity = 37/102 (36.27%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  132 VHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF---TPYYRPVALALDTKGPEI 428
            + RG   S L++   L        +  +SIICTIGP+      L  +I +GM + R++FS G+H+ H + I+  R+A+  +   T   R +A+ALDTKGP I
Sbjct:    8 LDRGPYLSQLDYQSRLQFQAPALRLPLTSIICTIGPSSSQPEVLLNLIHAGMKVVRLDFSDGTHDCHCQAIQAARKAIAMYAEETGLPRSLAIALDTKGPVI 109          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 344/522 (65.90%), Postives = 417/522 (79.89%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP + R++ IICTIGPA R+V TLK+MI SGMNIARMNFSHGSHEYH ETIK VREA  +F P    YRPV +ALDTKGPEIRTGLI GSGT EV L KGNKIK+ +D+ + ++C+E+ LW+DYKNI K++  G ++Y+DDGLISL V++ G DYL CE+ENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDM+FASFIR  A V  +R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCN+ GKPIICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A F  + FE L+   V + D + + A+ AVEA+ +C AS I+++T TGRSA+LISRYRPR PIL VTR+  TARQ HL+RG+ P+ Y++   D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    8 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLRRSSVLTRDPSDAVAVGAVEASFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVV 529          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 344/522 (65.90%), Postives = 417/522 (79.89%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP + R++ IICTIGPA R+V TLK+MI SGMNIARMNFSHGSHEYH ETIK VREA  +F P    YRPV +ALDTKGPEIRTGLI GSGT EV L KGNKIK+ +D+ + ++C+E+ LW+DYKNI K++  G ++Y+DDGLISL V++ G DYL CE+ENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDM+FASFIR  A V  +R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCN+ GKPIICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A F  + FE L+   V + D + + A+ AVEA+ +C AS I+++T TGRSA+LISRYRPR PIL VTR+  TARQ HL+RG+ P+ Y++   D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    8 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLRRSSVLTRDPSDAVAVGAVEASFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVV 529          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 345/522 (66.09%), Postives = 418/522 (80.08%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP + R++ IICTIGPA R+V TLK+MI SGMNIARMNFSHGSHEYH ETIK VREA  +F P    YRPV +ALDTKGPEIRTGLI GSGT EV L KGNKIK+ +D+ + ++C+E+ LW+DYKNI K++  G ++Y+DDGLISL V++ G DYL CE+ENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDM+FASFIR  A V  +R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCN+ GKPIICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A+F  + FEDL+  +  STD   + AI AVEA+ +  +SA +V+T +GRSA+LISRYRPR PIL VTR+  TARQ HL+RG+ P+ Y++   D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    8 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLRRCLPLSTDPAEAIAIGAVEASFKILSSAFIVLTGSGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVV 529          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkmb (pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-040801-230])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/519 (66.28%), Postives = 417/519 (80.35%), Query Frame = 3
Query:  114 FIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF---TPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            FIQ Q +   ++ + LE +C LDID+EP V R++ I+CT+GPA R++ TL++MI SGMN+AR+NFSHG+HEYHAETIK VREA+E+F   T  YRPVA+ALDTKGPEIRTGLI GSGT EV LVKGN IKL +D+K+ D+C+E  LW+DYKNI K++ +G  IYVDDGLISL V E G D+L+CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQGVDMVFASFIR  A V  +R +LGEKGK I IISK+ENHEGV++FDEIL+ASDGIMVARGDLGIEIP EKVFLAQKMMI RCNR+GKPIICATQMLESMI KPRPTRAESSDVANA+LDGADC+MLSGETAKG YP+E+V   H I REAE+A+F  + FE+L+     + D T S A+ AVEA+ +C ASAI+ +T TGRSA L+SRYRPR PI+ VTR+  T+RQ HL+RGV P+LY     D W  D+D R+++A      R + K+GD +IVVTGW+ GSG TNTMR++++
Sbjct:   11 FIQTQQMPAAMAETFLEHLCLLDIDSEPTVSRNTGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVAIALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLDYKNITKVVQQGSHIYVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGEKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIPTEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPIESVLTQHLIAREAEAAMFHRQLFEELRRTSHLTRDPTESVAVGAVEASFKCCASAIICLTKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPILYTKPANDIWAEDVDLRVSFALEIGKHRKYFKSGDVIIVVTGWRPGSGYTNTMRIVVV 529          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkmb (pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-040801-230])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/519 (66.28%), Postives = 417/519 (80.35%), Query Frame = 3
Query:  114 FIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF---TPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            FIQ Q +   ++ + LE +C LDID+EP V R++ I+CT+GPA R++ TL++MI SGMN+AR+NFSHG+HEYHAETIK VREA+E+F   T  YRPVA+ALDTKGPEIRTGLI GSGT EV LVKGN IKL +D+K+ D+C+E  LW+DYKNI K++ +G  IYVDDGLISL V E G D+L+CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQGVDMVFASFIR  A V  +R +LGEKGK I IISK+ENHEGV++FDEIL+ASDGIMVARGDLGIEIP EKVFLAQKMMI RCNR+GKPIICATQMLESMI KPRPTRAESSDVANA+LDGADC+MLSGETAKG YP+E+V   H I REAE+A+F  + FE+L+     + D T S A+ AVEA+ +C ASAI+ +T TGRSA L+SRYRPR PI+ VTR+  T+RQ HL+RGV P+LY     D W  D+D R+++A      R + K+GD +IVVTGW+ GSG TNTMR++++
Sbjct:   11 FIQTQQMPAAMAETFLEHLCLLDIDSEPTVSRNTGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVAIALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLDYKNITKVVQQGSHIYVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGEKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIPTEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPIESVLTQHLIAREAEAAMFHRQLFEELRRTSHLTRDPTESVAVGAVEASFKCCASAIICLTKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPILYTKPANDIWAEDVDLRVSFALEIGKHRKYFKSGDVIIVVTGWRPGSGYTNTMRIVVV 529          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 346/526 (65.78%), Postives = 413/526 (78.52%), Query Frame = 3
Query:   87 PSSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            PS     + FIQ Q +H  ++ + LE +C LDID+EP V R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHG+HEYHA TIK VREA E+F+    +YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +++ +D+ + + C+E ILWVDYKN+ K++  G +IYVDDGLISL+V ETG D+   EVENGG LGSKKGVNLPGA VDLPAVS KDI DL FGVEQ VDMVFASFIR  A V  +R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I  EAE+A F  + FE+L      S D   + A+ AVEA+ +C ASA++V+T +GRSA+L+SRYRPR PI+ VTR+  TARQ HL+RG+ P+LY     + W  D+D R+N+A      RGF K+GD VIV+TGW+ GSG TNTMRV+
Sbjct:    2 PSPLTAGSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIALEAEAAAFHRQLFEELFRATASSKDPAEAMALGAVEASFKCLASALIVMTESGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVV 527          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 345/522 (66.09%), Postives = 412/522 (78.93%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E  + FIQ Q +H  ++ + LE +C LDID+EP V R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHG+HEYHA TIK VREA E+F+    +YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +++ +D+ + + C+E ILWVDYKN+ K++  G +IYVDDGLISL+V ETG D+   EVENGG LGSKKGVNLPGA VDLPAVS KDI DL FGVEQ VDMVFASFIR  A V  +R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I  EAE+A F  + FE+L      S D   + A+ AVEA+ +C ASA++V+T +GRSA+L+SRYRPR PI+ VTR+  TARQ HL+RG+ P+LY     + W  D+D R+N+A      RGF K+GD VIV+TGW+ GSG TNTMRV+
Sbjct:    8 EAGSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIALEAEAAAFHRQLFEELFRATASSKDPAEAMALGAVEASFKCLASALIVMTESGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVV 529          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 345/522 (66.09%), Postives = 412/522 (78.93%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E  + FIQ Q +H  ++ + LE +C LDID+EP V R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHG+HEYHA TIK VREA E+F+    +YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +++ +D+ + + C+E ILWVDYKN+ K++  G +IYVDDGLISL+V ETG D+   EVENGG LGSKKGVNLPGA VDLPAVS KDI DL FGVEQ VDMVFASFIR  A V  +R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I  EAE+A F  + FE+L      S D   + A+ AVEA+ +C ASA++V+T +GRSA+L+SRYRPR PI+ VTR+  TARQ HL+RG+ P+LY     + W  D+D R+N+A      RGF K+GD VIV+TGW+ GSG TNTMRV+
Sbjct:    3 EAGSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIALEAEAAAFHRQLFEELFRATASSKDPAEAMALGAVEASFKCLASALIVMTESGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVV 524          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 345/522 (66.09%), Postives = 416/522 (79.69%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E  + FIQ Q +H  ++ + LE +C LDID+EP V R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHG+HEYHA TIK VREA E+F+    +YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +++ +D+ + + C+E ILWVDYKN+ K++  G +IYVDDGLISL+V ETG D+   EVENGG LGSKKGVNLPGA VDLPAVS KDI DL FGVEQ VDMVFASFIR  A V  +R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  + FE+L+     + D T +TA+ AVE++ +C + AI+V+T +GRSA+L+SRYRPR PI+ VTR+  TARQ HL+RG+ P+LY     + W  D+D R+N+A      RGF K+GD VIV+TGW+ GSG TNTMRV+
Sbjct:    4 EAGSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELRRVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVV 525          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 345/522 (66.09%), Postives = 416/522 (79.69%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E  + FIQ Q +H  ++ + LE +C LDID+EP V R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHG+HEYHA TIK VREA E+F+    +YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +++ +D+ + + C+E ILWVDYKN+ K++  G +IYVDDGLISL+V ETG D+   EVENGG LGSKKGVNLPGA VDLPAVS KDI DL FGVEQ VDMVFASFIR  A V  +R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  + FE+L+     + D T +TA+ AVE++ +C + AI+V+T +GRSA+L+SRYRPR PI+ VTR+  TARQ HL+RG+ P+LY     + W  D+D R+N+A      RGF K+GD VIV+TGW+ GSG TNTMRV+
Sbjct:    6 EAGSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELRRVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVV 527          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 345/522 (66.09%), Postives = 409/522 (78.35%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V  LK+MI SGMN+AR+NFSHG+HEYHAETIK VREA E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V E G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  A V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F    FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L     L+ W  D+D R+N A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRLLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLNAWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 344/522 (65.90%), Postives = 411/522 (78.74%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V  LK+MI SGMN+AR+NFSHG+HEYHAETIK VREA E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V E G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  A V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A++  + FE+L+     ++D T + A+ AVEA+ +C + AI+V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L     L+ W  D+D R+N A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLNAWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pklr (pyruvate kinase liver and red blood cell [Source:MGI Symbol;Acc:MGI:97604])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 311/524 (59.35%), Postives = 395/524 (75.38%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF--TPY-YRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            E+   F Q Q +   ++ + LE +C LDID+EP   RS+SII TIGPA R+V  LK+MI +GMNIAR+NFSHGSHEYHAE+I  +REA E+F  +P  YRPVA+ALDTKGPEIRTG++ G    EV +VKG+++ + +D K+    + + +WVDY NI +++  G RIY+DDGLISL+V + G + L  EVE+GG LG++KGVNLP A+VDLP +S++D+ DL FGVE  VD++FASF+R  + V  +R  LG +G+ I IISKIENHEGVK+FDEIL+ SDGIMVARGDLGIEIPAEKVFLAQKMMIGRCN  GKP++CATQMLESMITK RPTRAE+SDVANA+LDGADC+MLSGETAKG++P+EAV++ H I REAE+AV+  + FE+L+     S D T  TAI AVEA+ +C A+AI+V+T TGRSA L+SRYRPR  ++ VTR    ARQ HL RGV PLLY       W  D+D R+ +       RGF++ GD VIVVTGW+ GSG TN MRV+ +
Sbjct:   19 ELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVDYHNITQVVAVGGRIYIDDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYREPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTI 542          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pklr (pyruvate kinase liver and red blood cell [Source:MGI Symbol;Acc:MGI:97604])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 311/524 (59.35%), Postives = 395/524 (75.38%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF--TPY-YRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            E+   F Q Q +   ++ + LE +C LDID+EP   RS+SII TIGPA R+V  LK+MI +GMNIAR+NFSHGSHEYHAE+I  +REA E+F  +P  YRPVA+ALDTKGPEIRTG++ G    EV +VKG+++ + +D K+    + + +WVDY NI +++  G RIY+DDGLISL+V + G + L  EVE+GG LG++KGVNLP A+VDLP +S++D+ DL FGVE  VD++FASF+R  + V  +R  LG +G+ I IISKIENHEGVK+FDEIL+ SDGIMVARGDLGIEIPAEKVFLAQKMMIGRCN  GKP++CATQMLESMITK RPTRAE+SDVANA+LDGADC+MLSGETAKG++P+EAV++ H I REAE+AV+  + FE+L+     S D T  TAI AVEA+ +C A+AI+V+T TGRSA L+SRYRPR  ++ VTR    ARQ HL RGV PLLY       W  D+D R+ +       RGF++ GD VIVVTGW+ GSG TN MRV+ +
Sbjct:   50 ELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVDYHNITQVVAVGGRIYIDDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYREPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTI 573          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 301.212 bits (770), Expect = 3.800e-98
Identity = 145/226 (64.16%), Postives = 172/226 (76.11%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFG 767
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V  LK+MI SGMN+AR+NFSHG+HEYHAETIK VREA E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V E G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FG
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFG 232          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P11980|KPYM_RAT (Pyruvate kinase PKM OS=Rattus norvegicus OX=10116 GN=Pkm PE=1 SV=3)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 347/522 (66.48%), Postives = 408/522 (78.16%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V  LK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V E G DYL  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  A V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+AVF    FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L     LD W  D+D R+N A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADYLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAVFHRLLFEELARASSQSTDPLEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLDAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P14618|KPYM_HUMAN (Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 342/522 (65.52%), Postives = 412/522 (78.93%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A++  + FE+L+     ++D T +TA+ AVEA+ +C + AI+V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|Q5NVN0|KPYM_PONAB (Pyruvate kinase PKM OS=Pongo abelii OX=9601 GN=PKM PE=2 SV=3)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 342/522 (65.52%), Postives = 409/522 (78.35%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            E    FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+AR+NFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G +IYVDDGLISL V + G D+L  EVENGG+LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  + V E+R +LGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAE S VANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  K FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+P TARQ HL+RG+ P+L      + W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    7 EAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLLTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSGVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P00548|KPYM_CHICK (Pyruvate kinase PKM OS=Gallus gallus OX=9031 GN=PKM PE=2 SV=2)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 340/517 (65.76%), Postives = 407/517 (78.72%), Query Frame = 3
Query:  114 FIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            FIQ Q +H  ++ + LE +C LDID+EP + R++ IICTIGPA R+V  LK+MI SGMN+AR+NFSHG+HEYH  TIK VREA E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  + ++C+E +LWVDYKN++K++  G +IYVDDGLISL+V E GKD++  EVENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  A V  +R +LGEKGKHI IISKIENHEGV+RFDEI++ASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNR GKPIICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  + FE++    V   +   + A  AVEA+ +C A+A++V+T +GRSA+L+SRYRPR PI+ VTR+  TARQ HL+RGV P+L      D W  D+D R+N        RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:   11 FIQTQQLHAAMADTFLEHMCRLDIDSEPTIARNTGIICTIGPASRSVDKLKEMIKSGMNVARLNFSHGTHEYHEGTIKNVREATESFASDPITYRPVAIALDTKGPEIRTGLIKGSGTAEVELKKGAALKVTLDNAFMENCDENVLWVDYKNLIKVIDVGSKIYVDDGLISLLVKEKGKDFVMTEVENGGMLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKHIKIISKIENHEGVRRFDEIMEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAMFHRQQFEEILRHSVHHREPADAMAAGAVEASFKCLAAALIVMTESGRSAHLVSRYRPRAPIIAVTRNDQTARQAHLYRGVFPVLCKQPAHDAWAEDVDLRVNLGMNVGKARGFFKTGDLVIVLTGWRPGSGYTNTMRVV 527          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P11974|KPYM_RABIT (Pyruvate kinase PKM OS=Oryctolagus cuniculus OX=9986 GN=PKM PE=1 SV=4)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 343/525 (65.33%), Postives = 409/525 (77.90%), Query Frame = 3
Query:   90 SSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            S  E  + FIQ Q +H  ++ + LE +C LDID+ P   R++ IICTIGPA R+V TLK+MI SGMN+ARMNFSHG+HEYHAETIK VR A E+F      YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  +K+ +D  Y + C+E ILW+DYKNI K++  G ++YVDDGLISL V + G D+L  EVENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQ VDMVFASFIR  A V E+R ILGEKGK+I IISKIENHEGV+RFDEIL+ASDGIMVARGDLGIEIPAEKVFLAQKM+IGRCNR GKP+ICATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A+F  K FE+L      STD   + A+ +VEA+ +C A+A++V+T +GRSA+ ++RYRPR PI+ VTR+  TARQ HL+RG+ P++      + W  D+D R+N A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:    4 SHSEAGSAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVV 528          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A267EYV5 (Pyruvate kinase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019710g1 PE=3 SV=1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 361/544 (66.36%), Postives = 441/544 (81.07%), Query Frame = 3
Query:  105 NNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIM-PILSIPSIAKFED 1733
            N YFIQ Q +    +RSHLE +C+LD+D+EP  VR++ IICTIGPAC++V+ L KMIA+GMNIARMNFSHG+HEYH +T++LVR+A ETF P+ RPV +ALDTKGPEIRTGLI GSGT EV LV+G  I + ID  +A++C+++ LWVDY NIVK++++G R+++DDGLISL+V E     L CEVENGG LGSKKGVNLPG+ VDLPAVS+KD  DL F V+ G+DMVFASFIR   A+ EIR ILGE GK+I II+KIENHEGV+RFDEI++A+DGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKP+ICATQMLESMI+KPRPTRAE SDVANA+LDGADCVMLSGETAKG +PLEAV+ MH +CREAESA++  + FEDLK E++  TD TH+TAIAA EAA RCRA+AI+V+TTTGRSA L++R+RPRCPILTV+R   T RQ HLWRG+HPL +D  R D+WT DMD RI +A  Y  +RGF+  GD+V++VTGWKAG+G TNT+RVI + +D      +  P    P+IA   D
Sbjct:   21 NQYFIQKQQLQASNARSHLEHLCHLDVDSEPAYVRNTGIICTIGPACKSVAILHKMIANGMNIARMNFSHGTHEYHRQTVELVRQAAETFKPWSRPVGIALDTKGPEIRTGLIGGSGTAEVELVRGEPITVTIDSAFAENCSKDTLWVDYPNIVKVINEGGRVFIDDGLISLLVKEIRDKSLLCEVENGGKLGSKKGVNLPGSPVDLPAVSEKDREDLKFAVDLGLDMVFASFIRNADAIREIRHILGEAGKNIKIIAKIENHEGVRRFDEIMEAADGIMVARGDLGIEIPPEKVFLAQKMMIGRCNRAGKPVICATQMLESMISKPRPTRAEISDVANAVLDGADCVMLSGETAKGDFPLEAVRTMHQVCREAESAMYTSQLFEDLKAELLEPTDITHTTAIAASEAANRCRAAAIIVITTTGRSAQLVARHRPRCPILTVSRLAQTCRQAHLWRGLHPLFFDETRSDQWTEDMDKRIEFAIAYGRQRGFINRGDFVVMVTGWKAGTGFTNTLRVIQVTEDGEGSGSVAGPDQGGPNIAAIFD 564          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A267F274 (Pyruvate kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009984g1 PE=3 SV=1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 362/543 (66.67%), Postives = 443/543 (81.58%), Query Frame = 3
Query:  105 NNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            N YFIQ Q +    +RSHLE +C LDID +P  VR++ IICTIGPAC++V+ L KMIA+GMNIARMNFSHG+HEYH ET++LVR+A +TF  + RPVA+ALDTKGPEIRTGLI GSGT EV L +G++I +  D  ++++C+ ++LWVDY NIVK++ +G R++VDDGLISL+V E   + L CEVENGGNLGSKKGVNLPGA VDLPAVS+KD SDL F VE G+D+VFASFIR   A+ EI+ ILGE+GK+I II+KIENHEGV+RFDEI++A+DGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKP+ICATQMLESMITKPRPTRAE SDVANA+LDGADCVMLSGETAKG+YPLEAV+ MH +CREAESA+F  + FEDLK E++  TD TH+TAIAA EAA RCRA+AI+V+TTTGRSA LISR+RPRCPILTV+R   T RQ HL+RG+HPL YDA R ++WT DMD RI++A  Y  +R F+  GD+V++VTGWKAG+G TNT+R++ + + A         +  P+I  F D
Sbjct:   13 NPYFIQKQQLQASNARSHLEHLCRLDIDLDPAYVRNTGIICTIGPACKSVAVLHKMIAAGMNIARMNFSHGTHEYHKETVELVRQAADTFKGWSRPVAIALDTKGPEIRTGLIGGSGTAEVELKRGSEIVVTTDPAHSENCSADMLWVDYPNIVKVVREGGRVFVDDGLISLLVKEVRDNSLLCEVENGGNLGSKKGVNLPGAPVDLPAVSEKDKSDLRFAVEMGLDIVFASFIRNAEAIREIKHILGEEGKNIKIIAKIENHEGVRRFDEIMEAADGIMVARGDLGIEIPPEKVFLAQKMMIGRCNRAGKPVICATQMLESMITKPRPTRAEISDVANAVLDGADCVMLSGETAKGSYPLEAVKTMHQVCREAESAMFSSQLFEDLKAELLEPTDITHTTAIAASEAANRCRAAAIIVITTTGRSASLISRHRPRCPILTVSRLAQTCRQAHLFRGLHPLFYDAPRCEQWTEDMDKRIDFAIDYGRKREFINVGDFVVIVTGWKAGAGFTNTLRIVQVTEQAASS-----YIGAPNIVSFFD 550          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A3Q0KH21 (Pyruvate kinase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 360/528 (68.18%), Postives = 426/528 (80.68%), Query Frame = 3
Query:  150 RSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            RS LE + +LDID++P  VR++ IICTIGPACRTV  L+ MI SGMNIAR+NFSHGSHEYHAETIKL+REA  T  P+ RP+ +ALDTKGPEIRTGLI+GSGT EV+L  G+KI++  D  Y + CNE IL+VDY+NIV +L KG +I+VDDGL+SL+V++ G DYL+CEVENGG LGS+KGVNLPGA VDLPAVS+KD  DL F VE  VDMVFASFIR   AV +IR +LG+ G +I II+KIENHEGV+RF+EIL   DGIMVARGDLGIEIPAEKVF+AQKMMIGRCN++GKP+ICATQMLESM TKPRPTRAESSDVANA+LDGADCVMLSGETAKG YPLE VQ MH IC +AE+A+F G+ FEDLK  + G T+  H+TAIAAVEAA RC A+AI+V+TT+GRS  LISR+RPRCPILTVTRH V ARQ HL+RGVHP+ Y   R  EW  DMD RI +A  Y  +R F   G +VI+VTGWKAGSGSTNT+RV+ LED   +     PI+ +PSI  F+D
Sbjct:   39 RSLLEHVVSLDIDHQPAYVRNTGIICTIGPACRTVEMLQNMITSGMNIARLNFSHGSHEYHAETIKLIREAASTLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVSLEVGHKIRVTTDSAYMEKCNESILYVDYRNIVHVLSKGSKIFVDDGLLSLVVLDKGPDYLECEVENGGKLGSRKGVNLPGAHVDLPAVSEKDKQDLRFAVEHNVDMVFASFIRNADAVHQIRQLLGDNGAYIKIIAKIENHEGVQRFNEILDVVDGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLETVQTMHRICIQAEAAMFHGQLFEDLKSSLYGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEVIARQIHLYRGVHPIYYGESRAGEWYEDMDRRIRYALDYGKKRSFFSPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETK-----PIVMVPSITHFDD 561          
BLAST of Pyruvate kinase vs. TrEMBL
Match: Q5DAM7 (Pyruvate kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_008759 PE=2 SV=1)

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 360/528 (68.18%), Postives = 425/528 (80.49%), Query Frame = 3
Query:  150 RSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            RS LE + +LDID++P  VR++ IICTIGPACRTV  L+ M+ +GMNIAR+NFSHGSHEYHAETIKLVREA  T  P+ RP+ +ALDTKGPEIRTGLI+GSGT EV+L  G+KI++  D  Y ++CNE  L+VDY NIV +L  G +I+VDDGLISL+V+  G +YL+CEVENGG LGS+KGVNLPGA VDLPAVS+KD  DL F VE  VDMVFASFIR   AV EIR +LGE G +I II+KIENHEGV+RF+EIL+  DGIMVARGDLGIEIPAEKVF+AQKMMIGRCN++GKP+ICATQMLESM TKPRPTRAESSDVANA+LDGADCVMLSGETAKG YPLE VQ MH IC +AE+A+F G+ FEDLK  + G T+  H+TAIAAVEAA RC A+AI+V+TT+GRS  LISR+RPRCPILTVTRH V ARQ HL+RGVHPL Y   R  EW  DMD RI +A  Y  +R F+  G +VI+VTGWKAGSGSTNT+RV+ LED   +     PI+ +PSI  F+D
Sbjct:   39 RSLLEHVVSLDIDHQPTFVRNTGIICTIGPACRTVEMLQNMMTAGMNIARLNFSHGSHEYHAETIKLVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVSLEVGHKIRVTTDSAYMEACNESTLYVDYPNIVHVLSNGSKIFVDDGLISLVVLSKGPNYLECEVENGGKLGSRKGVNLPGAHVDLPAVSEKDKQDLRFAVEHNVDMVFASFIRNAGAVHEIRQLLGENGAYIKIIAKIENHEGVQRFNEILEVVDGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLETVQTMHRICVQAEAAMFHGQLFEDLKSSLCGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEVIARQIHLYRGVHPLFYGESRAGEWYEDMDRRIRYAIDYGKKRSFLTPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETK-----PIVMVPSITHFDD 561          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A095B084 (Pyruvate kinase OS=Schistosoma haematobium OX=6185 GN=MS3_08937 PE=3 SV=1)

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 361/528 (68.37%), Postives = 428/528 (81.06%), Query Frame = 3
Query:  150 RSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            RS LE + +LDID++P  VR++ IICTIGPACRTV  L+ M+ SGMNIAR+NFSHGSHEYHA+TI+LVREA  T  P+ RP+ +ALDTKGPEIRTGLI+GSGT EVTL  G+KI++  D  Y ++CNE IL++DY+NIV +L KG +I+VDDGLISL+V++ G DYL+CEVENGG LGS+KGVNLPGA VDL AVS+KD  DL F VE  VDMVFASFIR   AV +IR +LG+ G HI II+KIENHEGV+RF+EIL A+DGIMVARGDLGIEIPAEKVF+AQKMMIGRCN++GKP+ICATQMLESM TKPRPTRAESSDVANA+LDGADCVMLSGETAKG YPLEAVQ MH IC +AE+A+F G+ FEDLK  + G T+  H+TAIAAVEAA RC A+AI+V+TT+GRS  LISR+RPRCPILTVTRH   ARQ HL+RGVHPL Y   R  EW  DMD RI +A  Y  +R F   G +VI+VTGWKAGSGSTNT+RV+ LED   +     PI+ +PSI  F+D
Sbjct:   42 RSLLEHVVSLDIDHQPAYVRNTGIICTIGPACRTVEILQNMMTSGMNIARLNFSHGSHEYHAKTIELVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVTLQVGHKIRVTTDCAYMEACNESILYMDYRNIVHVLSKGSKIFVDDGLISLVVLDKGPDYLECEVENGGKLGSRKGVNLPGAHVDLDAVSEKDKQDLRFAVEHNVDMVFASFIRNADAVHQIRQLLGDNGSHIKIIAKIENHEGVQRFNEILDAADGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLEAVQTMHRICVQAEAAMFHGQLFEDLKSSLYGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEYIARQIHLYRGVHPLYYGEPRAGEWYEDMDRRIRYAIDYGRKRSFFSPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETK-----PIVMVPSITHFDD 564          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkmb (pyruvate kinase PKM-like [Source:NCBI gene;Acc:103047790])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 347/526 (65.97%), Postives = 420/526 (79.85%), Query Frame = 3
Query:   93 SFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            S ++ +  I  Q +H  ++ + LE +C LDID+EP V R++ IICTIGPA R+V  L++MI +GMNIAR+NFSHG+HEYHAETIK VREA E+F P    YRPVA+ALDTKGPEIRTGLI GSGT EVTL KG+KIKL +D+KY D+C+E+ LW+DYKNI K++ +G  IYVDDGLISL V+E G DYL CE+ENGG LGSKKGVNLPGA +DLPAVS+KD  DL FGVEQGVDMVFASFIR  A V  +R +LGEKGK I +ISK+ENHEGV+RFDEIL+ASDGIMVARGD+GIEIP EKVFLAQKMMI R NR+GKPI CATQMLESMI KPRPTRAESSDVANA+LDGADC+MLSGETAKG YP+E+V+  H I REAE+A+F  + FE+L+     + D   S AI AVEA+ +C AS I+V+T +GRSA+L+S+YRPR PIL VTR+  TARQ HL+RG++P+LY+    D W  D+D R+N+A      R F K+GD VIVVTGW+ GSG TNTMRV+L+
Sbjct:    4 SKDMGSSIIHTQQLHAAMADTLLEHMCLLDIDSEPAVYRNTGIICTIGPASRSVEKLREMIKAGMNIARLNFSHGTHEYHAETIKNVREATESFGPGTLEYRPVAIALDTKGPEIRTGLIKGSGTEEVTLNKGDKIKLTLDDKYKDNCDEKTLWLDYKNITKVVQQGSHIYVDDGLISLKVIEVGGDYLTCEIENGGMLGSKKGVNLPGANIDLPAVSEKDTQDLQFGVEQGVDMVFASFIRKAADVQAVRKVLGEKGKEIRVISKLENHEGVRRFDEILEASDGIMVARGDMGIEIPTEKVFLAQKMMISRSNRIGKPITCATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPVESVRTQHQIAREAEAAMFHRQVFEELRRITHLTRDPCESVAIGAVEASFKCCASGIIVLTKSGRSAHLLSKYRPRAPILAVTRNEQTARQSHLYRGIYPILYNKPANDVWAEDVDLRVNFALEMGKFRKFFKSGDVVIVVTGWRPGSGYTNTMRVVLV 529          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 341/522 (65.33%), Postives = 416/522 (79.69%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHGSHEYH ETIK +REA E+F P   +YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+E++LW+DYKNI K++  G ++Y+DDGLISL V E G DY+ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDMVFASFIR    V+E+R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A+F  + FE+L+     + D + + AI AVE++ +C ASAI+V+T +GRSA+LISRYRPR PI+ VTR+  TARQ HL+RG+ P+ Y+    D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:   31 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVV 552          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 341/522 (65.33%), Postives = 416/522 (79.69%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHGSHEYH ETIK +REA E+F P   +YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+E++LW+DYKNI K++  G ++Y+DDGLISL V E G DY+ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDMVFASFIR    V+E+R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A+F  + FE+L+     + D + + AI AVE++ +C ASAI+V+T +GRSA+LISRYRPR PI+ VTR+  TARQ HL+RG+ P+ Y+    D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:   33 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVV 554          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 341/522 (65.33%), Postives = 416/522 (79.69%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHGSHEYH ETIK +REA E+F P   +YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+E++LW+DYKNI K++  G ++Y+DDGLISL V E G DY+ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDMVFASFIR    V+E+R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A+F  + FE+L+     + D + + AI AVE++ +C ASAI+V+T +GRSA+LISRYRPR PI+ VTR+  TARQ HL+RG+ P+ Y+    D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:   61 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVV 582          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 341/522 (65.33%), Postives = 416/522 (79.69%), Query Frame = 3
Query:   99 EINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            ++ + FIQ Q ++  ++ + LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIAR+NFSHGSHEYH ETIK +REA E+F P   +YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+E++LW+DYKNI K++  G ++Y+DDGLISL V E G DY+ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVE GVDMVFASFIR    V+E+R +LGEKGK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A+F  + FE+L+     + D + + AI AVE++ +C ASAI+V+T +GRSA+LISRYRPR PI+ VTR+  TARQ HL+RG+ P+ Y+    D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRV+
Sbjct:  106 DMGSAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVV 627          
BLAST of Pyruvate kinase vs. Ensembl Sea Lamprey
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 341/534 (63.86%), Postives = 416/534 (77.90%), Query Frame = 3
Query:   90 SSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHG-------SGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGK--DYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            +S +  + F+Q Q +    + + LE +C LDID+EP   R++ IICTIGPA R++ TLK+MI SGMNIARMNFSHGSHEYH++TIK VREA E+F     YYRPV +ALDTKGPEIRTGLI G       SGT EV L KG ++K+ +D+ Y D+C++ ++W+DYKNI K++  G +I+VDDGLISL+V E GK  DY+  EVENGG LGS+KGVNLPGA VDLPAVS KD+ DL FGV+QGVDMVFASFIR  A V+E+RA+LGEKGK+I IISKIENHEGV+RF+EIL+ASDGIMVARGDLGIEIP EKVF+AQKMMIGRCNR GKP+ICATQMLESMI KPRPTRAESSDVANA+LDGADC+MLSGETAKG YPLEAV++ H I REAE+A++  + FE+L+     ++D T +TAI  VEA+ +C A AI+V+T +GRSA+L+S+YRPR PI+ VTR   TARQ HL+RG+ P+L      D W  D+D R+N A      RGF K  D VIVVTGW+ GSG TN MRVI
Sbjct:    4 ASHDPGSAFVQTQQLSASRADTFLEHMCLLDIDSEPITARNTGIICTIGPASRSLDTLKEMIKSGMNIARMNFSHGSHEYHSDTIKNVREATESFAGNPIYYRPVGVALDTKGPEIRTGLIKGAVVVAAQSGTAEVELKKGAELKVTLDDAYQDACDDTMVWLDYKNITKVVTPGSKIFVDDGLISLLVKEIGKGDDYVITEVENGGMLGSRKGVNLPGAAVDLPAVSAKDVQDLQFGVDQGVDMVFASFIRKAADVEEVRAVLGEKGKNIKIISKIENHEGVRRFEEILEASDGIMVARGDLGIEIPGEKVFIAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAMYHRQLFEELRRLSGITSDPTETTAIGTVEASFKCSAGAIIVLTKSGRSAHLLSKYRPRAPIIAVTRCGQTARQAHLYRGIFPVLCREPVNDVWAEDVDLRVNLAMEVGKCRGFFKQDDVVIVVTGWRPGSGYTNMMRVI 537          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: CDC19 (Pyruvate kinase; functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration; regulated via allosteric activation by fructose bisphosphate; CDC19 has a paralog, PYK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000036])

HSP 1 Score: 473.396 bits (1217), Expect = 2.461e-162
Identity = 248/501 (49.50%), Postives = 332/501 (66.27%), Query Frame = 3
Query:  153 SHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKD-YLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRV 1652
            S LE + +L++    D+ R +SII TIGP      TL  +  +G+NI RMNFSHGS+EYH   I   R++ E +    RP+A+ALDTKGPEIRTG    +   +  +   +++    D+KYA +C+++I++VDYKNI K++  G  IYVDDG++S  V+E   D  L  +  N G + S KGVNLPG  VDLPA+S+KD  DL FGV+ GV MVFASFIR    V  IR +LGE+GK + II KIEN +GV  FDEIL+ +DG+MVARGDLGIEIPA +V   QK +I + N  GKP+ICATQMLESM   PRPTRAE SDV NAILDGADCVMLSGETAKG YP+ AV  M      AE A+     ++D++      T  T + A +AV A    +A AI+V++T+G +  L+S+YRP CPI+ VTR P  AR  HL+RGV P +++ + + +WT D++ RIN+    A   G +K GD  + + G+KAG+G +NT++V
Sbjct:    2 SRLERLTSLNVVAGSDL-RRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEELYPG--RPLAIALDTKGPEIRTGTT--TNDVDYPIPPNHEMIFTTDDKYAKACDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVNLPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVKIENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQMLESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMRNCTPKPTSTTETVAASAVAAVFEQKAKAIIVLSTSGTTPRLVSKYRPNCPIILVTRCPRAARFSHLYRGVFPFVFEKEPVSDWTDDVEARINFGIEKAKEFGILKKGDTYVSIQGFKAGAGHSNTLQV 497          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: PYK2 (Pyruvate kinase; appears to be modulated by phosphorylation; transcription repressed by glucose, and Pyk2p may be active under low glycolytic flux; PYK2 has a paralog, CDC19, that arose from the whole genome duplication [Source:SGD;Acc:S000005874])

HSP 1 Score: 453.366 bits (1165), Expect = 2.455e-154
Identity = 241/504 (47.82%), Postives = 326/504 (64.68%), Query Frame = 3
Query:  153 SHLEFICNLDIDNEPDVVRSSSIICTIGP---ACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVET-GKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRV 1652
            S L+ + NL I   P  +R +SII TIGP   +C  ++ L+K   +G+NI R+NFSHGS+E+H   I+   ++ + F    RP+A+ALDTKGPEIRTG        ++ +   +++    D  +A++ N++I+++DY N+ K++  G  IYVDDG++S  V++   +  L  +  N G + S KGVNLP   VDLP +S KD+ DL FGV  G+ +VFASFIR    V  IR  LG +G+ I IISKIEN +G+  FDEIL+ +DG+M+ARGDLGIEI A +V   QK +I +CN  GKP+ICATQML+SM   PRPTRAE SDV NA+LDGADCVMLSGETAKG YP+ AV IM      AES +     ++DL+      T  T + A AA  A       AIVV++TTG +A L+S+YRP CPI+ VTRH  TAR  HL+RGV P LY+ KRLD+W  D+  R+ +    A   G V NGD V+ + G+K G G +NT+R+
Sbjct:    4 SRLQRLANLKI-GTPQQLRRTSIIGTIGPKTNSCEAITALRK---AGLNIIRLNFSHGSYEFHQSVIENAVKSEQQFPG--RPLAIALDTKGPEIRTG--RTLNDQDLYIPVDHQMIFTTDASFANTSNDKIMYIDYANLTKVIVPGRFIYVDDGILSFKVLQIIDESNLRVQAVNSGYIASHKGVNLPNTDVDLPPLSAKDMKDLQFGVRNGIHIVFASFIRTSEDVLSIRKALGSEGQDIKIISKIENQQGLDNFDEILEVTDGVMIARGDLGIEILAPEVLAIQKKLIAKCNLAGKPVICATQMLDSMTHNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVNAVNIMAATALIAESTIAHLALYDDLRDATPKPTSTTETVAAAATAAILEQDGKAIVVLSTTGNTARLLSKYRPSCPIILVTRHARTARIAHLYRGVFPFLYEPKRLDDWGEDVHRRLKFGVEMARSFGMVDNGDTVVSIQGFKGGVGHSNTLRI 499          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: YAL037C-B_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching [Source:SGD;Acc:S000028592])

HSP 1 Score: 64.3142 bits (155), Expect = 1.357e-11
Identity = 40/141 (28.37%), Postives = 79/141 (56.03%), Query Frame = -1
Query:  762 WISTFCRFA*KHYTXXXXXXXXXXITGFSSCWSRFSNHRF*HLSRTDNWFTKTITSPNHHFLCKEDFFCGNFYXXXXXXXXXXXXSL*YFIESFHAFVIFNFRYNQNMFSFFAKNGANFINCCSTSNK*CKYHINPLFNSK 1184
            W+ T   F  +H T+S+I +S++ I  FSS WS   +H F HL  TDNW T  +   N   L  +DF+  +F + ++S +HN++  L  F+E  +  ++FN   + ++ + F ++ ++  N    S++  + H++ + +++
Sbjct:  165 WVVTLGGFTRQHNTVSTIQDSVTDIGNFSSGWSWVVSHGFQHLGSTDNWLTSQVRLSNQFLLDSQDFWGWDFNTQVTSGNHNTVSDLQDFVEVVNTLLVFNLDNDLDVLTLFTQDFSDGQNIVGGSDERSEDHVDTVLDTE 305          
BLAST of Pyruvate kinase vs. Ensembl Nematostella
Match: EDO49963 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:A7RER9])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 287/508 (56.50%), Postives = 371/508 (73.03%), Query Frame = 3
Query:  147 SRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDD 1670
            +RS+LEF   LDID  P  +R+S ++CTIGPA R+V  + ++I +GMNIAR+NFSHG+HEYH ETI  +R A     P+   V +ALDTKGPEIRTGL+     GE+ L KG K+K+  D+   D  + E ++VDY+NIVK++  G  +YVDDGLISL V+E G ++L  EV N   LGSKKGVNLP   VDLPAVS++D  D+ F VE  VDM+FASFIR    + EIR +L +  K+I I++KIENHEGV+RF+EIL+ +DGIMVARGDLGIEIPAEKVFLAQKMMI RCN  G P+ICATQMLESM+  PRPTRAE+SDVANAILDGADCVMLSGETAKG YP++AV +MH I REAE+A+F  + F++L+  + G  D   STAIAAV A+    A AI+ +T TGR+A +++R+RPRCPI+ VTR P  ARQ HLWRG  P++YD + LD    + D R+++A G   + GF+  G   + V+GWK+G+  TNT+R++ L  +
Sbjct:   26 ARSNLEFRSELDIDKHPLTIRNSGVVCTIGPASRSVEIVAQLIENGMNIARLNFSHGTHEYHRETIMNIRRAALLEWPH--AVGIALDTKGPEIRTGLLKA---GEIKLEKGQKLKVSTDKAMYDQGHTECIFVDYENIVKVVQIGGTVYVDDGLISLKVLEKGDNFLITEVLNDALLGSKKGVNLPNCAVDLPAVSEQDKKDIAFAVEMEVDMIFASFIRKPEDIAEIRKLLEKHAKNIKIVAKIENHEGVRRFNEILEVADGIMVARGDLGIEIPAEKVFLAQKMMIARCNMKGVPVICATQMLESMVQNPRPTRAETSDVANAILDGADCVMLSGETAKGLYPVQAVAMMHRISREAEAAIFHKQSFDELRHNLEGYADTHISTAIAAVAASFTAGADAIICLTHTGRTAAVVARFRPRCPIVVVTRDPRVARQMHLWRGCFPIVYDQEPLDNVLEEHDQRLDFALGMGKKMGFLTIGSTFVFVSGWKSGAAHTNTLRILTLTQE 528          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 353/526 (67.11%), Postives = 417/526 (79.28%), Query Frame = 3
Query:   93 SFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            S ++ + FIQ Q ++  ++ S LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIARMNFSHGSHEYHAETIK VREA E+F P    YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+EE LW+DYKNI K++  G +IY+DDGLISL VVE G D++ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQGVDMVFASFIR  A V  +R +LGE+GK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A+F  + FEDL+      +D   + AI AVEA+ +  ASAI+V+T +GRSA+LISRYRPR PIL VTR+  TARQ HL+RG+ P+LY     D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRVIL+
Sbjct:    6 SSDMGSAFIQTQQLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLDYKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLRRSTPHCSDPAEAIAIGAVEASFKSLASAIIVLTGSGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLYTKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILV 531          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 351/526 (66.73%), Postives = 417/526 (79.28%), Query Frame = 3
Query:   93 SFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            S ++ + FIQ Q ++  ++ S LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIARMNFSHGSHEYHAETIK VREA E+F P    YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+EE LW+DYKNI K++  G +IY+DDGLISL VVE G D++ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQGVDMVFASFIR  A V  +R +LGE+GK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A F  + FE+L+     + D + + A+ AVE++ +C ASAI+ +T TGRSA+LISRYRPR PIL VTR+  TARQ HL+RG+ P+LY     D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRVIL+
Sbjct:   24 SSDMGSAFIQTQQLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLDYKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEELRRHTQLTRDPSEAVAVGAVESSFKCCASAIITLTKTGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLYTKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILV 549          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 351/526 (66.73%), Postives = 417/526 (79.28%), Query Frame = 3
Query:   93 SFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
            S ++ + FIQ Q ++  ++ S LE +C LDID+EP   R++ IICTIGPA R+V  LK+MI SGMNIARMNFSHGSHEYHAETIK VREA E+F P    YRP+ +ALDTKGPEIRTGLI GSGT EV L KGN IK+ +D+ Y ++C+EE LW+DYKNI K++  G +IY+DDGLISL VVE G D++ CE+ENGG LGSKKGVNLPGA VDLPAVS+KDI DL FGVEQGVDMVFASFIR  A V  +R +LGE+GK+I IISK+ENHEGV+RFDEI++ASDGIMVARGDLGIEIP EKVFLAQKMMIGRCNR GKPI CATQMLESMI KPRPTRAE SDVANA+LDGADC+MLSGETAKG YPLEAV+  H I REAE+A F  + FE+L+     + D + + A+ AVE++ +C ASAI+ +T TGRSA+LISRYRPR PIL VTR+  TARQ HL+RG+ P+LY     D W  D+D R+N+A      RGF K GD VIV+TGW+ GSG TNTMRVIL+
Sbjct:    6 SSDMGSAFIQTQQLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLDYKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEELRRHTQLTRDPSEAVAVGAVESSFKCCASAIITLTKTGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLYTKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILV 531          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkmb (pyruvate kinase PKM [Source:NCBI gene;Acc:101170426])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 347/519 (66.86%), Postives = 411/519 (79.19%), Query Frame = 3
Query:  114 FIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILL 1661
             +Q Q +H  ++ +++E +C LDID+EP V R++ I+CTIGPA R+V   K+MI +GMNIARMNFSHG+HEYHAETIK VREA E+F P    YRPVA+ALDTKGPEIRTGLI GSGT EV L KG  IKL +D+KY D+C+E  LWVDYKNI K+L  G  +Y+DDGLISL V E G DYL CE+ENGG LGSKKGVNLPGA VDLPA+S+KDI DL FG+EQGVDMVFASFIR  A V  +R +LGEKGK + IISK+ENHEGV+RFDEIL+ASDGIMVARGDLGIEIP EKVF+AQKMM G+CNR+GKPIICATQMLESM  KPRPTRAE+SDVANA+LDG DC+MLSGETAKG YPLEAV   H I REAE+A+F  + FE+L+     + D T S AI AVEA+ +C ASAI+V+T +GRSAY++SRYRPR PIL VTR   TARQ HL+RGV+P+LY     D W  D+D R+N+A  Y   R F K+GD  IVVTGW+ GSG TNTMRV+L+
Sbjct:   11 IMQTQQLHAAMADTYIEHMCLLDIDSEPAVSRNTGIVCTIGPASRSVDMAKEMIKAGMNIARMNFSHGTHEYHAETIKNVREATESFGPGTVEYRPVAIALDTKGPEIRTGLIKGSGTAEVELKKGQNIKLTLDDKYKDNCDENYLWVDYKNITKVLQVGNNVYIDDGLISLKVKEVGNDYLMCEIENGGLLGSKKGVNLPGAAVDLPALSEKDIQDLQFGLEQGVDMVFASFIRKAADVQAVRKVLGEKGKDVKIISKLENHEGVRRFDEILEASDGIMVARGDLGIEIPTEKVFIAQKMMTGKCNRIGKPIICATQMLESMTKKPRPTRAEASDVANAVLDGNDCIMLSGETAKGDYPLEAVLTQHRIAREAEAAMFHRQMFEELRRTSHLTRDPTESVAIGAVEASFKCCASAIIVLTKSGRSAYMLSRYRPRAPILAVTRCGQTARQAHLYRGVYPVLYTKNANDVWAEDVDMRVNFAMEYGKYRKFFKSGDVAIVVTGWRPGSGYTNTMRVVLV 529          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pklr (pyruvate kinase PKM [Source:NCBI gene;Acc:101161188])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 309/531 (58.19%), Postives = 393/531 (74.01%), Query Frame = 3
Query:   75 MKKNPSSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTP---YYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAK-VDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVI 1655
            +++      + + FIQ Q +   ++ + LE +C LDID EP   R++SIICTIGPA R++  L++M+ +GMNIAR+NFSHG HEYH+ETIK +REAVET T    YYRPVA+ALDTKGPEIRTGL+ G    EV LVKG+ +++V  E   D  +  ++WVDY ++ K+L KG RIY+DDGL++L V+E G D++D  VE GG L S+KGVNLPG   + L AVS++D +DL FGV  GVDMVFASFIR    V ++R  LGE G HI +ISK+E+ +GV+ F+EIL  SDG+MVARGDLGIEIPAEKVF+AQKMMIGRCN  GKP+ICATQMLESM++ PRPTRAESSDVANA+LDGADCVMLS ETAKG +PLEAV +MH ICREAE+A+F  + FE+L+     S+D T  TAI AVE++ +C A AI+V+T++GRS++L+SRYRPRCPI+ VTR P  ARQ  L RGV P L+       W  D+D+R+ +       RGF K+GD VIVVTGW  GSG TN MR +
Sbjct:   10 LRRYSDLMTMPDSFIQRQQLDASMADTFLEHLCLLDIDQEPITARNTSIICTIGPASRSIQKLQEMVKAGMNIARLNFSHGCHEYHSETIKNIREAVETITSDPLYYRPVAIALDTKGPEIRTGLVKGKVDEEVQLVKGSHVRVVTAESERDKTDATMVWVDYPHLPKVLEKGRRIYIDDGLLALKVLEIGSDWVDTVVEAGGLLCSRKGVNLPGCDLIGLQAVSEQDEADLRFGVAHGVDMVFASFIRSAQDVKDVRRALGELGSHIKVISKVESRQGVQNFEEILAESDGVMVARGDLGIEIPAEKVFIAQKMMIGRCNSAGKPVICATQMLESMVSHPRPTRAESSDVANAVLDGADCVMLSAETAKGKFPLEAVAMMHSICREAEAAIFHHQLFEELRRLTPLSSDPTEVTAIGAVESSFKCCAGAIIVLTSSGRSSHLLSRYRPRCPIIAVTRSPQVARQSQLLRGVFPALFHPLPAPVWADDVDSRVKFGMDIGKARGFFKSGDMVIVVTGWIPGSGHTNIMRAV 540          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000052083.1 (SMESG000052083.1)

HSP 1 Score: 1145.18 bits (2961), Expect = 0.000e+0
Identity = 553/553 (100.00%), Postives = 553/553 (100.00%), Query Frame = 3
Query:   75 MKKNPSSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            MKKNPSSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED
Sbjct:    1 MKKNPSSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 553          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000017675.1 (SMESG000017675.1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 382/554 (68.95%), Postives = 460/554 (83.03%), Query Frame = 3
Query:   75 MKKNPSS-FEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            MK N S  FE  NYFIQNQ +     RS+LE    L+ ++EP V+R+S IICTIGPAC++V+ L KMI++GMN+AR+NFSHG++EYH ETI LVREAV+TF PY+RP+A+ALDTKGPEIRTGL++GS TGEV L KG+ IK+V+D KY++ CN   LWVDY NI+ IL     IY+DDGLISL+V++ G D+L CEVENGG LGSKKGVNLPGAKVDLPAVS+KD  DL FGVE  VDMVFASFIR G A+ EI+ ILGEKGKHILIISKIEN EGV++FDEIL+ SDGIMVARGDLGIEIP EKV LAQKMMIGRCNR GKP+ICATQMLESMI KP PT+AE SDVANA+LDGADCVMLSGETAKG YPLEAVQ+MH ICREAE+ ++Q KFFE +K  I G TDQTHSTA+AAVEAAQRC A+AI+V+TTTGRSA+LI++YRP CPILTVTRHP+TARQ HLWRG+HP+ Y+  R+ +WT DMD RI+++  Y  RRGF++  D+VI+VTGWKAG GSTNT+R+I +E++   + G+  I+S+P I++FED
Sbjct:    1 MKLNGSKYFEPTNYFIQNQRITSNDYRSNLEHTSKLNYNDEPGVIRNSGIICTIGPACKSVTILHKMISAGMNVARLNFSHGTYEYHEETINLVREAVDTFKPYFRPIAIALDTKGPEIRTGLVNGSATGEVNLYKGSTIKIVVDNKYSEQCNSSQLWVDYVNIINILEVNSSIYIDDGLISLVVIKKGSDFLMCEVENGGLLGSKKGVNLPGAKVDLPAVSEKDKEDLRFGVEHNVDMVFASFIRSGNAIKEIKDILGEKGKHILIISKIENLEGVQKFDEILEISDGIMVARGDLGIEIPPEKVVLAQKMMIGRCNRAGKPVICATQMLESMINKPTPTKAEISDVANAVLDGADCVMLSGETAKGQYPLEAVQVMHSICREAENVLYQSKFFEAIKHTISGPTDQTHSTAVAAVEAAQRCHAAAIIVITTTGRSAHLIAKYRPTCPILTVTRHPITARQSHLWRGLHPIFYNEPRMIDWTEDMDERIHYSLSYGFRRGFLQMNDFVIIVTGWKAGVGSTNTLRIIRIEEN-QLQSGVRQIVSVPIISEFED 553          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000017671.1 (SMESG000017671.1)

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 353/554 (63.72%), Postives = 440/554 (79.42%), Query Frame = 3
Query:   75 MKKNPSSFEINNYFIQNQN-VHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            M +    FE +NYF Q +  VH+  + ++LE + +L+ID++P V+R++ IICT+GPAC +V+ L KMIA+GMN+AR+NFSHG+HE HA +IKL+REA+ T  PY  P+A+ALDTKGPEIRTGLI+ + TGEV L+KGN IKLV+ E+Y   C+E  +WVDYK+I+K+L  G RI++DDGLISLIV E   ++L C +ENGG LGS+KGVNLPG  VDLPAVS+KD  DL F VEQ VD+VFASFIR   +V+ IR ILGEKGKHILIISKIEN EG+ +FDEIL+ASDGIMVARGDLGIEIP EKV  AQKMMIG+CN  GK +ICAT MLESMITK RPTRAE SDVANA++DG+DCVMLSGE+AKG YP+EAV++MH ICREAE   FQ  FFE +K  +   TD THSTAIAAVEAAQRC A+ I+V+TT+G SA LI++YRP CPILT+TR+P+TARQ HLWRG+HP+L+   R DEW  DMD RIN++  YA +RGFVK  D +I+VTG KAGSGSTNT++V+ LE D  E+ G+   +S P+I +F+D
Sbjct:    1 MMQGARYFEQSNYFFQERRRVHKDYA-TNLELVADLNIDSDPGVIRNTGIICTLGPACASVAILHKMIAAGMNVARLNFSHGTHEDHARSIKLLREAIATLKPYRFPIAIALDTKGPEIRTGLINNNETGEVRLIKGNNIKLVVSEEYYRKCDENFIWVDYKSILKLLKVGNRIFIDDGLISLIVEEKDSEFLLCRIENGGMLGSRKGVNLPGVNVDLPAVSEKDKEDLKFAVEQNVDIVFASFIRNAESVNIIRKILGEKGKHILIISKIENQEGMIQFDEILEASDGIMVARGDLGIEIPPEKVICAQKMMIGKCNVAGKSVICATHMLESMITKSRPTRAEISDVANAVIDGSDCVMLSGESAKGRYPVEAVKMMHTICREAEHLFFQSNFFESIKETVNLPTDHTHSTAIAAVEAAQRCNAAVIIVLTTSGTSAKLIAKYRPSCPILTLTRNPITARQAHLWRGLHPILFSDPRKDEWPKDMDLRINFSINYAYQRGFVKALDIIIIVTGSKAGSGSTNTLQVVKLEIDEKEEIGLKKYISYPTIKEFDD 553          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000017671.1 (SMESG000017671.1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 352/547 (64.35%), Postives = 438/547 (80.07%), Query Frame = 3
Query:   96 FEINNYFIQNQN-VHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            FE +NYF Q +  VH+  + ++LE + +L+ID++P V+R++ IICT+GPAC +V+ L KMIA+GMN+AR+NFSHG+HE HA +IKL+REA+ T  PY  P+A+ALDTKGPEIRTGLI+ + TGEV L+KGN IKLV+ E+Y   C+E  +WVDYK+I+K+L  G RI++DDGLISLIV E   ++L C +ENGG LGS+KGVNLPG  VDLPAVS+KD  DL F VEQ VD+VFASFIR   +V+ IR ILGEKGKHILIISKIEN EG+ +FDEIL+ASDGIMVARGDLGIEIP EKV  AQKMMIG+CN  GK +ICAT MLESMITK RPTRAE SDVANA++DG+DCVMLSGE+AKG YP+EAV++MH ICREAE   FQ  FFE +K  +   TD THSTAIAAVEAAQRC A+ I+V+TT+G SA LI++YRP CPILT+TR+P+TARQ HLWRG+HP+L+   R DEW  DMD RIN++  YA +RGFVK  D +I+VTG KAGSGSTNT++V+ LE D  E+ G+   +S P+I +F+D
Sbjct:    7 FEQSNYFFQERRRVHKDYA-TNLELVADLNIDSDPGVIRNTGIICTLGPACASVAILHKMIAAGMNVARLNFSHGTHEDHARSIKLLREAIATLKPYRFPIAIALDTKGPEIRTGLINNNETGEVRLIKGNNIKLVVSEEYYRKCDENFIWVDYKSILKLLKVGNRIFIDDGLISLIVEEKDSEFLLCRIENGGMLGSRKGVNLPGVNVDLPAVSEKDKEDLKFAVEQNVDIVFASFIRNAESVNIIRKILGEKGKHILIISKIENQEGMIQFDEILEASDGIMVARGDLGIEIPPEKVICAQKMMIGKCNVAGKSVICATHMLESMITKSRPTRAEISDVANAVIDGSDCVMLSGESAKGRYPVEAVKMMHTICREAEHLFFQSNFFESIKETVNLPTDHTHSTAIAAVEAAQRCNAAVIIVLTTSGTSAKLIAKYRPSCPILTLTRNPITARQAHLWRGLHPILFSDPRKDEWPKDMDLRINFSINYAYQRGFVKALDIIIIVTGSKAGSGSTNTLQVVKLEIDEKEEIGLKKYISYPTIKEFDD 552          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000045839.1 (SMESG000045839.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 337/549 (61.38%), Postives = 416/549 (75.77%), Query Frame = 3
Query:   90 SSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLD-EWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 1733
            S+F+  +YF+Q Q V    +RS LE  C LD+ +EP   R++ I+CT+GPA ++   +K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   +F   YRPVA+ALDTKGPEIRTGLI GSGT EV L  GN I L  DEKY + C+E  L+VDY NI+K+     +IYVDDGLISL+V   G + + C +ENGGNLGSKKG+N+PG  VDLPAVS+KD  DL F  EQ +DMVFASFIR G+A+DEIRAILGEKGKH+ II+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN++GKP+ICATQMLESMI KPRPTRAE+SDVANA+LDGADCVMLSGETAKG YPLEAV  MH ICREAE+  F  +  +DLK  +    D THS AIAAVEAA    A  I+VVTT+GRSA L+SR+RP+CPIL VTR  +T RQ HLWRG+HPL Y+A++   +W  DMD R+ +A   A +RGFV+ G+ V++VTGW+AGSG TNT+R+I +ED             +P+I K E+
Sbjct:    4 SNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIED------------CMPTIMKIEN 540          
The following BLAST results are available for this feature:
BLAST of Pyruvate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKM0.000e+065.71pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+065.71pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+065.71pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+065.71pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+065.52pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pyk-10.000e+060.12Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+060.12Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+060.12Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+059.66Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+059.66Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PyK0.000e+062.67gene:FBgn0267385 transcript:FBtr0084214[more]
PyK0.000e+063.19gene:FBgn0267385 transcript:FBtr0084213[more]
CG29641.264e-16145.65gene:FBgn0031462 transcript:FBtr0077722[more]
CG70691.970e-14152.81gene:FBgn0038952 transcript:FBtr0084215[more]
CG73629.607e-7750.00gene:FBgn0038258 transcript:FBtr0331700[more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma0.000e+065.90pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkma0.000e+065.90pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkma0.000e+066.09pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkmb0.000e+066.28pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pkmb0.000e+066.28pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkm0.000e+065.78pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+066.09pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+066.09pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+066.09pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+066.09pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkm0.000e+066.09pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Pkm0.000e+065.90pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Pklr0.000e+059.35pyruvate kinase liver and red blood cell [Source:M... [more]
Pklr0.000e+059.35pyruvate kinase liver and red blood cell [Source:M... [more]
Pkm3.800e-9864.16pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11980|KPYM_RAT0.000e+066.48Pyruvate kinase PKM OS=Rattus norvegicus OX=10116 ... [more]
sp|P14618|KPYM_HUMAN0.000e+065.52Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM... [more]
sp|Q5NVN0|KPYM_PONAB0.000e+065.52Pyruvate kinase PKM OS=Pongo abelii OX=9601 GN=PKM... [more]
sp|P00548|KPYM_CHICK0.000e+065.76Pyruvate kinase PKM OS=Gallus gallus OX=9031 GN=PK... [more]
sp|P11974|KPYM_RABIT0.000e+065.33Pyruvate kinase PKM OS=Oryctolagus cuniculus OX=99... [more]
back to top
BLAST of Pyruvate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EYV50.000e+066.36Pyruvate kinase (Fragment) OS=Macrostomum lignano ... [more]
A0A267F2740.000e+066.67Pyruvate kinase OS=Macrostomum lignano OX=282301 G... [more]
A0A3Q0KH210.000e+068.18Pyruvate kinase OS=Schistosoma mansoni OX=6183 PE=... [more]
Q5DAM70.000e+068.18Pyruvate kinase OS=Schistosoma japonicum OX=6182 G... [more]
A0A095B0840.000e+068.37Pyruvate kinase OS=Schistosoma haematobium OX=6185... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkmb0.000e+065.97pyruvate kinase PKM-like [Source:NCBI gene;Acc:103... [more]
pkma0.000e+065.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+065.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+065.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+065.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pkma0.000e+063.86pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CDC192.461e-16249.50Pyruvate kinase; functions as a homotetramer in gl... [more]
PYK22.455e-15447.82Pyruvate kinase; appears to be modulated by phosph... [more]
YAL037C-B_mRNA1.357e-1128.37Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO499630.000e+056.50Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:A7RE... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma0.000e+067.11pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkma0.000e+066.73pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkma0.000e+066.73pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkmb0.000e+066.86pyruvate kinase PKM [Source:NCBI gene;Acc:10117042... [more]
pklr0.000e+058.19pyruvate kinase PKM [Source:NCBI gene;Acc:10116118... [more]
back to top
BLAST of Pyruvate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052083.10.000e+0100.00SMESG000052083.1[more]
SMESG000017675.10.000e+068.95SMESG000017675.1[more]
SMESG000017671.10.000e+063.72SMESG000017671.1[more]
SMESG000017671.10.000e+064.35SMESG000017671.1[more]
SMESG000045839.10.000e+061.38SMESG000045839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000995 ID=SMED30000995|Name=Pyruvate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1940bp
ATTAGTTATTGTATCTGAATTTAGTGAGCAGAAAGCATTGATATTTAATA
TAATAATTTTCTAATAACTAGCTAATGAAAAAAAATCCATCTAGTTTCGA
AATAAATAATTATTTCATCCAAAACCAAAATGTCCATCGAGGAGTATCCA
GATCACACTTAGAATTCATTTGTAATTTGGATATTGATAATGAACCCGAT
GTCGTAAGAAGTTCTAGCATTATATGTACAATTGGACCGGCTTGTAGAAC
TGTCAGTACACTGAAAAAAATGATAGCATCTGGAATGAATATTGCCCGAA
TGAATTTTAGTCACGGTTCTCATGAATATCATGCGGAAACAATTAAGCTA
GTTAGAGAAGCAGTTGAAACATTTACTCCTTACTACAGACCAGTTGCGTT
GGCTCTTGACACTAAAGGACCAGAAATACGAACTGGATTAATTCACGGAA
GTGGAACAGGGGAAGTCACTTTAGTTAAAGGCAATAAAATAAAATTGGTG
ATTGATGAGAAATATGCTGATTCGTGTAATGAAGAAATTTTATGGGTTGA
TTACAAAAATATTGTGAAAATTCTTCATAAAGGATGTAGAATCTATGTAG
ATGATGGATTAATTAGCCTCATTGTGGTTGAAACAGGAAAAGATTATTTG
GATTGTGAAGTAGAAAATGGAGGCAATCTAGGATCCAAAAAGGGCGTGAA
TTTGCCTGGAGCAAAAGTCGATTTACCCGCTGTTTCAGATAAAGACATAT
CGGATTTACATTTTGGAGTTGAACAAGGGGTTGATATGGTATTTGCATCA
TTTATTCGATGTGGAGCAGCAGTTGATGAAATTCGCGCCATTCTTGGCGA
AAAAGGAAAACATATTTTGATTATATCTAAAATTGAAAATCACGAAGGCG
TGAAAAGATTCGATGAAATATTACAAGCTTCGGATGGAATTATGGTGGCT
AGAGGAGATTTAGGAATAGAAATTCCCGCAGAAAAAGTCTTCCTTGCACA
AAAAATGATGATTGGGCGATGTAATCGTCTTGGTAAACCAATTATCTGTG
CGACTCAGATGTTAGAATCTATGATTACTAAACCTCGACCAACAAGAGCT
GAATCCAGTGATGTGGCTAATGCTATTTTAGATGGAGCTGATTGTGTAAT
GCTTTCAGGCGAAACGGCAAAAGGTGCTTATCCATTAGAAGCTGTGCAAA
TAATGCATCATATATGTCGTGAAGCTGAATCAGCTGTTTTTCAAGGAAAG
TTTTTTGAGGATCTCAAAGGTGAAATCGTTGGTTCGACCGATCAGACACA
TAGTACGGCTATTGCTGCAGTAGAAGCGGCTCAGAGATGTCGAGCATCTG
CCATCGTTGTTGTTACTACAACTGGAAGATCGGCGTACTTGATTTCTCGA
TATCGACCTCGATGCCCGATTCTTACTGTGACTCGTCACCCAGTAACAGC
CAGACAGGGTCATTTATGGCGTGGAGTTCATCCTCTACTTTATGATGCTA
AACGATTGGATGAATGGACCACTGATATGGATAACAGAATCAATTGGGCG
TTTGGTTATGCGATGAGACGCGGTTTTGTTAAAAATGGTGATTATGTTAT
TGTGGTTACTGGATGGAAGGCTGGTTCTGGGTCAACTAATACGATGCGAG
TTATATTATTAGAAGACGACGCAAATGAAAAAGATGGAATTATGCCAATT
TTATCTATTCCAAGCATAGCAAAATTTGAAGACTAATTTATTTCCTTGAT
GAATATTAACAGCTTTAACCTTTGTGTTTTTGTCCTATTTAGTTAGATTT
CAGACAAATACATCATTTGGATTGTAATTCATACTGATCCTCCTGGATAA
AGGATCTCTTGTTCTATTATATATGGGTTTTCTTTTAATTTTTTAATTGT
TTTTTGGTTTTGGTTTTTTCTTGAATAAAATTAAGTTCTT
back to top

protein sequence of SMED30000995-orf-1

>SMED30000995-orf-1 ID=SMED30000995-orf-1|Name=SMED30000995-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=554bp
MKKNPSSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSII
CTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETF
TPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADS
CNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGG
NLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAV
DEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEI
PAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANA
ILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGE
IVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPIL
TVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRG
FVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAK
FED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040442Pyrv_Kinase-like_dom_sf
IPR036918Pyrv_Knase_C_sf
IPR001697Pyr_Knase
IPR015795Pyrv_Knase_C
IPR015813Pyrv/PenolPyrv_Kinase-like_dom
IPR015794Pyrv_Knase_a/b
IPR015793Pyrv_Knase_brl
IPR015806Pyrv_Knase_insert_dom_sf
IPR018209Pyrv_Knase_AS
IPR011037Pyrv_Knase-like_insert_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004743pyruvate kinase activity
GO:0030955potassium ion binding
GO:0000287magnesium ion binding
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001697Pyruvate kinasePRINTSPR01050PYRUVTKNASEcoord: 293..317
score: 71.75
coord: 236..250
score: 52.21
coord: 266..292
score: 66.21
coord: 362..378
score: 64.62
coord: 105..121
score: 71.22
coord: 318..342
score: 72.62
coord: 343..361
score: 77.89
IPR001697Pyruvate kinaseTIGRFAMTIGR01064TIGR01064coord: 46..527
e-value: 1.6E-183
score: 608.6
IPR001697Pyruvate kinasePANTHERPTHR11817PYRUVATE KINASEcoord: 9..528
IPR001697Pyruvate kinaseCDDcd00288Pyruvate_Kinasecoord: 45..529
e-value: 0.0
score: 742.979
IPR015806Pyruvate kinase, insert domain superfamilyGENE3DG3DSA:2.40.33.10coord: 116..218
e-value: 1.6E-234
score: 780.8
IPR040442Pyruvate kinase-like domain superfamilyGENE3DG3DSA:3.20.20.60coord: 45..384
e-value: 1.6E-234
score: 780.8
IPR015793Pyruvate kinase, barrelPFAMPF00224PKcoord: 45..390
e-value: 1.1E-159
score: 531.0
IPR036918Pyruvate kinase, C-terminal domain superfamilyGENE3DG3DSA:3.40.1380.20coord: 28..526
e-value: 1.6E-234
score: 780.8
IPR036918Pyruvate kinase, C-terminal domain superfamilySUPERFAMILYSSF52935PK C-terminal domain-likecoord: 372..529
IPR015795Pyruvate kinase, C-terminalPFAMPF02887PK_Ccoord: 410..527
e-value: 1.8E-36
score: 124.9
NoneNo IPR availablePANTHERPTHR11817:SF83PYRUVATE KINASE PKMcoord: 9..528
IPR018209Pyruvate kinase, active sitePROSITEPS00110PYRUVATE_KINASEcoord: 264..276
IPR015813Pyruvate/Phosphoenolpyruvate kinase-like domain superfamilySUPERFAMILYSSF51621Phosphoenolpyruvate/pyruvate domaincoord: 18..391
IPR011037Pyruvate kinase-like, insert domain superfamilySUPERFAMILYSSF50800PK beta-barrel domain-likecoord: 116..217