Ras-related protein Rab-2A

Overview
NameRas-related protein Rab-2A
Smed IDSMED30000988
Length (bp)934
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-2A (SMED30000988) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-2A (SMED30000988) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-2A (SMED30000988) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-2A (SMED30000988) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000988

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30000988SMESG000043454.1 dd_Smed_v4_10570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000988SMESG000043454.1 dd_Smed_v4_10570_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-2A vs. Ensembl Human
Match: RAB2A (RAB2A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9763])

HSP 1 Score: 281.567 bits (719), Expect = 5.316e-95
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Human
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 280.796 bits (717), Expect = 6.796e-95
Identity = 130/181 (71.82%), Postives = 153/181 (84.53%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R + ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + SWLEDARQ++SSN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ G  +  NE
Sbjct:    1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Human
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 280.026 bits (715), Expect = 1.895e-94
Identity = 130/181 (71.82%), Postives = 153/181 (84.53%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R + ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + SWLEDARQ++SSN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ G  +  NE
Sbjct:    1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Human
Match: RAB2A (RAB2A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9763])

HSP 1 Score: 222.631 bits (566), Expect = 2.902e-72
Identity = 108/181 (59.67%), Postives = 134/181 (74.03%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGV                        EFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGV------------------------EFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 157          
BLAST of Ras-related protein Rab-2A vs. Ensembl Human
Match: RAB14 (RAB14, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16524])

HSP 1 Score: 222.246 bits (565), Expect = 1.083e-71
Identity = 102/176 (57.95%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3822883:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 282.722 bits (722), Expect = 9.481e-96
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R +TID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + SWLEDARQ+++SN+V++LIGNKSDLE+ R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:   10 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNE 190          
BLAST of Ras-related protein Rab-2A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 281.567 bits (719), Expect = 2.034e-95
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R +TID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + SWLEDARQ+++SN+V++LIGNKSDLE+ R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 217.238 bits (552), Expect = 3.123e-70
Identity = 100/176 (56.82%), Postives = 132/176 (75.00%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DA+   + N  + LIGNK+DLE +R V   E +AF++E+GL FLE SAKT  NV++AF+ TA  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 217.238 bits (552), Expect = 3.123e-70
Identity = 100/176 (56.82%), Postives = 132/176 (75.00%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DA+   + N  + LIGNK+DLE +R V   E +AF++E+GL FLE SAKT  NV++AF+ TA  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Celegans
Match: F11A5.3 (pep chromosome:WBcel235:V:16194939:16195544:1 gene:WBGene00008671.1 transcript:F11A5.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F11A5.3)

HSP 1 Score: 199.519 bits (506), Expect = 2.092e-63
Identity = 94/171 (54.97%), Postives = 129/171 (75.44%), Query Frame = 1
Query:  109 LFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTI 621
            +FK++IIGD GVGKS LLL+FTD+ F   H  T+GVEFG + + IDK   +L+VWDT GQE FRSI R+YYR +  ALLVYDIT +++F  +  WL D RQ+    +V++LIGNKSDL++ R V+T EGEAF+K++GL F+ETSAK   +V++AF+ TA+ IY+K++ G I
Sbjct:    6 MFKYVIIGDGGVGKSNLLLRFTDELFDPIHTTTLGVEFGYKDLQIDKYKVRLRVWDTCGQENFRSIIRAYYRNALGALLVYDITCRKSFVHLEQWLSDLRQHGHPEMVIMLIGNKSDLKAVRDVTTEEGEAFAKKNGLTFMETSAKANKHVEKAFVNTAHEIYKKLKLGVI 176          
BLAST of Ras-related protein Rab-2A vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0336658)

HSP 1 Score: 282.337 bits (721), Expect = 9.445e-96
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQEAFRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ+++SN+V++LIGNKSDL+S R+V   EGEAF++EHGL+F+ETSA+T  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0086124)

HSP 1 Score: 282.337 bits (721), Expect = 9.445e-96
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQEAFRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ+++SN+V++LIGNKSDL+S R+V   EGEAF++EHGL+F+ETSA+T  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0343678)

HSP 1 Score: 216.083 bits (549), Expect = 1.457e-69
Identity = 101/176 (57.39%), Postives = 131/176 (74.43%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y ++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +D    KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL D R   + + V+ LIGNKSDLES R+V+  E + F+ E+GL+FLE SA T  NV+EAF+ TA  IYQ IQ+G ++
Sbjct:    7 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080626)

HSP 1 Score: 216.083 bits (549), Expect = 1.457e-69
Identity = 101/176 (57.39%), Postives = 131/176 (74.43%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y ++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +D    KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL D R   + + V+ LIGNKSDLES R+V+  E + F+ E+GL+FLE SA T  NV+EAF+ TA  IYQ IQ+G ++
Sbjct:    7 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080627)

HSP 1 Score: 216.083 bits (549), Expect = 2.442e-69
Identity = 101/176 (57.39%), Postives = 131/176 (74.43%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y ++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +D    KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL D R   + + V+ LIGNKSDLES R+V+  E + F+ E+GL+FLE SA T  NV+EAF+ TA  IYQ IQ+G ++
Sbjct:   31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLD 206          
BLAST of Ras-related protein Rab-2A vs. Ensembl Zebrafish
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 281.567 bits (719), Expect = 3.382e-95
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Zebrafish
Match: rab14 (RAB14, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-030826-20])

HSP 1 Score: 222.246 bits (565), Expect = 6.527e-72
Identity = 102/176 (57.95%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Zebrafish
Match: rab14l (RAB14, member RAS oncogene family, like [Source:ZFIN;Acc:ZDB-GENE-040426-1207])

HSP 1 Score: 220.705 bits (561), Expect = 2.228e-71
Identity = 101/176 (57.39%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R + +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIMEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Zebrafish
Match: rab4a (RAB4a, member RAS oncogene family [Source:NCBI gene;Acc:403031])

HSP 1 Score: 211.846 bits (538), Expect = 6.665e-68
Identity = 99/178 (55.62%), Postives = 134/178 (75.28%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            +Y FLFKF++IG+ G GKSCLL QF +KRF+   + TIGVEFG + I++     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDIT +ET+ ++ +WL DAR  AS N+V+IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    4 TYDFLFKFLVIGNAGTGKSCLLHQFIEKRFKDDSNHTIGVEFGSKIISVVNKFVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Zebrafish
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 210.305 bits (534), Expect = 2.948e-67
Identity = 98/178 (55.06%), Postives = 132/178 (74.16%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            +Y FLFKF++IG  G GKSCLL QF + +F+Q  + TIGVEFG R + +     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDIT +ET+ ++ +WL DAR  AS N+V+IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    4 TYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARSILNKIESGELDPE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Xenopus
Match: hus1 (HUS1 checkpoint clamp component [Source:Xenbase;Acc:XB-GENE-983295])

HSP 1 Score: 285.804 bits (730), Expect = 1.049e-96
Identity = 134/181 (74.03%), Postives = 155/181 (85.64%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R I ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF+ + SWLEDARQ++SSN+V+ILIGNKSDLES R VS  EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFSHLTSWLEDARQHSSSNMVIILIGNKSDLESRRDVSREEGEAFAREHGLIFMETSAKTAANVEEAFIDTAKEIYKKIQQGLFDVNNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Xenopus
Match: RAB2A (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:100038062])

HSP 1 Score: 280.796 bits (717), Expect = 8.396e-95
Identity = 128/181 (70.72%), Postives = 155/181 (85.64%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LI NKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIANKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Xenopus
Match: RAB2A (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:100038062])

HSP 1 Score: 255.373 bits (651), Expect = 9.911e-85
Identity = 118/179 (65.92%), Postives = 146/179 (81.56%), Query Frame = 1
Query:  100 YAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            Y + +  ++I   GVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LI NKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    3 YCYCYFLLLIFYAGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIANKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Xenopus
Match: map4 (microtubule associated protein 4 [Source:Xenbase;Acc:XB-GENE-6259104])

HSP 1 Score: 206.453 bits (524), Expect = 1.491e-65
Identity = 96/178 (53.93%), Postives = 131/178 (73.60%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            +Y FLFKF++IG  G GKSCLL QF + +F+Q  + TIGVEFG R + +     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDI  +ET+ ++ +WL DAR  AS N+++IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    4 TYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDIASRETYNALTNWLTDARTLASPNIIIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILSKIESGELDPE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Xenopus
Match: map4 (microtubule associated protein 4 [Source:Xenbase;Acc:XB-GENE-6259104])

HSP 1 Score: 195.667 bits (496), Expect = 1.603e-61
Identity = 91/171 (53.22%), Postives = 125/171 (73.10%), Query Frame = 1
Query:  118 FIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            F++IG  G GKSCLL QF + +F+Q  + TIGVEFG R + +     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDI  +ET+ ++ +WL DAR  AS N+++IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    5 FLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDIASRETYNALTNWLTDARTLASPNIIIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILSKIESGELDPE 175          
BLAST of Ras-related protein Rab-2A vs. Ensembl Mouse
Match: Rab2a (RAB2A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1928750])

HSP 1 Score: 281.567 bits (719), Expect = 3.031e-95
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Mouse
Match: Rab2b (RAB2B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1923588])

HSP 1 Score: 278.485 bits (711), Expect = 6.400e-94
Identity = 129/181 (71.27%), Postives = 153/181 (84.53%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R + ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + SWLEDARQ++SSN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EA+I TA  IY+KIQ G  +  NE
Sbjct:    1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIYRKIQQGLFDVHNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Mouse
Match: Rab2b (RAB2B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1923588])

HSP 1 Score: 278.485 bits (711), Expect = 6.400e-94
Identity = 129/181 (71.27%), Postives = 153/181 (84.53%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R + ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + SWLEDARQ++SSN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EA+I TA  IY+KIQ G  +  NE
Sbjct:    1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIYRKIQQGLFDVHNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Mouse
Match: Rab2b (RAB2B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1923588])

HSP 1 Score: 257.299 bits (656), Expect = 5.032e-86
Identity = 118/159 (74.21%), Postives = 139/159 (87.42%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEA 570
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R + ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + SWLEDARQ++SSN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EA
Sbjct:    1 MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEA 159          
BLAST of Ras-related protein Rab-2A vs. Ensembl Mouse
Match: Rab14 (RAB14, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915615])

HSP 1 Score: 222.246 bits (565), Expect = 7.437e-72
Identity = 102/176 (57.95%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. UniProt/SwissProt
Match: sp|Q05975|RAB2_LYMST (Ras-related protein Rab-2 OS=Lymnaea stagnalis OX=6523 GN=RAB2 PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 2.096e-95
Identity = 131/181 (72.38%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLE+ R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IYQKIQDG  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLEARREVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQDGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. UniProt/SwissProt
Match: sp|P53994|RAB2A_MOUSE (Ras-related protein Rab-2A OS=Mus musculus OX=10090 GN=Rab2a PE=1 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.120e-94
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. UniProt/SwissProt
Match: sp|Q5R6B6|RAB2A_PONAB (Ras-related protein Rab-2A OS=Pongo abelii OX=9601 GN=RAB2A PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.553e-94
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. UniProt/SwissProt
Match: sp|Q4R4X6|RAB2A_MACFA (Ras-related protein Rab-2A OS=Macaca fascicularis OX=9541 GN=RAB2A PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.553e-94
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. UniProt/SwissProt
Match: sp|P61019|RAB2A_HUMAN (Ras-related protein Rab-2A OS=Homo sapiens OX=9606 GN=RAB2A PE=1 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.553e-94
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. TrEMBL
Match: B4HQA8 (GM20894 OS=Drosophila sechellia OX=7238 GN=Dsec\GM20894 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 4.207e-94
Identity = 134/197 (68.02%), Postives = 163/197 (82.74%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENEN-----PWTLDSLILM 669
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQEAFRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ+++SN+V++LIGNKSDL+S R+V   EGEAF++EHGL+F+ETSA+T  NV+EAFI TA  IY+KIQ+G  +  NE      PW L ++ L+
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEVRKKHFPWELLAITLL 197          
BLAST of Ras-related protein Rab-2A vs. TrEMBL
Match: A0A369RRK9 (Ras-related protein Rab-2 OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_011069 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.976e-94
Identity = 133/181 (73.48%), Postives = 155/181 (85.64%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ+++SN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IYQKIQDG  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQDGAFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. TrEMBL
Match: B3S6V0 (Uncharacterized protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_30079 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.976e-94
Identity = 133/181 (73.48%), Postives = 155/181 (85.64%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ+++SN+V++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IYQKIQDG  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQDGAFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. TrEMBL
Match: A0A1B6CLR0 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.16737 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.276e-93
Identity = 132/181 (72.93%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQEAFRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. TrEMBL
Match: A0A3Q3IQK1 (RAB2A, member RAS oncogene family OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.462e-93
Identity = 132/190 (69.47%), Postives = 161/190 (84.74%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENENPWTLDSLI 663
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE  W + SL+
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEVRWAVPSLL 190          
BLAST of Ras-related protein Rab-2A vs. Ensembl Cavefish
Match: rab2a (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:103041250])

HSP 1 Score: 281.567 bits (719), Expect = 2.804e-95
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Cavefish
Match: ENSAMXT00000039673.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000139.1:3081649:3095559:1 gene:ENSAMXG00000040126.1 transcript:ENSAMXT00000039673.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.942 bits (572), Expect = 3.508e-72
Identity = 102/176 (57.95%), Postives = 137/176 (77.84%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I ++    KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:   64 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVNGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 239          
BLAST of Ras-related protein Rab-2A vs. Ensembl Cavefish
Match: rab14 (ras-related protein Rab-14 [Source:NCBI gene;Acc:103026976])

HSP 1 Score: 222.246 bits (565), Expect = 5.531e-72
Identity = 102/176 (57.95%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Cavefish
Match: rab4a (RAB4A, member RAS oncogene family [Source:NCBI gene;Acc:103032660])

HSP 1 Score: 209.92 bits (533), Expect = 3.652e-67
Identity = 98/178 (55.06%), Postives = 133/178 (74.72%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            +Y FLFKF++IG+ G GKSCLL QF +K+F+   + TIGVEFG + I +     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDIT +ET+ ++ +WL DAR  AS N+V+IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    4 TYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVVNKFVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Cavefish
Match: rab4b (ras-related protein Rab-4B [Source:NCBI gene;Acc:103022831])

HSP 1 Score: 209.92 bits (533), Expect = 3.940e-67
Identity = 98/178 (55.06%), Postives = 132/178 (74.16%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            +Y FLFKF++IG  G GKSCLL QF + +F+Q  + TIGVEFG R + +     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDIT +ET+ ++ +WL DAR  AS N+V+IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    4 TYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARTLASPNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIESGELDPE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 283.493 bits (724), Expect = 9.919e-97
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 279.256 bits (713), Expect = 4.926e-95
Identity = 128/181 (70.72%), Postives = 154/181 (85.08%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R I I     KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    6 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNMVIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKIQEGVFDVNNE 186          
BLAST of Ras-related protein Rab-2A vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 274.633 bits (701), Expect = 9.254e-94
Identity = 126/177 (71.19%), Postives = 151/177 (85.31%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R I ID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ++SSN++++LIGNKSDLES R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IYQ+I +G  +
Sbjct:    6 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMIIMLIGNKSDLESRRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKEIYQRIHEGVFD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002219.1 (pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene:ENSPMAG00000002006.1 transcript:ENSPMAT00000002219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.713 bits (574), Expect = 4.647e-74
Identity = 104/176 (59.09%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ LIGNK+DLE++R V+  E + F++E+GLLFLE SAKT DNV+EAF+ TA  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGDNVEEAFLETAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Sea Lamprey
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 199.904 bits (507), Expect = 8.350e-64
Identity = 97/181 (53.59%), Postives = 129/181 (71.27%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDIT--KKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            +S  FLFKF++IG  G GKSCLL QF + +F+Q  + TIGVEFG + +       KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDIT   +ET+ ++ +WL DAR  AS N+ +IL GNK DLE +R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    7 VSTDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSKVVNTGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSGSRETYNALTNWLADARTLASPNIAIILCGNKKDLEPDREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIESGELDPE 187          
BLAST of Ras-related protein Rab-2A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 180.259 bits (456), Expect = 1.995e-56
Identity = 96/216 (44.44%), Postives = 128/216 (59.26%), Query Frame = 1
Query:  100 YAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENENPWTLDSLILMKTVSEVTVSPYPTLSITP*LEECMEA 747
            Y  LFK ++IGD+GVGKS LL +FT   F      TIGVEF  RT+ ID    K Q+WDTAGQE +R+IT +YYRG+  AL+VYDI+K  ++ +   WL + R+NA  N+ V LIGNKSDL   R V T E + F++E+ LLF ETSA   +NVD+AF    N IYQK+    ++        L         +  +    PT+S+TP   E  +A
Sbjct:   10 YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMD--------LGDSSANGNANGASAPNGPTISLTPTPNENKKA 217          
BLAST of Ras-related protein Rab-2A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 170.629 bits (431), Expect = 1.309e-52
Identity = 91/208 (43.75%), Postives = 123/208 (59.13%), Query Frame = 1
Query:  100 YAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENENPWTLDSLILMKTVSEVTVSPYPTLSITP 723
            Y +LFK ++IGD+GVGKS LL +FT   F      TIGVEF  RTI ++    K Q+WDTAGQE +R+IT +YYRG+  AL+VYDI+K  ++ +   WL + R+NA  N+ V LIGNKSDL   R V T E + F+ E+ +LF ETSA   DNVD+AF      I+Q +    ++        + S    K          PT+S+TP
Sbjct:   10 YDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKG---------PTISLTP 208          
BLAST of Ras-related protein Rab-2A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 168.318 bits (425), Expect = 8.766e-52
Identity = 79/170 (46.47%), Postives = 120/170 (70.59%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKI 606
            SY  + K ++IGD+GVGKSCLL++F + +F  +   TIG++F ++T+ I+    KLQ+WDTAGQE FR+IT +YYRG+   +LVYD+T + TFT++  W +   ++A+    ++L+GNKSD+E+ R V+  +GEA +KE G+ F+E+SAK  DNV+E F   A  I +KI
Sbjct:   16 SYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMET-RVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKI 184          
BLAST of Ras-related protein Rab-2A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 164.081 bits (414), Expect = 3.026e-50
Identity = 77/175 (44.00%), Postives = 118/175 (67.43%), Query Frame = 1
Query:  100 YAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            Y +LFK ++IG++GVGKSCLLL+F+D  +   +  TIGV+F ++T+ +D    KLQ+WDTAGQE FR+IT SYYRGS   ++VYD+T +E+F  V  WL++  + A+S ++ +L+GNK DL+ +R V     + F+  + + FLETSA    NV++AF+  A  I + +    +N
Sbjct:    5 YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLN 179          
BLAST of Ras-related protein Rab-2A vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 145.591 bits (366), Expect = 4.406e-43
Identity = 69/178 (38.76%), Postives = 110/178 (61.80%), Query Frame = 1
Query:  112 FKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDL---ESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
             K +++G+  VGKS ++L+F    F +  + TIG  F  + +TI++   K ++WDTAGQE F S+   YYR + AAL+VYD+TK ++F     W+++  + AS ++++ L+GNK D+     ER+V+  EGE  ++E GLLF ETSAKT +NV++ F+     I  K  +   +  NE
Sbjct:    8 IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNE 185          
BLAST of Ras-related protein Rab-2A vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 283.493 bits (724), Expect = 1.483e-96
Identity = 131/181 (72.38%), Postives = 155/181 (85.64%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ++SSN+V++LIGNKSDLE+ R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IYQKIQ+G  +  NE
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Nematostella
Match: EDO43319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ04])

HSP 1 Score: 219.164 bits (557), Expect = 3.710e-71
Identity = 101/176 (57.39%), Postives = 135/176 (76.70%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ LIGNKSDL+++R V+  E + F++E+GLLF E SAKT +NV++AF+ TA  IYQ IQDG+++
Sbjct:    8 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKSDLDAQRDVTYEEAKQFAEENGLLFCEASAKTGENVEDAFLETAKKIYQNIQDGSLD 183          
BLAST of Ras-related protein Rab-2A vs. Ensembl Nematostella
Match: EDO43047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZT6])

HSP 1 Score: 204.142 bits (518), Expect = 3.078e-65
Identity = 94/176 (53.41%), Postives = 130/176 (73.86%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y FLFKF++IG  G GKSC+L QF + +F+Q    TIGVEFG + + +     KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDI+ +ETF S+ +WL DAR  AS N+V+IL+GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+E F+  +  I  KI+ G ++
Sbjct:    4 TYDFLFKFLVIGSAGTGKSCILHQFIEGKFKQDSSHTIGVEFGSKIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDISSRETFNSLTNWLTDARTLASPNIVIILVGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEGFLKCSRTILNKIESGELD 179          
BLAST of Ras-related protein Rab-2A vs. Ensembl Nematostella
Match: EDO49117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU7])

HSP 1 Score: 179.489 bits (454), Expect = 1.702e-55
Identity = 87/204 (42.65%), Postives = 130/204 (63.73%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTI---NCENENPWTLDSLILMKTVSEVTVSP 699
            +Y +LFK ++IGD+GVGKS LL ++T   F      TIGVE   R + I+    + Q+WDTAGQE +R+IT +YYRG+  A+LVYDI K  +F ++  W+E+ RQ+AS +L +ILIGNKSDL+  R +    G+ F+ EHG+LF+ETSA    NV EAF     HI+ K++   +      +E P   +S+++   ++E+  +P
Sbjct:   14 NYDYLFKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDTAGQERYRAITSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLKHLRMIENRRGKQFAAEHGMLFMETSALDSTNVAEAFEFIFAHIFDKVRQNELEKSGQAHEKP-NGESIVIKAELAELPATP 216          
BLAST of Ras-related protein Rab-2A vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 178.333 bits (451), Expect = 2.139e-55
Identity = 84/182 (46.15%), Postives = 123/182 (67.58%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENENP 642
            +Y FLFK ++IGD+GVGK+C+L +F++  F  T   TIG++F +RTI +D    KLQ+WDTAGQE FR+IT +YYRG+   +LVYDIT  ++F ++ +W+ +  ++AS ++  +++GNK D+E  RQVS   GE  + E+G+ F+ETSAK   NV+EAF   A  I  K+       EN NP
Sbjct:    4 TYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDK---KLENSNP 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Medaka
Match: rab2a (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:101175108])

HSP 1 Score: 281.567 bits (719), Expect = 2.144e-95
Identity = 129/181 (71.27%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            M+YA+LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G  +  NE
Sbjct:    1 MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Ensembl Medaka
Match: rab2a (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:101175108])

HSP 1 Score: 231.491 bits (589), Expect = 5.706e-76
Identity = 105/144 (72.92%), Postives = 126/144 (87.50%), Query Frame = 1
Query:  139 GVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEA 570
            GVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT+++TF  + +WLEDARQ+++SN+V++LIGNKSDLES R+V   EGEAF++EHGL+F+ETSAKT  NV+EA
Sbjct:   15 GVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEA 158          
BLAST of Ras-related protein Rab-2A vs. Ensembl Medaka
Match: ENSORLT00000033612.1 (ras-related protein Rab-14 [Source:NCBI gene;Acc:101167092])

HSP 1 Score: 223.402 bits (568), Expect = 1.795e-72
Identity = 103/176 (58.52%), Postives = 135/176 (76.70%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+F+FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R + +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F+ E+GLLFLE SAKT +NV+EAF+  A  IYQ IQDG+++
Sbjct:    7 NYSFIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIMEVHGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFADENGLLFLEASAKTGENVEEAFLEAAKRIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Medaka
Match: rab14 (ras-related protein Rab-14 [Source:NCBI gene;Acc:101162540])

HSP 1 Score: 222.246 bits (565), Expect = 5.804e-72
Identity = 102/176 (57.95%), Postives = 136/176 (77.27%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I +     KLQ+WDTAGQE FR++TRSYYRG+A AL+VYDIT++ T+  + SWL DAR   + N V+ILIGNK+DLE++R V+  E + F++E+GLLFLE SAKT +NV++AF+  A  IYQ IQDG+++
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD 182          
BLAST of Ras-related protein Rab-2A vs. Ensembl Medaka
Match: rab4a (RAB4A, member RAS oncogene family [Source:NCBI gene;Acc:101158840])

HSP 1 Score: 214.927 bits (546), Expect = 3.802e-69
Identity = 100/178 (56.18%), Postives = 135/178 (75.84%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCE 630
            SY FLFKF++IG+ G GKSCLL QF +KRF+   + TIGVEFG + I++   + KLQ+WDTAGQE FRS+TRSYYRG+A ALLVYDIT +ET+ ++ +WL DAR  AS N+V+IL GNK DL+++R+V+  E   F++E+ L+FLETSA T +NV+EAF+  A  I  KI+ G ++ E
Sbjct:    4 SYDFLFKFLVIGNAGTGKSCLLHQFIEKRFKDESNHTIGVEFGSKIISVVNKMVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTTWLSDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPE 181          
BLAST of Ras-related protein Rab-2A vs. Planmine SMEST
Match: SMESG000043454.1 (SMESG000043454.1)

HSP 1 Score: 372.089 bits (954), Expect = 2.975e-131
Identity = 181/181 (100.00%), Postives = 181/181 (100.00%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE
Sbjct:    1 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 181          
BLAST of Ras-related protein Rab-2A vs. Planmine SMEST
Match: SMESG000076159.1 (SMESG000076159.1)

HSP 1 Score: 282.337 bits (721), Expect = 8.042e-96
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSY++LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ++SSN+V++LIGNKSDLE+ R V   EGEAF++EHGL+F+ETSAKT  NV+EAFI TA  IY+KIQ+G ++  NE
Sbjct:    1 MSYSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKAIYEKIQEGVLDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Planmine SMEST
Match: SMESG000017457.1 (SMESG000017457.1)

HSP 1 Score: 276.174 bits (705), Expect = 2.452e-93
Identity = 129/181 (71.27%), Postives = 154/181 (85.08%), Query Frame = 1
Query:   94 MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENE 636
            MSY++LFK+IIIGDTGVGKSCLLLQFTDKRFQ  HD+TIGVEFG R ITID    KLQ+WDTAGQE+FRSITRSYYRG+A ALLVYDIT++ETF  + +WLEDARQ++SSN+V++LIGNKSDLE+ R V   EGE+F+ EHGL+F+ETSAKT  NV+EAFI TA  IY KIQ+G ++  NE
Sbjct:    1 MSYSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFDHLTTWLEDARQHSSSNMVIMLIGNKSDLENRRDVKREEGESFAHEHGLVFMETSAKTALNVEEAFINTAKAIYGKIQEGVLDINNE 181          
BLAST of Ras-related protein Rab-2A vs. Planmine SMEST
Match: SMESG000044270.1 (SMESG000044270.1)

HSP 1 Score: 220.705 bits (561), Expect = 1.686e-71
Identity = 104/181 (57.46%), Postives = 136/181 (75.14%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENEN 639
            +Y+++FK+IIIGD GVGKSCLL QFT+K+F      TIGVEFG R I I+    KLQ+WDTAGQE FR++TRSYYRG+A ALLVYD+T+K TF  + SWL DAR   S N V+ +IGNKSD+  +R V+  EG+A + E+GL+FLE SAKT + V++AFI TA  I+Q IQDG+++  + N
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEINGEKIKLQIWDTAGQERFRAVTRSYYRGAAGALLVYDVTRKSTFNHIHSWLTDARGLTSPNTVIFMIGNKSDMNEQRDVTYDEGKAVADENGLMFLECSAKTGEGVEDAFIETARKIFQNIQDGSVDLNSAN 187          
BLAST of Ras-related protein Rab-2A vs. Planmine SMEST
Match: SMESG000024495.1 (SMESG000024495.1)

HSP 1 Score: 210.305 bits (534), Expect = 1.545e-67
Identity = 99/176 (56.25%), Postives = 129/176 (73.30%), Query Frame = 1
Query:   97 SYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITIDKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTIN 624
            +Y+++FK+IIIGD GVGKSCLL QFT+ +F      TIGVEFG + I +     KLQ+WDTAGQE FR++TRSYYRG+A A+LVYDIT+K TF  V SWL DAR   S   V ILIGNK DL   R+VS  +G+  ++E+G+ FLE SA+T ++V++AFI TA  IYQ IQ+G ++
Sbjct:    5 AYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVD 180          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB2A5.316e-9571.27RAB2A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B6.796e-9571.82RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B1.895e-9471.82RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2A2.902e-7259.67RAB2A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB141.083e-7157.95RAB14, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1089.481e-9671.27pep chromosome:WBcel235:I:3822883:3826514:1 gene:W... [more]
unc-1082.034e-9571.27pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
rab-143.123e-7056.82RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
rab-143.123e-7056.82RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
F11A5.32.092e-6354.97pep chromosome:WBcel235:V:16194939:16195544:1 gene... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab29.445e-9671.82gene:FBgn0014009 transcript:FBtr0336658[more]
Rab29.445e-9671.82gene:FBgn0014009 transcript:FBtr0086124[more]
Rab141.457e-6957.39gene:FBgn0015791 transcript:FBtr0343678[more]
Rab141.457e-6957.39gene:FBgn0015791 transcript:FBtr0080626[more]
Rab142.442e-6957.39gene:FBgn0015791 transcript:FBtr0080627[more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab2a3.382e-9571.27RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab146.527e-7257.95RAB14, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab14l2.228e-7157.39RAB14, member RAS oncogene family, like [Source:ZF... [more]
rab4a6.665e-6855.62RAB4a, member RAS oncogene family [Source:NCBI gen... [more]
rab4b2.948e-6755.06RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hus11.049e-9674.03HUS1 checkpoint clamp component [Source:Xenbase;Ac... [more]
RAB2A8.396e-9570.72RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
RAB2A9.911e-8565.92RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
map41.491e-6553.93microtubule associated protein 4 [Source:Xenbase;A... [more]
map41.603e-6153.22microtubule associated protein 4 [Source:Xenbase;A... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab2a3.031e-9571.27RAB2A, member RAS oncogene family [Source:MGI Symb... [more]
Rab2b6.400e-9471.27RAB2B, member RAS oncogene family [Source:MGI Symb... [more]
Rab2b6.400e-9471.27RAB2B, member RAS oncogene family [Source:MGI Symb... [more]
Rab2b5.032e-8674.21RAB2B, member RAS oncogene family [Source:MGI Symb... [more]
Rab147.437e-7257.95RAB14, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05975|RAB2_LYMST2.096e-9572.38Ras-related protein Rab-2 OS=Lymnaea stagnalis OX=... [more]
sp|P53994|RAB2A_MOUSE2.120e-9471.27Ras-related protein Rab-2A OS=Mus musculus OX=1009... [more]
sp|Q5R6B6|RAB2A_PONAB2.553e-9471.27Ras-related protein Rab-2A OS=Pongo abelii OX=9601... [more]
sp|Q4R4X6|RAB2A_MACFA2.553e-9471.27Ras-related protein Rab-2A OS=Macaca fascicularis ... [more]
sp|P61019|RAB2A_HUMAN2.553e-9471.27Ras-related protein Rab-2A OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4HQA84.207e-9468.02GM20894 OS=Drosophila sechellia OX=7238 GN=Dsec\GM... [more]
A0A369RRK94.976e-9473.48Ras-related protein Rab-2 OS=Trichoplax sp. H2 OX=... [more]
B3S6V04.976e-9473.48Uncharacterized protein OS=Trichoplax adhaerens OX... [more]
A0A1B6CLR01.276e-9372.93Uncharacterized protein OS=Clastoptera arizonana O... [more]
A0A3Q3IQK11.462e-9369.47RAB2A, member RAS oncogene family OS=Monopterus al... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab2a2.804e-9571.27RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
ENSAMXT00000039673.13.508e-7257.95pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
rab145.531e-7257.95ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
rab4a3.652e-6755.06RAB4A, member RAS oncogene family [Source:NCBI gen... [more]
rab4b3.940e-6755.06ras-related protein Rab-4B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab2a9.919e-9771.82RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB2B4.926e-9570.72RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B9.254e-9471.19RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
ENSPMAT00000002219.14.647e-7459.09pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene... [more]
rab4b8.350e-6453.59RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT311.995e-5644.44Rab family GTPase; involved in the exocytic pathwa... [more]
YPT321.309e-5243.75Rab family GTPase involved in the exocytic pathway... [more]
SEC48.766e-5246.47Rab family GTPase; essential for vesicle-mediated ... [more]
YPT13.026e-5044.00Rab family GTPase; involved in the ER-to-Golgi ste... [more]
VPS214.406e-4338.76Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO366871.483e-9672.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433193.710e-7157.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430473.078e-6553.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491171.702e-5542.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410182.139e-5546.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab2a2.144e-9571.27RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
rab2a5.706e-7672.92RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
ENSORLT00000033612.11.795e-7258.52ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
rab145.804e-7257.95ras-related protein Rab-14 [Source:NCBI gene;Acc:1... [more]
rab4a3.802e-6956.18RAB4A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043454.12.975e-131100.00SMESG000043454.1[more]
SMESG000076159.18.042e-9671.82SMESG000076159.1[more]
SMESG000017457.12.452e-9371.27SMESG000017457.1[more]
SMESG000044270.11.686e-7157.46SMESG000044270.1[more]
SMESG000024495.11.545e-6756.25SMESG000024495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000988 ID=SMED30000988|Name=Ras-related protein Rab-2A|organism=Schmidtea mediterranea sexual|type=transcript|length=934bp
CAAATTATATTGGAGAATTCATTCAAGGTCATATTTGTTTAAATTAGCAA
ATAAAATTTAATATCTCACAATTTAACAATTGAATTTATTTAAATGTCTT
ATGCTTTTCTTTTTAAATTTATTATAATTGGTGATACTGGAGTGGGCAAA
TCTTGCTTATTGCTTCAATTTACCGATAAACGTTTTCAACAGACTCACGA
TATGACTATTGGAGTTGAATTCGGAGTTCGTACAATAACCATTGATAAAA
GTCTCACAAAGTTACAAGTTTGGGATACAGCAGGACAAGAAGCTTTTCGC
TCAATCACTCGCTCATATTACAGAGGATCTGCAGCTGCTTTATTGGTTTA
TGATATTACAAAAAAAGAAACTTTCACCAGCGTTTTATCATGGCTGGAAG
ATGCTAGACAAAATGCCAGTTCTAATTTAGTAGTCATTCTCATTGGTAAT
AAAAGTGATCTCGAATCCGAAAGGCAAGTCTCAACATATGAAGGAGAAGC
ATTTTCAAAAGAACACGGTTTATTGTTTCTTGAGACATCAGCGAAAACTT
GCGACAATGTAGACGAAGCATTTATCATTACTGCCAATCATATTTATCAA
AAAATACAAGATGGCACTATCAATTGTGAAAATGAGAACCCATGGACATT
AGATTCTTTAATTTTGATGAAGACGGTGTCGGAAGTGACAGTGAGTCCTT
ACCCGACCTTGTCCATAACGCCCTAACTCGAGGAATGCATGGAGGCTTAA
AGTCGAATTTTTTAAGCCTTCTAAACCAAGAAGACTTTAGATATTTTTTT
ACTAATTTTTTCCATATAATTTTATGCTTTCTATTATAGACTGGCGGAAT
TAAACTTGGAACAAGATATAAACTTTCAAAGAAAAAATCATCAGATTCTA
ATGGAAAACGTAGCAGTTGTTGTTGAAATTTACA
back to top

protein sequence of SMED30000988-orf-1

>SMED30000988-orf-1 ID=SMED30000988-orf-1|Name=SMED30000988-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
CKFQQQLLRFPLESDDFFFESLYLVPSLIPPVYNRKHKIIWKKLVKKYLK
SSWFRRLKKFDFKPPCIPRVRALWTRSGKDSLSLPTPSSSKLKNLMSMGS
HFHN*
back to top

protein sequence of SMED30000988-orf-2

>SMED30000988-orf-2 ID=SMED30000988-orf-2|Name=SMED30000988-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MSYAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITI
DKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSW
LEDARQNASSNLVVILIGNKSDLESERQVSTYEGEAFSKEHGLLFLETSA
KTCDNVDEAFIITANHIYQKIQDGTINCENENPWTLDSLILMKTVSEVTV
SPYPTLSITP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0019003GDP binding
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0042470melanosome
GO:0005802trans-Golgi network
GO:0045335phagocytic vesicle
GO:0055037recycling endosome
GO:0000139Golgi membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0033116endoplasmic reticulum-Golgi intermediate compartment membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR030702Rab14
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0032456endocytic recycling
GO:0006895Golgi to endosome transport
GO:0090382phagosome maturation
GO:0042742defense response to bacterium
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0015031protein transport
GO:0016192vesicle-mediated transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 30..46
score: 31.51
coord: 110..123
score: 48.7
coord: 145..167
score: 43.27
coord: 7..28
score: 51.71
coord: 48..70
score: 47.0
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 7..170
e-value: 8.0E-93
score: 324.4
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 4..170
e-value: 5.0E-31
score: 119.1
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 12..208
e-value: 4.8E-5
score: 22.6
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 9..170
e-value: 5.2E-10
score: 9.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..187
e-value: 4.0E-65
score: 220.9
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 3..182
NoneNo IPR availablePROSITEPS51419RABcoord: 2..210
score: 33.864
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 8..162
e-value: 5.1E-31
score: 105.6
IPR001806Small GTPasePFAMPF00071Rascoord: 8..168
e-value: 4.0E-58
score: 195.6
IPR030702Ras-related protein Rab14PANTHERPTHR24073:SF1098coord: 3..182
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..181