SMED30000978

Overview
NameSMED30000978
Smed IDSMED30000978
Length (bp)1481
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000978 (SMED30000978) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000978 (SMED30000978) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000978 (SMED30000978) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000978 (SMED30000978) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000978h1SMcG0019368 dd_Smed_v4_32425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000978h1SMcG0019368 dd_Smed_v4_32425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000978h1SMcG0019368 dd_Smed_v4_32425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000978h1SMcG0019368 dd_Smed_v6_32425_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000978 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000268:186287..187767 -7405
Homology
BLAST of SMED30000978 vs. TrEMBL
Match: A0A2P8YAJ6 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Blattella germanica OX=6973 GN=C0J52_09872 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.163e-10
Identity = 65/255 (25.49%), Postives = 120/255 (47.06%), Query Frame = 2
Query:  698 STVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKK---YISIGFILSLMTIIFGVALD---FNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIF-SYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEV 1441
            S VFL   +  +A + +L +  GKN+    + L+    + ++ + L+T  + C +V    H+F LA SF  +L M    +R + L  +E   RV  G + +K   Y +  + +  + ++  +A D    +++S    P +    CW    Y  +++  VPLA+   +N++ F S  + +F   S  R    S +++       LAL   L  +V +I  +L +   E  + + I  L  LQG+F+ L F   ++V
Sbjct:  474 SVVFLILHLTAFALLPELRNLSGKNLACLCVSLLAAYCAFIIGQFLETGRVPCTVVAVVTHYFFLA-SFSWMLTMAFDVWRTLRLATSE--LRVSAGKQWRKFAVYSTWSWAVPAIFVVAAIATDNAPSDAVSPDFRPEFGLETCWFSHRYALLVFFAVPLALVMILNIAFFSSSAHMIFSTTSTTRFTSSSGTQRDFRLYIRLALVMGLTWTVGLIAGYLNV---EGLWYTFI-ALNTLQGLFIFLAFTCTEKV 721          
BLAST of SMED30000978 vs. TrEMBL
Match: A0A2J7PD90 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G07085 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.907e-9
Identity = 67/255 (26.27%), Postives = 116/255 (45.49%), Query Frame = 2
Query:  698 STVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKK---YISIGFILSLMTIIFGVALD---FNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIF-SYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEV 1441
            S +FL   +  +  + +L +  GKN+ S    L+      +V + L+  +  C  V     +F LA SF  +L M    +R + L  +E   RV  G + +K   Y S  ++   + ++  VA D     S+     PG+  RNCW    Y  +++  +PLA+   +N++ F S  + +F   S  R    S +++       LAL   L  +V +I  +L +   E  + + I  L  LQG+F+ L F   ++V
Sbjct:  475 SIIFLVLHLTAFILLPELRNLSGKNLASLCFSLLAAYTVFIVGQFLEVGSGSCSAVAVVTQYFFLA-SFSWMLTMAFDVWRTLRLATSE--LRVSAGKQWRKFAFYSSWTWMAPAVFVVAAVATDCAPTGSVLQDFRPGFGVRNCWFSHRYALLVFFALPLALVMILNIAFFSSSAHMIFSTTSTARFTSSSGTQRDFRLYIRLALVMGLTWTVGLIAGYLNV---EGLWYTFI-ALNTLQGLFIFLAFTCTEKV 722          
BLAST of SMED30000978 vs. TrEMBL
Match: A0A067R7S8 (G-protein coupled receptor Mth2 OS=Zootermopsis nevadensis OX=136037 GN=L798_06829 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.005e-8
Identity = 64/255 (25.10%), Postives = 118/255 (46.27%), Query Frame = 2
Query:  698 STVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKK---YISIGFILSLMTIIFGVALDF---NSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIF-SYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEV 1441
            S +FL   +  +  + +L +  GKN+ S  + L+      +V + L+  +  C +V     +F LA SF  +L M    +R + L  +E   RV  G + +K   Y +  ++  L+ ++  +A D     S+     P +  +NCW    Y  +++  +PLA+   +N++ F S  + +F   S  R    S +++       LAL   L  +V +I  +L +   E  + + I  L  LQG+F+ L F   ++V
Sbjct:  484 SIIFLLLHLTAFMLLAELRNLSGKNLASLCVSLLAAYTVFIVGQFLEVGSESCSVVAVVTQYFFLA-SFSWMLTMAFDVWRTLRLATSE--LRVSAGEQWRKFALYSTWTWMAPLVFVVAAIATDSAYEGSVVQDFRPAFGVKNCWFSHRYALLVFFALPLALVMVLNIAFFSSSAHMIFSTTSTTRFTSSSGTQRDFRLYIRLALVMGLTWTVGLIAGYLNV---EGLWYTFI-ALNTLQGLFIFLAFTCTEKV 731          
BLAST of SMED30000978 vs. TrEMBL
Match: E0VM40 (Class B secretin-like G-protein coupled receptor GPRmth5, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8229835 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 8.354e-7
Identity = 68/264 (25.76%), Postives = 119/264 (45.08%), Query Frame = 2
Query:  698 STVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGL-HFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYI--SI-GFILSLMTIIFGVALDFN---SISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIF-SYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIKTLV 1465
            S VFL   ++ +  +  L +  GKN+ S  + L+L +IS +  + + T T  C    +G+  ++    SF  +L M    +R +++   E   RV  G + KK+I  SI  ++  L+ +I  V  D +   +++  + P +   +CW       +I+   P A+    N+  F S  + +F   S  R     S+++       LAL   L     +   +L I   +  + S I  L  LQG+F+ L F  N +V   IK L+
Sbjct:  466 SIVFLVLHLLAFLVVPDLQNLSGKNLASLCVALLLANISFISGQRITTGTRSC--AASGIVTYYGYLASFFWMLTMAFDIWRTLKIATFE--LRVSSGKQWKKFIVYSIWSWMAPLILMIAAVVTDISPSGTVNVYIRPFFGVHSCWFGHRQALLIFFAAPFAVIMIANIGFFASSAHMIFSTTSTTRYTASGSTQRDFRLYIRLALVMGLTWLTGLFAGYLDI---DALWYSFI-ALNTLQGLFIFLAFTCNDKVIRTIKELI 721          
BLAST of SMED30000978 vs. TrEMBL
Match: R7URJ0 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_216805 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.346e-6
Identity = 53/251 (21.12%), Postives = 113/251 (45.02%), Query Frame = 2
Query:  692 VASTVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFILSLMTIIFGVALDFNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLS-IFSYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEV 1441
            V S V L   +++Y+   KL +  G NI+S S CL++  +  +       +   C  +   +H+F LA      ++   I    ++  K    +  ++  +  +Y    F+++L+ ++  +  +F        P Y +  CW+ +    I++   P+A+  T NL   F  ++ + K    ++  + +++KK     FWL +K + I+ +  +  F+   F+ +    L  +   LQG  +   F++ K+V
Sbjct:  456 VISIVCLSVHLLVYSMFRKLRNLAGLNIMSLSGCLLIAQLLFLFAGSASASYSWCFSIGVLVHYFFLASFLWMNVMAFDICRTFVKFSKPSARDDFLQ--KFLRYCVYCFLVALLIVLSAIVANFTLGDSLYRPAYGEDICWIKNRKALIVFFAAPVAVIVTSNLVYFFITLWSIQKSMEASK--MATNNKKGDRDRFWLYVKLSTIMGLTWVFGFVAAIFDVDVLWYLFIIFNSLQGAMICFAFVMTKQV 702          
BLAST of SMED30000978 vs. Planmine SMEST
Match: SMESG000067131.1 (SMESG000067131.1)

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 488/488 (100.00%), Postives = 488/488 (100.00%), Query Frame = 2
Query:    2 FFSFXXXXXXXXXXXXXXXXXXFNSTEICFNERLNCYCDKNCKNYGNCCTNKTRKADKIFTTCLSINFQHKFNQKKNFSSDFFRFLCEKNQSLYEYYLPILKEKIFDPIQLCWVCISEKKANSLEENIFVNCLENNCLLSTKSMETFRKTCYQKLRSKCKWILSKGSNPLKPKPPKEYCKENQTIGCLQTPNKALSILKGNGQNLTIWKSKIKTPYKVTNWELLIRSNCSVASTVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFILSLMTIIFGVALDFNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIFSYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIKTLV 1465
            FFSFILALNLLLNLISTSQLRLFNSTEICFNERLNCYCDKNCKNYGNCCTNKTRKADKIFTTCLSINFQHKFNQKKNFSSDFFRFLCEKNQSLYEYYLPILKEKIFDPIQLCWVCISEKKANSLEENIFVNCLENNCLLSTKSMETFRKTCYQKLRSKCKWILSKGSNPLKPKPPKEYCKENQTIGCLQTPNKALSILKGNGQNLTIWKSKIKTPYKVTNWELLIRSNCSVASTVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFILSLMTIIFGVALDFNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIFSYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIKTLV
Sbjct:    2 FFSFILALNLLLNLISTSQLRLFNSTEICFNERLNCYCDKNCKNYGNCCTNKTRKADKIFTTCLSINFQHKFNQKKNFSSDFFRFLCEKNQSLYEYYLPILKEKIFDPIQLCWVCISEKKANSLEENIFVNCLENNCLLSTKSMETFRKTCYQKLRSKCKWILSKGSNPLKPKPPKEYCKENQTIGCLQTPNKALSILKGNGQNLTIWKSKIKTPYKVTNWELLIRSNCSVASTVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGSFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFILSLMTIIFGVALDFNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIFSYIYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIKTLV 489          
BLAST of SMED30000978 vs. Planmine SMEST
Match: SMESG000033614.1 (SMESG000033614.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.036e-12
Identity = 64/264 (24.24%), Postives = 117/264 (44.32%), Query Frame = 2
Query:  698 STVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYS-ISHVVIRILKTNTIQCRIVVAGLHFFQLAG----SFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFI--LSLMTIIFGVAL---DFNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIFSYI-YKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIK 1456
            S V LFF I++Y +     +  G   I  SICL L + +S +V       +  C+ +    HF  L+     +   + L+ T G +   + KN          R  K   I FI   ++   + G+++    F+  +  + P Y   +CW  S +G +IW  +P+ +    N+    ++ Y++FK A   RI+    +   + S  WL ++   +  V  ++  + I  + N   SL  ++  LQG  L+L F+  K V+  ++
Sbjct:  293 SLVSLFFLIILYLTHQVFKNLGGYLTICLSICLWLINFMSLLVTNTQIVKSASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKSASINKN----------RGWKTFCIYFICVFAVSGCVVGISVIIEYFDKTNSTLRPQYGGPHCWFTSKFGGLIWYFIPVCLLLLWNIITCGFVFYQLFKTAKECRII----NNNDLNSTLWLCMRLTAVFGVGYVLQIIAIFTQLNILISLGSMVNCLQGFMLTLCFVCTKRVRSQLR 542          
BLAST of SMED30000978 vs. Planmine SMEST
Match: SMESG000033615.1 (SMESG000033615.1)

HSP 1 Score: 64.3142 bits (155), Expect = 7.858e-11
Identity = 63/260 (24.23%), Postives = 112/260 (43.08%), Query Frame = 2
Query:  698 STVFLFFCIVIYASIDKLYDEVGKNIISTSICLMLYS-ISHVVIRILKTNTIQCRIVVAGLHFFQLAG----SFQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFILSLMTIIFGVALD-FNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIFSYI-YKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISFEENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIK 1456
            S V LFF I++Y +     +  G   I  SICL L + +S +V       +  C+ +    HF  L+     +   + L+ T G +++   K   ++          Y  IGF  S   +   V  + F+  +  + P Y    CW  S +G +I+  +P+ +    N  + S++ Y++FK A   RI+     KK   S  WL ++   +  V  ++    I  +     SL  ++  LQG  L+L F+  K  +  ++
Sbjct:  136 SLVSLFFLIILYLTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSF------SVYCLIGFSTSGSVVGISVITEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIV----KKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLR 385          
The following BLAST results are available for this feature:
BLAST of SMED30000978 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P8YAJ68.163e-1025.49G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A2J7PD901.907e-926.27G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A067R7S82.005e-825.10G-protein coupled receptor Mth2 OS=Zootermopsis ne... [more]
E0VM408.354e-725.76Class B secretin-like G-protein coupled receptor G... [more]
R7URJ02.346e-621.12G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
back to top
BLAST of SMED30000978 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000978 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000067131.10.000e+0100.00SMESG000067131.1[more]
SMESG000033614.11.036e-1224.24SMESG000033614.1[more]
SMESG000033615.17.858e-1124.23SMESG000033615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000978 ID=SMED30000978|Name=SMED30000978|organism=Schmidtea mediterranea sexual|type=transcript|length=1481bp
GTTTTTCTCATTTATTTTAGCTCTTAATCTTTTATTAAATTTAATTTCAA
CTTCTCAACTCAGGTTATTCAACTCGACAGAGATTTGTTTTAATGAGCGT
TTGAATTGTTATTGTGACAAAAATTGCAAAAACTATGGAAATTGCTGTAC
AAATAAAACTCGAAAAGCCGACAAAATTTTCACGACTTGTTTGAGCATAA
ATTTTCAACATAAATTTAATCAAAAAAAAAATTTTTCCTCCGATTTTTTT
CGATTTCTCTGCGAGAAAAACCAATCGCTCTACGAATATTATTTACCAAT
TTTAAAAGAAAAAATCTTCGATCCCATTCAACTTTGTTGGGTCTGCATTT
CAGAAAAGAAGGCAAATTCTTTGGAAGAAAACATTTTCGTAAATTGCCTC
GAAAACAATTGTTTATTGTCAACAAAATCTATGGAAACGTTTCGGAAAAC
CTGCTACCAAAAACTTAGAAGTAAATGCAAATGGATCCTTTCAAAGGGTT
CCAATCCCTTGAAACCAAAACCCCCCAAAGAGTATTGTAAAGAAAATCAA
ACTATTGGCTGCTTACAAACTCCAAACAAAGCCCTGTCCATCTTGAAGGG
AAACGGTCAAAACCTCACCATATGGAAATCCAAAATTAAAACCCCATACA
AAGTTACAAACTGGGAACTGTTGATAAGATCGAATTGTTCTGTGGCATCG
ACGGTATTTTTGTTTTTCTGCATTGTGATATATGCTAGCATTGATAAGCT
GTATGATGAGGTTGGGAAAAATATCATTTCGACATCCATTTGTCTCATGC
TCTATTCGATTTCCCATGTTGTCATTAGGATTCTCAAAACCAACACAATT
CAATGCCGAATTGTGGTGGCGGGGCTGCATTTTTTCCAACTGGCTGGGTC
ATTTCAAGGGGTCCTACTTATGGTAACCATCGGATATCGAGTGATTGAGC
TGAAAAAAAACGAGGATATCGAAAGAGTTGTCAAAGGAAACAGAAACAAA
AAATATATTTCAATAGGATTTATTCTTTCTCTGATGACAATTATTTTTGG
AGTGGCTCTAGATTTTAATTCCATTTCTCACAAGGTCACTCCTGGGTATT
GTCAACGCAACTGTTGGCTGGACAGCTATTATGGGGCCATAATTTGGCTG
ATAGTTCCTCTAGCAATGGCGGAAACGATAAATCTGTCAATATTTTCCTA
TATTTATAAAGTTTTCAAAGATGCCTCCAACAACCGAATACTTTTGCCGA
GCAGTTCCAAAAAACCAATTGAAAGCATTTTCTGGCTTGCATTGAAATAT
AATCTCATCATTTCAGTTATGATAATCGTTGATTTTCTGAAAATATCTTT
CGAAGAAAACTTTTTTGGGTCTTTAATAAGAGTTCTTGCTCGCTTGCAAG
GCGTATTTCTTTCACTGATCTTCTTGATTAACAAGGAAGTTCAAATTGCG
ATTAAAACTTTAGTTTGATCGTTTTACTGGT
back to top

protein sequence of SMED30000978-orf-1

>SMED30000978-orf-1 ID=SMED30000978-orf-1|Name=SMED30000978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
FFSFILALNLLLNLISTSQLRLFNSTEICFNERLNCYCDKNCKNYGNCCT
NKTRKADKIFTTCLSINFQHKFNQKKNFSSDFFRFLCEKNQSLYEYYLPI
LKEKIFDPIQLCWVCISEKKANSLEENIFVNCLENNCLLSTKSMETFRKT
CYQKLRSKCKWILSKGSNPLKPKPPKEYCKENQTIGCLQTPNKALSILKG
NGQNLTIWKSKIKTPYKVTNWELLIRSNCSVASTVFLFFCIVIYASIDKL
YDEVGKNIISTSICLMLYSISHVVIRILKTNTIQCRIVVAGLHFFQLAGS
FQGVLLMVTIGYRVIELKKNEDIERVVKGNRNKKYISIGFILSLMTIIFG
VALDFNSISHKVTPGYCQRNCWLDSYYGAIIWLIVPLAMAETINLSIFSY
IYKVFKDASNNRILLPSSSKKPIESIFWLALKYNLIISVMIIVDFLKISF
EENFFGSLIRVLARLQGVFLSLIFLINKEVQIAIKTLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000832GPCR_2_secretin-like
IPR017981GPCR_2-like
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 218..488
e-value: 2.0E-17
score: 65.0
NoneNo IPR availablePANTHERPTHR45902FAMILY NOT NAMEDcoord: 230..484
NoneNo IPR availablePANTHERPTHR45902:SF1coord: 230..484
NoneNo IPR availableCDDcd139527tm_classBcoord: 229..484
e-value: 1.17196E-15
score: 74.5619
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.784
NoneNo IPR availableTMHMMTMhelixcoord: 455..477
NoneNo IPR availableTMHMMTMhelixcoord: 423..445
NoneNo IPR availableTMHMMTMhelixcoord: 258..278
NoneNo IPR availableTMHMMTMhelixcoord: 223..245
NoneNo IPR availableTMHMMTMhelixcoord: 293..315
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
NoneNo IPR availableTMHMMTMhelixcoord: 336..358
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 231..469
e-value: 1.5E-5
score: 24.4
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 222..478
score: 10.543