Phosphomannomutase

Overview
NamePhosphomannomutase
Smed IDSMED30000977
Length (bp)1099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphomannomutase (SMED30000977) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphomannomutase (SMED30000977) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphomannomutase (SMED30000977) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphomannomutase (SMED30000977) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000977

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000977SMESG000079671.1 SMESG000079384.1 dd_Smed_v4_1964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000977SMESG000079671.1 SMESG000079384.1 dd_Smed_v4_1964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000977SMESG000079671.1 SMESG000079384.1 dd_Smed_v4_1964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000977SMESG000079671.1 SMESG000079384.1 dd_Smed_v4_1964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphomannomutase vs. Ensembl Human
Match: PMM2 (phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:9115])

HSP 1 Score: 282.337 bits (721), Expect = 5.209e-94
Identity = 134/241 (55.60%), Postives = 182/241 (75.52%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
              +CLFD+DGTLT  R  I  +M +FL KL++++KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+C+ NI   LGE  +Q+ INY L Y+++I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+   +R K +ADL+ +F   GL+F+IGGQISFDVFP+GWDKRY LR+V++D +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR    LF
Sbjct:    6 PALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLF 245          
BLAST of Phosphomannomutase vs. Ensembl Human
Match: PMM2 (phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:9115])

HSP 1 Score: 258.07 bits (658), Expect = 6.224e-85
Identity = 123/219 (56.16%), Postives = 168/219 (76.71%), Query Frame = 3
Query:  198 MLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            M +FL KL++++KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+C+ NI   LGE  +Q+ INY L Y+++I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+   +R K +ADL+ +F   GL+F+IGGQISFDVFP+GWDKRY LR+V++D +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR    LF
Sbjct:    1 MDDFLQKLRQKIKIGVVGGSDFEKVQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLF 218          
BLAST of Phosphomannomutase vs. Ensembl Human
Match: PMM1 (phosphomannomutase 1 [Source:HGNC Symbol;Acc:HGNC:9114])

HSP 1 Score: 256.914 bits (655), Expect = 6.213e-84
Identity = 125/240 (52.08%), Postives = 168/240 (70.00%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDN-LKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +CLFD+DGTLT +R  I  ++  FL KL+ +V+IG+VGGSD+ KI EQLG  D  ++K +YVF+ENG + +K+G L+ K  I   LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+NISPIGR+C+  ER EF + D+  K+R+K +  LK +F   GL F+ GG ISFDVFPEGWDKRY L  + +D F TIHFFG+ T  GGND+ I  D   +GH V  P DT ++  E+F
Sbjct:   15 LCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIF 254          
BLAST of Phosphomannomutase vs. Ensembl Human
Match: PMM2 (phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:9115])

HSP 1 Score: 164.851 bits (416), Expect = 1.398e-49
Identity = 78/140 (55.71%), Postives = 108/140 (77.14%), Query Frame = 3
Query:  147 FDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDR 566
            FD+DGTLT  R  I  +M +FL KL++++KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+C+ NI   LGE  +Q+ INY L Y+++I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+
Sbjct:    2 FDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDK 140          
BLAST of Phosphomannomutase vs. Ensembl Human
Match: PMM2 (phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:9115])

HSP 1 Score: 115.931 bits (289), Expect = 1.073e-30
Identity = 54/93 (58.06%), Postives = 71/93 (76.34%), Query Frame = 3
Query:  576 VRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +R K +ADL+ +F   GL+F+IGGQISFDVFP+GWDKRY LR+V++D +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR    LF
Sbjct:   62 IRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLF 154          

HSP 2 Score: 71.633 bits (174), Expect = 1.728e-14
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKK-----IEYVFSENGLIYHKNGEL 362
              +CLFD+DGTLT  R  I  +M +FL KL++++KIG+VGGSDF K+ EQLG  +N+++     +   F+  GL +   G++
Sbjct:    6 PALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDENIRQKFVADLRKEFAGKGLTFSIGGQI 87          
BLAST of Phosphomannomutase vs. Ensembl Celegans
Match: F52B11.2 (Probable phosphomannomutase [Source:UniProtKB/Swiss-Prot;Acc:Q9XUE6])

HSP 1 Score: 261.151 bits (666), Expect = 5.127e-86
Identity = 127/244 (52.05%), Postives = 165/244 (67.62%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDN---LKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            + TI +FD+DGTLT +R  I  +M EFL + +K+V + IVGGSDF KI EQL   D    L   +Y FSENGL   K  E     +I + +G+  LQ  IN++L+Y+S I LP+KRG FVE+R GMIN+SPIGR+CSQ ER +F ++D+ H +R K    L+ KFG  GL FAIGGQIS DVFP GWDK + L+Y+  DF TIHFFGD+T  GGND+ I  DE  +GH V GP+DTR+ +  + 
Sbjct:    7 SRTILVFDVDGTLTAARQTITPEMREFLIEARKRVPLAIVGGSDFKKITEQLADHDKDLLLSLFDYTFSENGLYGFKGTEPYPVQSIQKAIGDAKLQELINFALRYMSDIQLPVKRGNFVEFRNGMINLSPIGRSCSQEERMQFVEFDKKHGIRQKFTEQLREKFGQYGLQFAIGGQISVDVFPTGWDKTFCLQYLVPDFDTIHFFGDKTAPGGNDHEIFADERTVGHTVEGPEDTRKHVENVL 250          
BLAST of Phosphomannomutase vs. Ensembl Celegans
Match: F52B11.2 (Probable phosphomannomutase [Source:UniProtKB/Swiss-Prot;Acc:Q9XUE6])

HSP 1 Score: 236.498 bits (602), Expect = 7.399e-77
Identity = 116/220 (52.73%), Postives = 149/220 (67.73%), Query Frame = 3
Query:  198 MLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDN---LKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSEL 848
            M EFL + +K+V + IVGGSDF KI EQL   D    L   +Y FSENGL   K  E     +I + +G+  LQ  IN++L+Y+S I LP+KRG FVE+R GMIN+SPIGR+CSQ ER +F ++D+ H +R K    L+ KFG  GL FAIGGQIS DVFP GWDK + L+Y+  DF TIHFFGD+T  GGND+ I  DE  +GH V GP+DTR+ +  +
Sbjct:    1 MREFLIEARKRVPLAIVGGSDFKKITEQLADHDKDLLLSLFDYTFSENGLYGFKGTEPYPVQSIQKAIGDAKLQELINFALRYMSDIQLPVKRGNFVEFRNGMINLSPIGRSCSQEERMQFVEFDKKHGIRQKFTEQLREKFGQYGLQFAIGGQISVDVFPTGWDKTFCLQYLVPDFDTIHFFGDKTAPGGNDHEIFADERTVGHTVEGPEDTRKHVENV 220          
BLAST of Phosphomannomutase vs. Ensembl Fly
Match: Pmm2 (gene:FBgn0036300 transcript:FBtr0075961)

HSP 1 Score: 254.988 bits (650), Expect = 1.652e-83
Identity = 124/244 (50.82%), Postives = 172/244 (70.49%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFL-AKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKD--DFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +  + LFD+DGTLT  R+V+  +  EF  ++++ +  IGIVGGSD  K+ EQL G   L + +++F ENGL+  + G+ V K NI+  LGEE ++ FIN+ L+YLS + +PIKRGTF+E+R GM+N+ PIGR C++ ER+ F +YD  HKVR+KMI DLK +F ++ L+++IGGQISFDVFP GWDK Y LR+++    FK IHFFGD+T  GGNDY I  D   I H V  P DT+R L+E+ 
Sbjct:    9 DEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQLNGRKILNEFDFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNVCPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEIL 252          
BLAST of Phosphomannomutase vs. Ensembl Zebrafish
Match: pmm2 (phosphomannomutase 2 [Source:ZFIN;Acc:ZDB-GENE-030722-6])

HSP 1 Score: 276.944 bits (707), Expect = 4.351e-92
Identity = 137/242 (56.61%), Postives = 179/242 (73.97%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            ++T+CLFD+DGTLT +R     DM EFL+KL+++VK+G+VGGSD  KI EQLG  D + +++YVF+ENGL+ ++ G+L    NI   LGE+ LQ FIN+ L YLS+I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+  K+R+  ++ LK +F   GL+F+IGGQISFDVFPEGWDKRY L  V KD ++ IHFFGD+T  GGNDY I  D   IGH V  P+DT+R   ELF
Sbjct:    8 STTLCLFDVDGTLTAARQKATADMHEFLSKLKQRVKVGVVGGSDLDKIKEQLGD-DVIDRVDYVFAENGLVAYRFGKLHSVQNIQAYLGEDILQEFINFCLNYLSKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQQERIEFFELDKKEKIRETFVSVLKEEFAGKGLAFSIGGQISFDVFPEGWDKRYCLGIVEKDSYQHIHFFGDKTMPGGNDYEIFVDPRTIGHEVKSPEDTQRICRELF 248          
BLAST of Phosphomannomutase vs. Ensembl Zebrafish
Match: pmm1 (phosphomannomutase 1 [Source:ZFIN;Acc:ZDB-GENE-180314-1])

HSP 1 Score: 176.407 bits (446), Expect = 1.954e-53
Identity = 87/174 (50.00%), Postives = 123/174 (70.69%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDN-LKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQ 650
            + +CLFD+DGTLT  R  I  ++ +F+  L+++VKIG+VGGSD+ KI EQLG  D  ++K +YVF+ENG + +K+G+L+ K  I   LGEE LQ  IN+ L Y+  I LP KRGTF+E+R+G+INISPIGR+C+  ER EF + D+  K+R+K +A L+ +F   GL F  G Q
Sbjct:   12 NVLCLFDVDGTLTAPREKIDPELDDFIQALKQKVKIGVVGGSDYCKIAEQLGDGDEVIQKFDYVFAENGTVQYKDGKLIFKQAIQNHLGEELLQELINFCLSYMGLIKLPKKRGTFIEFRSGVINISPIGRSCTLEERIEFSEIDKREKIREKFVAALQKEFAGKGLRFTRGKQ 185          
BLAST of Phosphomannomutase vs. Ensembl Zebrafish
Match: CABZ01117706.1 (pep chromosome:GRCz11:3:4997545:4998034:1 gene:ENSDARG00000115870.1 transcript:ENSDART00000181237.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01117706.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.064e-16
Identity = 36/71 (50.70%), Postives = 45/71 (63.38%), Query Frame = 3
Query:  642 GGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            GG ISFD+FPEGWDKR  L  ++ +   TI+FFG+ T  GGNDY I  D   +G  V+ P DT R   E+F
Sbjct:    1 GGLISFDIFPEGWDKRLCLDVLEQEGLDTIYFFGNETSLGGNDYEIFEDPRTVGFSVSCPADTARLCREMF 71          
BLAST of Phosphomannomutase vs. Ensembl Xenopus
Match: pmm1 (phosphomannomutase 1 [Source:NCBI gene;Acc:100127589])

HSP 1 Score: 275.018 bits (702), Expect = 3.771e-91
Identity = 132/239 (55.23%), Postives = 179/239 (74.90%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +CLFD+DGTLT +R  +  DM EFL +L+K+VK+G+VGGSDF KI EQLG  D ++K +YVF+ENGL+ +K+G+ +CK +I   LGE+ LQ+ INY L Y++++ LP KRGTFVE+R GM+N+SPIGRNC+Q ER EF + D+  + RDK +A+L+ +F   GL+F+IGGQISFDVFP GWDK + L  ++++ F  I+FFGD+T  GGNDY I  D   IGH VT P +TR   +ELF
Sbjct:   11 LCLFDVDGTLTAARQKVTKDMAEFLEELRKRVKVGVVGGSDFEKIKEQLGD-DVVEKFDYVFAENGLVAYKDGKFLCKQSIHAHLGEDLLQDIINYCLSYIAKLKLPKKRGTFVEFRNGMLNVSPIGRNCTQEERIEFYELDKKEQFRDKFVAELQREFSGRGLTFSIGGQISFDVFPTGWDKTFCLGILENEGFSKIYFFGDKTMPGGNDYEIYTDSRTIGHSVTSPGETRTICTELF 248          
BLAST of Phosphomannomutase vs. Ensembl Xenopus
Match: pmm2 (phosphomannomutase 2 [Source:NCBI gene;Acc:100216238])

HSP 1 Score: 253.832 bits (647), Expect = 9.360e-83
Identity = 121/240 (50.42%), Postives = 170/240 (70.83%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNL-KKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +CLFD+DGTLT +R  +   + +FL +L+++VKIG+VGGSD++KI EQLG  D +  K +Y+F+ENG + +K+G+L+ +  I   LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+NISPIGR+C+Q ER EF + D+  ++R+K +A L+ +F   GL F  GG ISFD+FPEGWDKR  L  +  + F +IHFFG+ T  GGNDY I  D   IGH V  P+DT ++  ELF
Sbjct:   15 LCLFDVDGTLTPAREKVDPAVDQFLQELRQRVKIGVVGGSDYSKIAEQLGEGDQVVSKFDYIFAENGTVQYKDGKLLARQAIQNHLGEELLQDLINFCLMYIALLKLPKKRGTFIEFRNGMLNISPIGRSCTQEERIEFNELDKKERIREKFVAALQREFAGKGLRFTRGGMISFDIFPEGWDKRCCLEVLAAEQFSSIHFFGNETTPGGNDYEIYSDPRTIGHTVVSPEDTVKRCQELF 254          
BLAST of Phosphomannomutase vs. Ensembl Xenopus
Match: pmm2 (phosphomannomutase 2 [Source:NCBI gene;Acc:100216238])

HSP 1 Score: 253.832 bits (647), Expect = 1.240e-82
Identity = 121/240 (50.42%), Postives = 170/240 (70.83%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNL-KKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +CLFD+DGTLT +R  +   + +FL +L+++VKIG+VGGSD++KI EQLG  D +  K +Y+F+ENG + +K+G+L+ +  I   LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+NISPIGR+C+Q ER EF + D+  ++R+K +A L+ +F   GL F  GG ISFD+FPEGWDKR  L  +  + F +IHFFG+ T  GGNDY I  D   IGH V  P+DT ++  ELF
Sbjct:   13 LCLFDVDGTLTPAREKVDPAVDQFLQELRQRVKIGVVGGSDYSKIAEQLGEGDQVVSKFDYIFAENGTVQYKDGKLLARQAIQNHLGEELLQDLINFCLMYIALLKLPKKRGTFIEFRNGMLNISPIGRSCTQEERIEFNELDKKERIREKFVAALQREFAGKGLRFTRGGMISFDIFPEGWDKRCCLEVLAAEQFSSIHFFGNETTPGGNDYEIYSDPRTIGHTVVSPEDTVKRCQELF 252          
BLAST of Phosphomannomutase vs. Ensembl Xenopus
Match: pmm2 (phosphomannomutase 2 [Source:NCBI gene;Acc:100216238])

HSP 1 Score: 233.032 bits (593), Expect = 2.524e-74
Identity = 111/218 (50.92%), Postives = 155/218 (71.10%), Query Frame = 3
Query:  204 EFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNL-KKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +FL +L+++VKIG+VGGSD++KI EQLG  D +  K +Y+F+ENG + +K+G+L+ +  I   LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+NISPIGR+C+Q ER EF + D+  ++R+K +A L+ +F   GL F  GG ISFD+FPEGWDKR  L  +  + F +IHFFG+ T  GGNDY I  D   IGH V  P+DT ++  ELF
Sbjct:   55 QFLQELRQRVKIGVVGGSDYSKIAEQLGEGDQVVSKFDYIFAENGTVQYKDGKLLARQAIQNHLGEELLQDLINFCLMYIALLKLPKKRGTFIEFRNGMLNISPIGRSCTQEERIEFNELDKKERIREKFVAALQREFAGKGLRFTRGGMISFDIFPEGWDKRCCLEVLAAEQFSSIHFFGNETTPGGNDYEIYSDPRTIGHTVVSPEDTVKRCQELF 272          
BLAST of Phosphomannomutase vs. Ensembl Mouse
Match: Pmm2 (phosphomannomutase 2 [Source:MGI Symbol;Acc:MGI:1859214])

HSP 1 Score: 276.559 bits (706), Expect = 4.664e-92
Identity = 134/241 (55.60%), Postives = 179/241 (74.27%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +T+CLFD+DGTLT  R  I  +M  FL KL+++ KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+CK NI   LGE+ +Q+ INY L Y++ I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+   +R K +ADL+ +F   GL+F+IGGQIS DVFPEGWDKRY LR+++   +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR    LF
Sbjct:    2 ATLCLFDMDGTLTAPRQKITEEMDGFLQKLRQKTKIGVVGGSDFEKLQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCKQNIQGHLGEDVIQDLINYCLSYIANIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKEHIRQKFVADLRKEFAGKGLTFSIGGQISIDVFPEGWDKRYCLRHLEHAGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYTVTAPEDTRRICEGLF 241          
BLAST of Phosphomannomutase vs. Ensembl Mouse
Match: Pmm2 (phosphomannomutase 2 [Source:MGI Symbol;Acc:MGI:1859214])

HSP 1 Score: 276.559 bits (706), Expect = 4.664e-92
Identity = 134/241 (55.60%), Postives = 179/241 (74.27%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +T+CLFD+DGTLT  R  I  +M  FL KL+++ KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+CK NI   LGE+ +Q+ INY L Y++ I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+   +R K +ADL+ +F   GL+F+IGGQIS DVFPEGWDKRY LR+++   +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR    LF
Sbjct:    2 ATLCLFDMDGTLTAPRQKITEEMDGFLQKLRQKTKIGVVGGSDFEKLQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCKQNIQGHLGEDVIQDLINYCLSYIANIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKEHIRQKFVADLRKEFAGKGLTFSIGGQISIDVFPEGWDKRYCLRHLEHAGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYTVTAPEDTRRICEGLF 241          
BLAST of Phosphomannomutase vs. Ensembl Mouse
Match: Pmm1 (phosphomannomutase 1 [Source:MGI Symbol;Acc:MGI:1353418])

HSP 1 Score: 255.373 bits (651), Expect = 1.970e-83
Identity = 124/240 (51.67%), Postives = 169/240 (70.42%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLG-GMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            +CLFD+DGTLT +R  I  ++  FL KL+ +V+IG+VGGSD++KI EQLG G + ++K +YVF+ENG + +K+G L+ K  I   LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+N+SPIGR+C+  ER EF + D+  K+R+K +  LK +F   GL F+ GG ISFDVFPEGWDKRY L  + +D F  IHFFG+ T  GGND+ I  D   +GH V  P DT ++  ELF
Sbjct:   15 LCLFDVDGTLTPARQKIDPEVSAFLQKLRSRVQIGVVGGSDYSKIAEQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSPGGNDFEIYADPRTVGHSVVSPQDTVQRCRELF 254          
BLAST of Phosphomannomutase vs. Ensembl Mouse
Match: Pmm1 (phosphomannomutase 1 [Source:MGI Symbol;Acc:MGI:1353418])

HSP 1 Score: 175.252 bits (443), Expect = 5.847e-53
Identity = 82/155 (52.90%), Postives = 107/155 (69.03%), Query Frame = 3
Query:  390 LGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+N+SPIGR+C+  ER EF + D+  K+R+K +  LK +F   GL F+ GG ISFDVFPEGWDKRY L  + +D F  IHFFG+ T  GGND+ I  D   +GH V  P DT ++  ELF
Sbjct:   40 LGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSPGGNDFEIYADPRTVGHSVVSPQDTVQRCRELF 194          
BLAST of Phosphomannomutase vs. Ensembl Mouse
Match: Pmm1 (phosphomannomutase 1 [Source:MGI Symbol;Acc:MGI:1353418])

HSP 1 Score: 159.458 bits (402), Expect = 1.834e-47
Identity = 76/145 (52.41%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLG-GMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRV 569
            +CLFD+DGTLT +R  I  ++  FL KL+ +V+IG+VGGSD++KI EQLG G + ++K +YVF+ENG + +K+G L+ K  I   LGEE LQ+ IN+ L Y++ + LP KRGTF+E+R GM+N+SPIGR+C+  ER EF + D+V
Sbjct:   15 LCLFDVDGTLTPARQKIDPEVSAFLQKLRSRVQIGVVGGSDYSKIAEQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKV 159          
BLAST of Phosphomannomutase vs. UniProt/SwissProt
Match: sp|Q7XPW5|PMM_ORYSJ (Phosphomannomutase OS=Oryza sativa subsp. japonica OX=39947 GN=PMM PE=2 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 2.496e-96
Identity = 134/238 (56.30%), Postives = 180/238 (75.63%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            + LFD+DGTLT  R V+  +ML+F+ +L++ V +G+VGGSD  KI EQLG        +Y FSENGL+ HKNGEL+   ++   LG++ L+ FIN++L Y++ + +PIKRGTF+E+R+GM+N+SPIGRNCSQ ERDEFEKYD+VH +R KM++ L+ KF +L L+F+IGGQISFDVFP+GWDK Y LRY+ ++F+ IHFFGD+T +GGNDY I   +  IGH VT PDDT  Q   LF
Sbjct:   10 LALFDVDGTLTAPRKVVTPEMLQFMKQLREHVTVGVVGGSDLVKISEQLG-KSVTTDYDYCFSENGLVAHKNGELIGTQSLKSFLGDDQLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKVHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYL-EEFQEIHFFGDKTYKGGNDYEIFESDRTIGHTVTSPDDTAEQCRSLF 245          
BLAST of Phosphomannomutase vs. UniProt/SwissProt
Match: sp|Q259G4|PMM_ORYSI (Phosphomannomutase OS=Oryza sativa subsp. indica OX=39946 GN=PMM PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 2.496e-96
Identity = 134/238 (56.30%), Postives = 180/238 (75.63%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            + LFD+DGTLT  R V+  +ML+F+ +L++ V +G+VGGSD  KI EQLG        +Y FSENGL+ HKNGEL+   ++   LG++ L+ FIN++L Y++ + +PIKRGTF+E+R+GM+N+SPIGRNCSQ ERDEFEKYD+VH +R KM++ L+ KF +L L+F+IGGQISFDVFP+GWDK Y LRY+ ++F+ IHFFGD+T +GGNDY I   +  IGH VT PDDT  Q   LF
Sbjct:   10 LALFDVDGTLTAPRKVVTPEMLQFMKQLREHVTVGVVGGSDLVKISEQLG-KSVTTDYDYCFSENGLVAHKNGELIGTQSLKSFLGDDQLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKVHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYL-EEFQEIHFFGDKTYKGGNDYEIFESDRTIGHTVTSPDDTAEQCRSLF 245          
BLAST of Phosphomannomutase vs. UniProt/SwissProt
Match: sp|Q60HD6|PMM2_MACFA (Phosphomannomutase 2 OS=Macaca fascicularis OX=9541 GN=PMM2 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 7.198e-95
Identity = 135/241 (56.02%), Postives = 183/241 (75.93%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
              +CLFD+DGTLT  R  I  +M +FL KL++++KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+CK NI   LGE  +Q+ INY L Y++++ LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+   +R K +ADL+ +F   GL+F+IGGQISFDVFP+GWDKRY LR+V++D +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR   ELF
Sbjct:    6 PALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCKQNIQSHLGEALIQDLINYCLSYIAKVKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYSVTAPEDTRRICEELF 245          
BLAST of Phosphomannomutase vs. UniProt/SwissProt
Match: sp|Q1W374|PMM_WHEAT (Phosphomannomutase OS=Triticum aestivum OX=4565 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 5.178e-94
Identity = 131/238 (55.04%), Postives = 182/238 (76.47%), Query Frame = 3
Query:  138 ICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            + LFD+DGTLT  R  +  +MLEF+ +L++ V +G+VGGSD  KI EQLG    +   +YVFSENGL+ HK+G+L+   ++   LG++ L+ FIN++L Y++ + +PIKRGTF+E+R+GMIN+SPIGRNCSQ ERD+FEKYD+VH VR KM++ L+ KF +L L+F+IGGQISFDVFP+GWDK Y LRY+ ++FK IHFFGD+T +GGND+ I   +  +GH VT P+DT +Q   +F
Sbjct:   11 LALFDVDGTLTAPRKEVTPEMLEFMKRLRENVTVGVVGGSDLVKISEQLG-KSVITDYDYVFSENGLVAHKDGKLIGTQSLKTYLGDDQLKEFINFTLHYIADLDIPIKRGTFIEFRSGMINVSPIGRNCSQEERDDFEKYDKVHNVRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYL-EEFKEIHFFGDKTYKGGNDHEIFESDRTVGHTVTSPNDTVQQCKSIF 246          
BLAST of Phosphomannomutase vs. UniProt/SwissProt
Match: sp|O15305|PMM2_HUMAN (Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2 PE=1 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.501e-93
Identity = 134/241 (55.60%), Postives = 182/241 (75.52%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
              +CLFD+DGTLT  R  I  +M +FL KL++++KIG+VGGSDF K+ EQLG  D ++K +YVF ENGL+ +K+G+L+C+ NI   LGE  +Q+ INY L Y+++I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+   +R K +ADL+ +F   GL+F+IGGQISFDVFP+GWDKRY LR+V++D +KTI+FFGD+T  GGND+ I  D   +G+ VT P+DTRR    LF
Sbjct:    6 PALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGN-DVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLF 245          
BLAST of Phosphomannomutase vs. TrEMBL
Match: A0A0P4WB28 (Phosphomannomutase OS=Scylla olivacea OX=85551 PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.822e-100
Identity = 137/245 (55.92%), Postives = 191/245 (77.96%), Query Frame = 3
Query:  123 LMNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI 857
            ++  T+CLFD+DGTLT+ R  I+  M EF+ K++++V  G+VGGSD  KI EQ+GG++ L K +YVF+ENGL+ +KNG+ + K +I   +GEE LQ FIN++L+Y+S + LP+KRGTF+E+R G+IN+ P+GR+CSQ ERD+F +YD+VH +R+K +  L+ +F N GL F+IGGQISFDVFP+GWDK Y LRYV++DFKTIHFFGD+T +GGND+ I  D   +GH VT P+DTR QL ++ GI
Sbjct:    3 VLPDTLCLFDVDGTLTQPRKKIEPVMAEFMLKMKEKVPCGLVGGSDLNKIAEQMGGLEALMKFDYVFAENGLVAYKNGQFMKKESIQNHMGEEKLQTFINFALRYMSSLTLPVKRGTFIEFRNGLINVCPVGRSCSQEERDQFGEYDKVHHIREKFVKALEEEFPNSGLVFSIGGQISFDVFPKGWDKTYCLRYVENDFKTIHFFGDKTDKGGNDHEIYEDTRTVGHKVTSPEDTRVQLQKVLGI 247          
BLAST of Phosphomannomutase vs. TrEMBL
Match: A0A1D1VRH8 (Phosphomannomutase OS=Ramazzottius varieornatus OX=947166 GN=RvY_14488-1 PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 2.680e-100
Identity = 144/240 (60.00%), Postives = 185/240 (77.08%), Query Frame = 3
Query:  135 TICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYAL-RYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            TI LFD+DGTLTKSR  I  +M  F+  L+K+V++GIVGGSD AKI EQ+ G +  +K +Y+FSENGL+ +K G+L+ + +I E LGEE LQ+FINY+L+YLS + LP KRGTF+E+R GM+N+ P+GR+C+Q ERD F ++D+VH +RDKM AD + KF   GL F+IGGQIS DVFP+GWDK Y L + VKD +KTIHFFGD+T  GGNDY I  D   IGH VT P+DTRRQ+SELF
Sbjct:   12 TILLFDVDGTLTKSRVTITPEMKAFMEDLRKKVQVGIVGGSDLAKIAEQMSGFEEARKFDYLFSENGLVAYKRGKLIHEVSIQEFLGEEKLQDFINYALRYLSELRLPCKRGTFIEFRKGMLNVCPVGRSCTQAERDAFFEFDKVHGIRDKMAADFRQKFAKDGLVFSIGGQISLDVFPKGWDKTYCLDQLVKDGYKTIHFFGDKTMPGGNDYEIFEDPRTIGHTVTSPEDTRRQVSELF 251          
BLAST of Phosphomannomutase vs. TrEMBL
Match: C3YWF0 (Phosphomannomutase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_113552 PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 5.368e-100
Identity = 139/242 (57.44%), Postives = 189/242 (78.10%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
             ST+CLFD+DGTLT +R  I + M EF+ KL+++V +G+VGGSD  KI EQ+ G D +KK +YVF+ENGL+ +K+G L+ K NI E +GEE LQ+FIN+ LQY+S++ LP+KRGTF+E+R+G+IN+ P+GR+CSQ ER +F +YD+ HK+R+  +A+L+ +F ++GL F+IGGQISFD FP+GWDK Y L +V KD +KTIHFFGD+T  GGND+ I  D   IGH VT PDDTR QL +LF
Sbjct:    6 TSTLCLFDVDGTLTAARQKITSSMEEFMMKLKEKVVVGLVGGSDLVKIAEQMKGEDVVKKFDYVFAENGLVAYKDGGLLAKMNIQEHMGEEKLQSFINFCLQYMSKLTLPVKRGTFIEFRSGLINVCPVGRSCSQEERIQFNQYDQEHKIRETFVAELQKQFPDMGLVFSIGGQISFDAFPKGWDKTYCLNHVEKDGYKTIHFFGDKTMPGGNDHEIFADPRTIGHTVTSPDDTRAQLEKLF 247          
BLAST of Phosphomannomutase vs. TrEMBL
Match: A0A2P2I7N5 (Phosphomannomutase (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.917e-98
Identity = 140/245 (57.14%), Postives = 183/245 (74.69%), Query Frame = 3
Query:  123 LMNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI 857
            L++ TI LFD+DGTLTK R VI+ +M  F+AK +  V  G+VGGSD  KI EQLGGMD + K  YVF+ENGL+ +K+G L+ K +I   LGE ALQ+FIN+SL Y++ + LP KRGTFVE+R+GMIN+ P+GR+CSQ  R++F  YD+ H VRDK +  L+ KF +LGL+F+IGGQIS D FP GWDK Y L+YV+ ++KTIHF+GD+T +GGND+ I  D   IGH VT P DT+ QLSEL  +
Sbjct:    7 LLSDTIVLFDVDGTLTKPRGVIEAEMASFIAKARGAVACGVVGGSDLCKIAEQLGGMDEVMKFSYVFAENGLVAYKDGILIAKQSIEAQLGEAALQSFINFSLGYMANLELPCKRGTFVEFRSGMINLCPVGRSCSQQIREQFAAYDQEHNVRDKFVEALRKKFPDLGLTFSIGGQISIDAFPTGWDKTYCLQYVEKEYKTIHFYGDKTHKGGNDHEIFSDPRTIGHTVTSPTDTKVQLSELLNL 251          
BLAST of Phosphomannomutase vs. TrEMBL
Match: A0A1S3HCV3 (Phosphomannomutase OS=Lingula unguis OX=7574 GN=LOC106153804 PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.171e-97
Identity = 141/244 (57.79%), Postives = 184/244 (75.41%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGM--DNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVK-DDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
             ST+CLFD+DGTLT  R  I  +M  F+ +L K+V +G+VGGSD +KI EQLG    D +KK EYVFSENGL+ HKNG+L+ K +I   +GEE LQ FINY+L Y+S+I LP KRGTF+E+R+G+IN+ P+GR+CSQ ERD+F +YD+VH +R + + DL+ +F + GL ++IGGQISFDVFPEGWDKRY L ++  D+FK IHFFGD+T  G NDY I  D   +GH V  P+DTR+QL ELF
Sbjct:    6 TSTLCLFDVDGTLTAPRKKITPEMETFMEQLDKKVVVGLVGGSDLSKISEQLGKSEEDVIKKFEYVFSENGLVAHKNGQLIAKESIQNYMGEEKLQKFINYALGYMSKIELPAKRGTFIEFRSGLINVCPVGRSCSQAERDQFGEYDKVHNIRKQFVEDLRKQFPDNGLVYSIGGQISFDVFPEGWDKRYCLNHIAGDNFKVIHFFGDKTNPGENDYEIFMDPRTVGHSVKSPEDTRQQLMELF 249          
BLAST of Phosphomannomutase vs. Ensembl Cavefish
Match: pmm2 (phosphomannomutase 2 [Source:NCBI gene;Acc:103035397])

HSP 1 Score: 283.493 bits (724), Expect = 1.003e-94
Identity = 137/242 (56.61%), Postives = 182/242 (75.21%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
             ST+CLFD+DGTLT +R  +   M +FL KL+++V++G+VGGSD +KI EQLG  D +++ +YVF+ENGL+ ++ GEL    +I   LGEE LQ+FIN+ L Y+++I LP KRGTF+E+R GM+N+SPIGR+CSQ ER EF + D+  K+R+K +A L+ +F   GL+F+IGGQISFDVFPEGWDKRY L  V KD ++TIHFFGD+T  GGNDY I  D   IGH VT P+DT+R   ELF
Sbjct:    8 TSTLCLFDVDGTLTAARQKVTPQMQQFLTKLRQRVRVGVVGGSDLSKIKEQLG-EDVIQQADYVFAENGLVAYRFGELHSVQSIQAYLGEEILQDFINFCLNYMAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQQERIEFFELDKKEKIREKFVAVLQEEFAGKGLAFSIGGQISFDVFPEGWDKRYCLGIVEKDSYQTIHFFGDKTKPGGNDYEIYADPRTIGHEVTSPEDTQRICEELF 248          
BLAST of Phosphomannomutase vs. Ensembl Cavefish
Match: pmm1 (phosphomannomutase 1 [Source:NCBI gene;Acc:103032981])

HSP 1 Score: 243.432 bits (620), Expect = 7.275e-79
Identity = 124/242 (51.24%), Postives = 163/242 (67.36%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDN-LKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVK-DDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            + +CLFD+DGTLT  R  I   + EF   L+ +VKIG+VGGSD++KI EQLG  D  + K +YVF+ENG + +K+G+L+ K  I   LGEE LQ+ IN+ L+Y+  I LP KRGTF+E+R GM+NISPIGR+C+  ER EF + D+  K+R+K +A L+ +F   GL F  GG ISFDVFPEGWDKR  L  ++ +    I+FFG+ T  GGNDY I  D   IG  V  P+DT R   ELF
Sbjct:   11 TVLCLFDVDGTLTPPREKIDPQLDEFFQSLRMKVKIGLVGGSDYSKIAEQLGDGDEVIHKFDYVFAENGTVQYKDGKLLSKQAIQNQLGEELLQDLINFCLRYMGLIKLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFAEIDKREKIREKFVAALQKEFAGKGLRFTRGGLISFDVFPEGWDKRLCLEVLEGEGLDAIYFFGNETSLGGNDYEIFEDPRTIGFTVYSPEDTARLCRELF 252          
BLAST of Phosphomannomutase vs. Ensembl Cavefish
Match: pmm1 (phosphomannomutase 1 [Source:NCBI gene;Acc:103032981])

HSP 1 Score: 167.933 bits (424), Expect = 1.972e-50
Identity = 84/164 (51.22%), Postives = 109/164 (66.46%), Query Frame = 3
Query:  366 CKTNIVE-VLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVK-DDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            CK+  ++  LGEE LQ+ IN+ L+Y+  I LP KRGTF+E+R GM+NISPIGR+C+  ER EF + D+  K+R+K +A L+ +F   GL F  GG ISFDVFPEGWDKR  L  ++ +    I+FFG+ T  GGNDY I  D   IG  V  P+DT R   ELF
Sbjct:   22 CKSGAIQNQLGEELLQDLINFCLRYMGLIKLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFAEIDKREKIREKFVAALQKEFAGKGLRFTRGGLISFDVFPEGWDKRLCLEVLEGEGLDAIYFFGNETSLGGNDYEIFEDPRTIGFTVYSPEDTARLCRELF 185          
BLAST of Phosphomannomutase vs. Ensembl Sea Lamprey
Match: pmm1 (phosphomannomutase 1 [Source:ZFIN;Acc:ZDB-GENE-180314-1])

HSP 1 Score: 191.43 bits (485), Expect = 1.907e-60
Identity = 91/171 (53.22%), Postives = 124/171 (72.51%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIG 644
            S +CLFD+DGTLT +R  I  DM + L +L++QV+IG+VGGSDF KI+EQLGG   + + +YVF+ENGL+ +K+G L  + +I   LGEE LQ FINY L Y+S I LP KRGTF+E+R GM+N+ P+GR+C+Q ER EF + D+   +R K + DL+ KF   GL F+IG
Sbjct:    8 SVLCLFDVDGTLTPARQKISPDMQDLLQRLRRQVRIGVVGGSDFCKIIEQLGGT-VVNQFDYVFAENGLVAYKDGRLFAQQSIQNHLGEEILQEFINYCLAYMSHIRLPRKRGTFIEFRNGMLNVCPVGRSCTQEERLEFYELDKKENIRQKFVEDLRKKFAGKGLVFSIG 177          
BLAST of Phosphomannomutase vs. Ensembl Yeast
Match: SEC53 (Phosphomannomutase; involved in synthesis of GDP-mannose and dolichol-phosphate-mannose; required for folding and glycosylation of secretory proteins in the ER lumen [Source:SGD;Acc:S000001849])

HSP 1 Score: 254.988 bits (650), Expect = 1.920e-84
Identity = 129/242 (53.31%), Postives = 170/242 (70.25%), Query Frame = 3
Query:  135 TICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI 857
            T+ LFD+DGTLT +R  +  ++ + LAKL+ +  IG VGGSD +K LEQLG  + L + +Y FSENGL  ++ G+ +   + +  LGEE       + L+YLS I LP +RGTF+E+R GMIN+SPIGRN S  ER+EFE+YD+ H++R K +  LK +F + GL+F+IGGQISFDVFP GWDK Y L++V KD FK IHFFGD+T  GGNDY I  DE  IGH V  PDDT + L+ELF +
Sbjct:   14 TLVLFDVDGTLTPARLTVSEEVRKTLAKLRNKCCIGFVGGSDLSKQLEQLGP-NVLDEFDYSFSENGLTAYRLGKELASQSFINWLGEEKYNKLAVFILRYLSEIDLPKRRGTFLEFRNGMINVSPIGRNASTEERNEFERYDKEHQIRAKFVEALKKEFPDYGLTFSIGGQISFDVFPAGWDKTYCLQHVEKDGFKEIHFFGDKTMVGGNDYEIFVDERTIGHSVQSPDDTVKILTELFNL 254          
BLAST of Phosphomannomutase vs. Ensembl Nematostella
Match: EDO47912 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKH5])

HSP 1 Score: 281.567 bits (719), Expect = 1.977e-94
Identity = 136/241 (56.43%), Postives = 182/241 (75.52%), Query Frame = 3
Query:  132 STICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            + +CLFD+DGT+T SR VIQ +M E +A+L+K+VKIG+VGGSD  K+ EQ+GG D  K  +Y F ENGL+ +K+G+L+   NI + LGE+++Q  I++ L Y+S I +P KRGTF+E+R G+IN+SPIGRNC+Q ER EF +YD+VH VR K +  LK KF +LGL ++IGGQISFDVFP+GWDK + LR+V+ + FK IHFFGD+  EGGND+ I  D   IGH VT P+DT + L ELF
Sbjct:    9 NILCLFDVDGTVTPSRLVIQPEMRELMAELRKKVKIGLVGGSDQCKVEEQMGGEDVTKLYDYFFPENGLVAYKDGKLLAIQNIKKFLGEDSIQELIDFCLSYMSNIKIPKKRGTFIEFRHGLINVSPIGRNCTQEERIEFFEYDKVHNVRGKFVEALKEKFPHLGLQYSIGGQISFDVFPKGWDKTFCLRHVEAEGFKEIHFFGDKCYEGGNDWEIYQDSRTIGHKVTCPEDTMKLLRELF 249          
BLAST of Phosphomannomutase vs. Ensembl Medaka
Match: pmm2 (phosphomannomutase 2 [Source:NCBI gene;Acc:101157104])

HSP 1 Score: 286.96 bits (733), Expect = 4.942e-96
Identity = 135/242 (55.79%), Postives = 185/242 (76.45%), Query Frame = 3
Query:  129 NSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYV-KDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            ++T+CLFD+DGTLT +R V+  DM +FL +L+ +V++G+VGGSD +KI EQLG  D ++K++YVF+ENGL+ +KNG+L+   +I   +GEE LQ+FIN+ L Y++ I LP KRGTF+E+R GM+N+SP+GR+CSQ ER EF + D+  K+R+K ++ LK +F   GLSF+IGGQISFDVFP+GWDKRY L  V KD + TIHFFGD+T  GGNDY I  D   +GH V+ P+DTRR   +LF
Sbjct:    8 STTLCLFDVDGTLTAARQVVTPDMADFLQRLRTRVRVGVVGGSDLSKIKEQLGA-DVIQKVDYVFAENGLVAYKNGQLLSVQSIQAHMGEELLQDFINFCLNYMATIKLPKKRGTFIEFRNGMLNVSPVGRSCSQEERIEFYELDQKEKIREKFVSALKEEFKGKGLSFSIGGQISFDVFPDGWDKRYCLGIVEKDHYSTIHFFGDKTKPGGNDYEIFSDPRTVGHEVSCPEDTRRLCEQLF 248          
BLAST of Phosphomannomutase vs. Ensembl Medaka
Match: pmm1 (phosphomannomutase 1 [Source:NCBI gene;Acc:101169859])

HSP 1 Score: 247.669 bits (631), Expect = 3.360e-80
Identity = 129/247 (52.23%), Postives = 165/247 (66.80%), Query Frame = 3
Query:  117 FYLMNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLG-GMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDD-FKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELF 851
            F    + +CLFD+DGTLT  R  I   + EF   L+++VKIGIVGGSD+ KI EQLG G D + K +YVF+ENG + +K+G+LV K  I   LGEE LQ+ IN+ L Y+  I LP KRGTF+E+R GMINISPIGR+C+  ER EF + D+  K+R+K +A LK +F   GL F  GG ISFDVFPEGWDKR  L  ++ +  + I+FFG+ T +GGNDY I +D   IG  V  P  T R   ELF
Sbjct:    7 FSRKRNILCLFDVDGTLTPPREKIDPKLDEFFQTLRRKVKIGIVGGSDYPKIAEQLGEGDDVIHKFDYVFAENGTVQYKDGKLVSKHTIQNHLGEELLQDLINFCLSYMGLIKLPKKRGTFIEFRNGMINISPIGRSCTLEERKEFSEIDKREKIREKFVAALKKEFAGKGLRFTKGGLISFDVFPEGWDKRLCLDLLEAEGLEAIYFFGNETSDGGNDYEIFNDPRTIGFTVYSPQHTARLCRELF 253          
BLAST of Phosphomannomutase vs. Planmine SMEST
Match: SMESG000079671.1 (SMESG000079671.1)

HSP 1 Score: 497.278 bits (1279), Expect = 2.525e-179
Identity = 242/244 (99.18%), Postives = 243/244 (99.59%), Query Frame = 3
Query:  126 MNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI 857
            MNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNL KIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYD+VHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI
Sbjct:    1 MNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLNKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDQVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKTIHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI 244          
BLAST of Phosphomannomutase vs. Planmine SMEST
Match: SMESG000079384.1 (SMESG000079384.1)

HSP 1 Score: 259.996 bits (663), Expect = 8.717e-87
Identity = 138/185 (74.59%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  126 MNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINYSLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHKVRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGW 680
            MNSTICLFDLDGTL KSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEY+FSENGLIYHKNGELVCKTNIVEVLGEEAL             IVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYD+ +  +     D++    NL + + +   I   V  E W
Sbjct:    1 MNSTICLFDLDGTLKKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYLFSENGLIYHKNGELVCKTNIVEVLGEEAL-------------IVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDQRYNSQSDSDQDMR---LNLSVIYQV---IGLTVLVEIW 166          
BLAST of Phosphomannomutase vs. Planmine SMEST
Match: SMESG000079384.1 (SMESG000079384.1)

HSP 1 Score: 184.111 bits (466), Expect = 3.220e-58
Identity = 92/94 (97.87%), Postives = 93/94 (98.94%), Query Frame = 3
Query:  126 MNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEAL 407
            MNSTICLFDLDGTL KSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEY+FSENGLIYHKNGELVCKTNIVEVLGEEAL
Sbjct:    1 MNSTICLFDLDGTLKKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKILEQLGGMDNLKKIEYLFSENGLIYHKNGELVCKTNIVEVLGEEAL 94          
The following BLAST results are available for this feature:
BLAST of Phosphomannomutase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PMM25.209e-9455.60phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PMM26.224e-8556.16phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PMM16.213e-8452.08phosphomannomutase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
PMM21.398e-4955.71phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PMM21.073e-3058.06phosphomannomutase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F52B11.25.127e-8652.05Probable phosphomannomutase [Source:UniProtKB/Swi... [more]
F52B11.27.399e-7752.73Probable phosphomannomutase [Source:UniProtKB/Swi... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pmm21.652e-8350.82gene:FBgn0036300 transcript:FBtr0075961[more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pmm24.351e-9256.61phosphomannomutase 2 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
pmm11.954e-5350.00phosphomannomutase 1 [Source:ZFIN;Acc:ZDB-GENE-180... [more]
CABZ01117706.11.064e-1650.70pep chromosome:GRCz11:3:4997545:4998034:1 gene:ENS... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pmm13.771e-9155.23phosphomannomutase 1 [Source:NCBI gene;Acc:1001275... [more]
pmm29.360e-8350.42phosphomannomutase 2 [Source:NCBI gene;Acc:1002162... [more]
pmm21.240e-8250.42phosphomannomutase 2 [Source:NCBI gene;Acc:1002162... [more]
pmm22.524e-7450.92phosphomannomutase 2 [Source:NCBI gene;Acc:1002162... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pmm24.664e-9255.60phosphomannomutase 2 [Source:MGI Symbol;Acc:MGI:18... [more]
Pmm24.664e-9255.60phosphomannomutase 2 [Source:MGI Symbol;Acc:MGI:18... [more]
Pmm11.970e-8351.67phosphomannomutase 1 [Source:MGI Symbol;Acc:MGI:13... [more]
Pmm15.847e-5352.90phosphomannomutase 1 [Source:MGI Symbol;Acc:MGI:13... [more]
Pmm11.834e-4752.41phosphomannomutase 1 [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Phosphomannomutase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7XPW5|PMM_ORYSJ2.496e-9656.30Phosphomannomutase OS=Oryza sativa subsp. japonica... [more]
sp|Q259G4|PMM_ORYSI2.496e-9656.30Phosphomannomutase OS=Oryza sativa subsp. indica O... [more]
sp|Q60HD6|PMM2_MACFA7.198e-9556.02Phosphomannomutase 2 OS=Macaca fascicularis OX=954... [more]
sp|Q1W374|PMM_WHEAT5.178e-9455.04Phosphomannomutase OS=Triticum aestivum OX=4565 PE... [more]
sp|O15305|PMM2_HUMAN2.501e-9355.60Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PM... [more]
back to top
BLAST of Phosphomannomutase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P4WB281.822e-10055.92Phosphomannomutase OS=Scylla olivacea OX=85551 PE=... [more]
A0A1D1VRH82.680e-10060.00Phosphomannomutase OS=Ramazzottius varieornatus OX... [more]
C3YWF05.368e-10057.44Phosphomannomutase OS=Branchiostoma floridae OX=77... [more]
A0A2P2I7N51.917e-9857.14Phosphomannomutase (Fragment) OS=Hirondellea gigas... [more]
A0A1S3HCV31.171e-9757.79Phosphomannomutase OS=Lingula unguis OX=7574 GN=LO... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pmm21.003e-9456.61phosphomannomutase 2 [Source:NCBI gene;Acc:1030353... [more]
pmm17.275e-7951.24phosphomannomutase 1 [Source:NCBI gene;Acc:1030329... [more]
pmm11.972e-5051.22phosphomannomutase 1 [Source:NCBI gene;Acc:1030329... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pmm11.907e-6053.22phosphomannomutase 1 [Source:ZFIN;Acc:ZDB-GENE-180... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SEC531.920e-8453.31Phosphomannomutase; involved in synthesis of GDP-m... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO479121.977e-9456.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphomannomutase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pmm24.942e-9655.79phosphomannomutase 2 [Source:NCBI gene;Acc:1011571... [more]
pmm13.360e-8052.23phosphomannomutase 1 [Source:NCBI gene;Acc:1011698... [more]
back to top
BLAST of Phosphomannomutase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000079671.12.525e-17999.18SMESG000079671.1[more]
SMESG000079384.18.717e-8774.59SMESG000079384.1[more]
SMESG000079384.13.220e-5897.87SMESG000079384.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000977 ID=SMED30000977|Name=Phosphomannomutase|organism=Schmidtea mediterranea sexual|type=transcript|length=1099bp
AAATATTGGACGTTAACAAACTTTATTTGAATTTCTTTAAATTTAATCAC
GATTCTTATTTTTAACTTATTTTAAAATTTTATTTATAATTTTATATCTG
CATCTAAGATATTGAATTTTATTTAATGAATTCAACAATTTGCTTATTTG
ACTTGGATGGAACCTTAACAAAATCCAGAAATGTTATACAAAATGATATG
CTTGAGTTTCTTGCAAAACTTCAAAAGCAAGTTAAAATTGGTATAGTTGG
AGGTTCAGATTTTGCAAAGATTTTAGAACAGTTAGGAGGAATGGATAATT
TAAAGAAAATCGAGTATGTATTTTCTGAAAACGGTCTAATCTATCATAAG
AATGGTGAACTTGTATGCAAAACAAATATCGTTGAAGTTTTGGGCGAAGA
AGCTTTGCAGAATTTCATAAATTATTCATTGCAATATTTATCGAGAATTG
TTTTACCTATTAAACGCGGCACATTTGTGGAGTATCGGACAGGAATGATC
AACATTTCCCCGATCGGCCGAAACTGCTCACAAACTGAGAGAGATGAATT
TGAAAAATATGATCGAGTTCATAAAGTGCGAGACAAAATGATTGCTGATT
TGAAAGGAAAGTTCGGCAATCTTGGATTGAGCTTTGCGATTGGTGGGCAA
ATCAGTTTCGATGTGTTTCCCGAGGGCTGGGACAAGCGTTATGCGTTGCG
ATATGTTAAAGACGATTTTAAAACCATCCATTTTTTCGGTGATAGGACAT
GTGAGGGAGGCAACGATTACGCAATATCTCACGATGAACTAGTTATCGGA
CATCCGGTTACAGGGCCCGATGACACAAGGCGTCAACTGTCGGAGTTATT
CGGTATTTGATCTTACTATTTACTTACCGAAACATTCTACTTTGAATTCC
TTGATTATCTTAGCGAGGGCGTCTCCTATTATGATTTTAATAAATCCTAG
TTTTTTCATTTTTTTATTTACTTCGGTTCCTTATATTGCCAAGTGTTCCC
GGGGATCCATTGTCACTTCTAATGTATCTTATTTCTCGAATGCAAAATAT
TTATCAGAAATAAGTAAAAATGTATTGAAATGAAATATTGAAAAATGCC
back to top

protein sequence of SMED30000977-orf-1

>SMED30000977-orf-1 ID=SMED30000977-orf-1|Name=SMED30000977-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MNSTICLFDLDGTLTKSRNVIQNDMLEFLAKLQKQVKIGIVGGSDFAKIL
EQLGGMDNLKKIEYVFSENGLIYHKNGELVCKTNIVEVLGEEALQNFINY
SLQYLSRIVLPIKRGTFVEYRTGMINISPIGRNCSQTERDEFEKYDRVHK
VRDKMIADLKGKFGNLGLSFAIGGQISFDVFPEGWDKRYALRYVKDDFKT
IHFFGDRTCEGGNDYAISHDELVIGHPVTGPDDTRRQLSELFGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006379HAD-SF_hydro_IIB
IPR043169PMM_cap
IPR036412HAD-like_sf
IPR005002PMM
IPR023214HAD_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0009298GDP-mannose biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004615phosphomannomutase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005002PhosphomannomutasePFAMPF03332PMMcoord: 25..242
e-value: 4.4E-97
score: 324.2
IPR005002PhosphomannomutasePANTHERPTHR10466PHOSPHOMANNOMUTASEcoord: 3..242
IPR005002PhosphomannomutaseCDDcd02585HAD_PMMcoord: 5..241
e-value: 1.7067E-125
score: 353.504
IPR006379HAD-superfamily hydrolase, subfamily IIBTIGRFAMTIGR01484TIGR01484coord: 7..217
e-value: 4.6E-26
score: 90.2
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 5..235
e-value: 6.1E-98
score: 329.0
IPR043169Phosphomannomutase, cap domainGENE3DG3DSA:3.30.1240.20coord: 84..185
e-value: 6.1E-98
score: 329.0
NoneNo IPR availableSFLDSFLDF00445alpha-phosphomannomutasecoord: 2..242
e-value: 0.0
score: 367.3
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 2..242
e-value: 0.0
score: 367.3
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 5..241