Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30000970
Length (bp)872
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30000970) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30000970) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30000970) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30000970) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 49.2914 bits (116), Expect = 2.430e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  146 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 192          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 49.6766 bits (117), Expect = 2.817e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  199 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 245          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 49.6766 bits (117), Expect = 2.817e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  199 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 245          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MEIS1 (Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000])

HSP 1 Score: 49.6766 bits (117), Expect = 2.832e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  218 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 264          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 49.6766 bits (117), Expect = 2.960e-6
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  525 KQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            + KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  262 RNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 319          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-40 (Homeobox protein ceh-40 [Source:UniProtKB/Swiss-Prot;Acc:Q19503])

HSP 1 Score: 53.9138 bits (128), Expect = 4.212e-8
Identity = 23/68 (33.82%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  516 YMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPK 719
            Y++ ++K +  ++ + +I+  ++  NI  PYPS  +K+ +A + NI V QV++WF N+R R   T  K
Sbjct:  184 YLDARRKRRNFSKTSTEILNEYFLANINHPYPSEEVKQALAMQCNISVAQVSNWFGNKRIRYKKTMAK 251          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-60 (C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:Q45EK2])

HSP 1 Score: 50.447 bits (119), Expect = 5.648e-7
Identity = 20/60 (33.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRS 701
            ++ +K +  ++N   I++ W+ ++ + PYPS+  K  +A++ NI ++QVN+WF N+R R+
Sbjct:  179 QQGRKRRNFDKNTTDILQNWFHDHRQNPYPSDQEKAELAKQCNIKISQVNNWFGNQRIRT 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 49.2914 bits (116), Expect = 1.632e-6
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 3
Query:  525 KQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            K+K  K  ++ AI    AW  +N+  PYPS   KK +A+E  + + QVN+WF N R R
Sbjct:  318 KRKVPKVFSKEAITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRR 375          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 49.2914 bits (116), Expect = 1.794e-6
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 3
Query:  525 KQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            K+K  K  ++ AI    AW  +N+  PYPS   KK +A+E  + + QVN+WF N R R
Sbjct:  392 KRKVPKVFSKEAITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRR 449          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 49.2914 bits (116), Expect = 1.794e-6
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 3
Query:  525 KQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            K+K  K  ++ AI    AW  +N+  PYPS   KK +A+E  + + QVN+WF N R R
Sbjct:  392 KRKVPKVFSKEAITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRR 449          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 48.9062 bits (115), Expect = 2.680e-6
Identity = 23/57 (40.35%), Postives = 32/57 (56.14%), Query Frame = 3
Query:  528 QKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            QKK     + A  I+ AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  366 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 48.9062 bits (115), Expect = 2.995e-6
Identity = 23/57 (40.35%), Postives = 32/57 (56.14%), Query Frame = 3
Query:  528 QKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            QKK     + A  I+ AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  351 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 407          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 52.373 bits (124), Expect = 2.680e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  274 KRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 332          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 52.373 bits (124), Expect = 2.680e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  274 KRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 332          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: meis1b (Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122-1])

HSP 1 Score: 49.6766 bits (117), Expect = 2.110e-6
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  525 KQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            + KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  270 RNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 327          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pbx4 (pre-B-cell leukemia transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-000201-18])

HSP 1 Score: 46.9802 bits (110), Expect = 2.219e-6
Identity = 18/61 (29.51%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  516 YMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            +++ ++K +  N+ A +++  ++ +++  PYPS   K+ +A++  I V+QV++WF N+R R
Sbjct:   49 FLDARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 109          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 49.2914 bits (116), Expect = 2.609e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  282 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 328          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 49.6766 bits (117), Expect = 2.634e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  283 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 49.6766 bits (117), Expect = 2.677e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  230 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 276          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 49.6766 bits (117), Expect = 2.706e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  283 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: meis2 (Meis homeobox 2 [Source:NCBI gene;Acc:100036664])

HSP 1 Score: 49.6766 bits (117), Expect = 2.757e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  224 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 270          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 49.2914 bits (116), Expect = 3.170e-6
Identity = 23/56 (41.07%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  531 KKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  266 KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 321          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 51.2174 bits (121), Expect = 7.219e-7
Identity = 24/63 (38.10%), Postives = 33/63 (52.38%), Query Frame = 3
Query:  510 DFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            D    + KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  260 DLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 322          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Meis3 (Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519])

HSP 1 Score: 50.8322 bits (120), Expect = 7.842e-7
Identity = 24/63 (38.10%), Postives = 33/63 (52.38%), Query Frame = 3
Query:  510 DFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            D    + KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  243 DLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 305          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 49.6766 bits (117), Expect = 1.856e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  283 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 49.6766 bits (117), Expect = 2.031e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  283 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 49.2914 bits (116), Expect = 2.664e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  283 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q19503|HM40_CAEEL (Homeobox protein ceh-40 OS=Caenorhabditis elegans OX=6239 GN=ceh-40 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 5.358e-7
Identity = 23/68 (33.82%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  516 YMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPK 719
            Y++ ++K +  ++ + +I+  ++  NI  PYPS  +K+ +A + NI V QV++WF N+R R   T  K
Sbjct:  184 YLDARRKRRNFSKTSTEILNEYFLANINHPYPSEEVKQALAMQCNISVAQVSNWFGNKRIRYKKTMAK 251          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P97368|MEIS3_MOUSE (Homeobox protein Meis3 OS=Mus musculus OX=10090 GN=Meis3 PE=2 SV=2)

HSP 1 Score: 51.2174 bits (121), Expect = 5.050e-6
Identity = 24/63 (38.10%), Postives = 33/63 (52.38%), Query Frame = 3
Query:  510 DFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            D    + KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  260 DLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 322          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A183NS64 (Homeobox domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS4950 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.641e-29
Identity = 52/105 (49.52%), Postives = 80/105 (76.19%), Query Frame = 3
Query:  534 KNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 848
            +N+PLN+ A+ +ME+WYTN+++ PYP+ A K+ +A  G I V QV+SWFANRR R+ NTKPKKNR++L  ++Y+ A E+E  ++G L+A D+  ++  +IDEYL+
Sbjct:  431 RNRPLNQTALSVMESWYTNHVDNPYPTTAEKEELAALGGITVIQVSSWFANRRTRTANTKPKKNRRKLYHQIYQLAVEIEALTQGSLRACDLQERIGQIIDEYLT 535          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A183L9M4 (Homeobox domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS499 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 9.366e-29
Identity = 52/105 (49.52%), Postives = 80/105 (76.19%), Query Frame = 3
Query:  534 KNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 848
            +N+PLN+ A+ +ME+WYTN+++ PYP+ A K+ +A  G I V QV+SWFANRR R+ NTKPKKNR++L  ++Y+ A E+E  ++G L+A D+  ++  +IDEYL+
Sbjct:  431 RNRPLNQTALSVMESWYTNHVDNPYPTTAEKEELAALGGITVIQVSSWFANRRTRTANTKPKKNRRKLYHQIYQLAVEIETLTQGSLRACDLQERIGQIIDEYLT 535          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A430QP45 (Homeobox domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0003622 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 9.905e-29
Identity = 52/105 (49.52%), Postives = 80/105 (76.19%), Query Frame = 3
Query:  534 KNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 848
            +N+PLN+ A+ +ME+WYTN+++ PYP+ A K+ +A  G I V QV+SWFANRR R+ NTKPKKNR++L  ++Y+ A E+E  ++G L+A D+  ++  +IDEYL+
Sbjct:  585 RNRPLNQTALSVMESWYTNHVDNPYPTTAEKEELAALGGITVIQVSSWFANRRTRTANTKPKKNRRKLYHQIYQLAVEIEALTQGSLRACDLQERIGQIIDEYLT 689          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A095C6T9 (Pre-B-cell leukemia transcription factor 4 OS=Schistosoma haematobium OX=6185 GN=MS3_06095 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.224e-28
Identity = 52/105 (49.52%), Postives = 80/105 (76.19%), Query Frame = 3
Query:  534 KNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 848
            +N+PLN+ A+ +ME+WYTN+++ PYP+ A K+ +A  G I V QV+SWFANRR R+ NTKPKKNR++L  ++Y+ A E+E  ++G L+A D+  ++  +IDEYL+
Sbjct:  585 RNRPLNQTALSVMESWYTNHVDNPYPTTAEKEELAALGGITVIQVSSWFANRRTRTANTKPKKNRRKLYHQIYQLAVEIEALTQGSLRACDLQERIGQIIDEYLT 689          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: G4VA00 (Irx-related OS=Schistosoma mansoni OX=6183 GN=Smp_063520 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.380e-28
Identity = 52/105 (49.52%), Postives = 80/105 (76.19%), Query Frame = 3
Query:  534 KNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 848
            +N+PLN+ A+ +ME+WYTN+++ PYP+ A K+ +A  G I V QV+SWFANRR R+ NTKPKKNR++L  ++Y+ A E+E  ++G L+A D+  ++  +IDEYL+
Sbjct:  431 RNRPLNQTALSVMESWYTNHVDNPYPTTAEKEELAALGGITVIQVSSWFANRRTRTANTKPKKNRRKLYHQIYQLAVEIEALTQGALRACDLQERIGQIIDEYLT 535          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: meis2a (homeobox protein Meis1-like [Source:NCBI gene;Acc:103032373])

HSP 1 Score: 52.373 bits (124), Expect = 1.992e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  261 KRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 319          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pknox1.2 (homeobox protein PKNOX1-like [Source:NCBI gene;Acc:103022264])

HSP 1 Score: 51.6026 bits (122), Expect = 4.072e-7
Identity = 32/96 (33.33%), Postives = 49/96 (51.04%), Query Frame = 3
Query:  498 FVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR--------SDNTKPKKNRKQLQVR-LYKF 758
            F++ D    K K+   L ++A  +M +W   +I  PYP+   KK +A + N+ + QVN+WF N R R        S +  PK  +K  Q R L +F
Sbjct:  258 FLSQDEGSSKSKRGI-LPKHATSVMRSWLFQHIGHPYPTEDEKKQIALQTNLTLLQVNNWFINARRRILQPMLDASSSETPKSKKKTPQTRPLQRF 352          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pknox1.2 (homeobox protein PKNOX1-like [Source:NCBI gene;Acc:103022264])

HSP 1 Score: 51.6026 bits (122), Expect = 4.203e-7
Identity = 32/96 (33.33%), Postives = 49/96 (51.04%), Query Frame = 3
Query:  498 FVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR--------SDNTKPKKNRKQLQVR-LYKF 758
            F++ D    K K+   L ++A  +M +W   +I  PYP+   KK +A + N+ + QVN+WF N R R        S +  PK  +K  Q R L +F
Sbjct:  303 FLSQDEGSSKSKRGI-LPKHATSVMRSWLFQHIGHPYPTEDEKKQIALQTNLTLLQVNNWFINARRRILQPMLDASSSETPKSKKKTPQTRPLQRF 397          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pknox1.2 (homeobox protein PKNOX1-like [Source:NCBI gene;Acc:103022264])

HSP 1 Score: 51.6026 bits (122), Expect = 4.232e-7
Identity = 32/96 (33.33%), Postives = 49/96 (51.04%), Query Frame = 3
Query:  498 FVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR--------SDNTKPKKNRKQLQVR-LYKF 758
            F++ D    K K+   L ++A  +M +W   +I  PYP+   KK +A + N+ + QVN+WF N R R        S +  PK  +K  Q R L +F
Sbjct:  275 FLSQDEGSSKSKRGI-LPKHATSVMRSWLFQHIGHPYPTEDEKKQIALQTNLTLLQVNNWFINARRRILQPMLDASSSETPKSKKKTPQTRPLQRF 369          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:103038426])

HSP 1 Score: 49.6766 bits (117), Expect = 1.054e-6
Identity = 34/115 (29.57%), Postives = 51/115 (44.35%), Query Frame = 3
Query:  441 ANRLVANTLEKINSDRINS-FVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNS 782
            A RL    L  +   RI   F       + ++K     E    ++  WY   ++ PYP+ + K+++AQ   +  TQV +WF NRR R D     KNR Q    L+      E +S
Sbjct:   99 AERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWY---LQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQR-DRAASAKNRLQQDPSLHPSGSSPECSS 209          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 45.4394 bits (106), Expect = 7.808e-6
Identity = 19/51 (37.25%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  546 LNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            L ++A  +M +W   +I  PYP+   K+ +A + N+ + QVN+WF N R R
Sbjct:  265 LPKHATTVMRSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRR 315          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 54.299 bits (129), Expect = 1.296e-8
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 3
Query:  474 INSDRINSFVNNDFYMEK--QKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            I SD   S   +D    K  QKK     + A  IM+AW   ++  PYPS   K+++AQE  + + QVN+WF N R R
Sbjct:  219 IGSDDGGSETADDDQGGKKSQKKRGIFPKAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRR 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 50.447 bits (119), Expect = 2.828e-7
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 3
Query:  546 LNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            L + A  IM+ W   +I  PYP+   K+++AQ+ N+ + QVN+WF N R R
Sbjct:  204 LPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRR 254          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO43361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ8])

HSP 1 Score: 47.7506 bits (112), Expect = 2.108e-6
Identity = 18/61 (29.51%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  516 YMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            +++ ++K +  ++ A +I+  ++ +++  PYPS   K+ +A++ NI V Q+++WF N+R R
Sbjct:  195 FLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIR 255          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 53.1434 bits (126), Expect = 1.266e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  244 KRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 302          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 52.7582 bits (125), Expect = 1.499e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  259 KRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 317          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:101167316])

HSP 1 Score: 49.6766 bits (117), Expect = 1.746e-6
Identity = 23/56 (41.07%), Postives = 31/56 (55.36%), Query Frame = 3
Query:  531 KKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            KK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  272 KKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 327          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 49.2914 bits (116), Expect = 2.165e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  284 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 330          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 49.2914 bits (116), Expect = 2.268e-6
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  558 AIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  285 ATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 331          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000008497.1 (SMESG000008497.1)

HSP 1 Score: 471.085 bits (1211), Expect = 2.738e-170
Identity = 234/236 (99.15%), Postives = 234/236 (99.15%), Query Frame = 3
Query:  144 MQQSN-ESENSSTGFNIRVSEENSTDFHKSNWNMSSWPNTFDVDLLKAYEIEKLKETNPTNQNPSSSIFSEPQSAITDEFRILLDSIKCFEKEKLQNSETANRLVANTLEKINSDRINSFVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 848
            MQQSN ESENSSTGFNI VSEENSTDFHKSNWNMSSWPNTFDVDLLKAYEIEKLKETNPTNQNPSSSIFSEPQSAITDEFRILLDSIKCFEKEKLQNSETANRLVANTLEKINSDRINSFVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS
Sbjct:    1 MQQSNSESENSSTGFNIHVSEENSTDFHKSNWNMSSWPNTFDVDLLKAYEIEKLKETNPTNQNPSSSIFSEPQSAITDEFRILLDSIKCFEKEKLQNSETANRLVANTLEKINSDRINSFVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS 236          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000005966.1 (SMESG000005966.1)

HSP 1 Score: 128.642 bits (322), Expect = 1.401e-35
Identity = 58/103 (56.31%), Postives = 78/103 (75.73%), Query Frame = 3
Query:  534 KNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQVRLYKFAQELELNSEGRLKAYDIATKMNNMIDEY 842
            +NKPLN+ A+KIME WY  +I++PYP+N  K+ +A +G I + QVNSWFANRRNRSDNTKPKKNRK L+  L  FA +LE  S G LKA  I+ ++ ++++EY
Sbjct:  145 RNKPLNKKAVKIMEKWYMKHIDYPYPNNKQKETLASQGVISIAQVNSWFANRRNRSDNTKPKKNRKYLESHLMSFASQLETESRGILKANSISKRLTDILNEY 247          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.129e-7
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  465 LEKINSDRINSFVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            +E+I+SD  N+        ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  471 VEEIDSDDKNN--------KRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 540          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.172e-7
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  465 LEKINSDRINSFVNNDFYMEKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            +E+I+SD  N+        ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  471 VEEIDSDDKNN--------KRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 540          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.723e-7
Identity = 24/59 (40.68%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  522 EKQKKNKPLNENAIKIMEAWYTNNIEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNR 698
            ++QKK     + A  IM AW   ++  PYPS   KK +AQ+  + + QVN+WF N R R
Sbjct:  473 KRQKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 531          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS22.430e-644.68Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.817e-644.68Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.817e-644.68Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS12.832e-644.68Meis homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7000][more]
MEIS32.960e-639.66Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-404.212e-833.82Homeobox protein ceh-40 [Source:UniProtKB/Swiss-P... [more]
ceh-605.648e-733.33C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-621.632e-641.38Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.794e-641.38Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.794e-641.38Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hth2.680e-640.35gene:FBgn0001235 transcript:FBtr0082255[more]
hth2.995e-640.35gene:FBgn0001235 transcript:FBtr0082256[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a2.680e-740.68Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a2.680e-740.68Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis1b2.110e-639.66Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
pbx42.219e-629.51pre-B-cell leukemia transcription factor 4 [Source... [more]
meis2a2.609e-644.68Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS12.634e-644.68Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS12.677e-644.68Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS12.706e-644.68Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
meis22.757e-644.68Meis homeobox 2 [Source:NCBI gene;Acc:100036664][more]
meis33.170e-641.07Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meis37.219e-738.10Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis37.842e-738.10Meis homeobox 3 [Source:MGI Symbol;Acc:MGI:108519][more]
Meis11.856e-644.68Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis12.031e-644.68Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis12.664e-644.68Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q19503|HM40_CAEEL5.358e-733.82Homeobox protein ceh-40 OS=Caenorhabditis elegans ... [more]
sp|P97368|MEIS3_MOUSE5.050e-638.10Homeobox protein Meis3 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183NS645.641e-2949.52Homeobox domain-containing protein OS=Schistosoma ... [more]
A0A183L9M49.366e-2949.52Homeobox domain-containing protein OS=Schistosoma ... [more]
A0A430QP459.905e-2949.52Homeobox domain-containing protein OS=Schistosoma ... [more]
A0A095C6T91.224e-2849.52Pre-B-cell leukemia transcription factor 4 OS=Schi... [more]
G4VA001.380e-2849.52Irx-related OS=Schistosoma mansoni OX=6183 GN=Smp_... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a1.992e-740.68homeobox protein Meis1-like [Source:NCBI gene;Acc:... [more]
pknox1.24.072e-733.33homeobox protein PKNOX1-like [Source:NCBI gene;Acc... [more]
pknox1.24.203e-733.33homeobox protein PKNOX1-like [Source:NCBI gene;Acc... [more]
pknox1.24.232e-733.33homeobox protein PKNOX1-like [Source:NCBI gene;Acc... [more]
six71.054e-629.57homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pknox27.808e-637.25pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO364391.296e-838.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393752.828e-741.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433612.108e-629.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a1.266e-740.68homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis2a1.499e-740.68homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis1b1.746e-641.07Meis homeobox 1 [Source:NCBI gene;Acc:101167316][more]
meis2a2.165e-644.68Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a2.268e-644.68Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008497.12.738e-17099.15SMESG000008497.1[more]
SMESG000005966.11.401e-3556.31SMESG000005966.1[more]
SMESG000006530.11.129e-737.18SMESG000006530.1[more]
SMESG000006530.11.172e-737.18SMESG000006530.1[more]
SMESG000078684.11.723e-740.68SMESG000078684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000970 ID=SMED30000970|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=872bp
TCAAACAAATCAATGAGAAGAATTAAGAGTTAACTTTAATCAGAAGTGAA
GATAAGAAAATGCTATGCTATGAATGACTAAGAGATTCAAGATTCCAATA
TATAAAACCAATTGACCAATAAACGTGAAATTAGGTGGCAAAAATGCAAC
AGTCAAATGAATCCGAAAATTCTTCAACCGGCTTTAACATTCGCGTGTCG
GAAGAAAATTCAACAGATTTCCATAAATCAAATTGGAATATGTCTTCTTG
GCCAAACACTTTTGATGTAGATTTATTGAAAGCGTATGAAATTGAAAAAC
TTAAAGAAACAAATCCAACCAATCAAAATCCTTCCTCGTCAATATTTTCT
GAGCCGCAAAGCGCAATTACTGATGAATTTCGTATTCTTTTGGATTCGAT
TAAGTGTTTTGAAAAAGAAAAGTTGCAAAATAGTGAAACAGCAAACCGAT
TAGTGGCAAACACTCTTGAAAAAATTAACAGTGATCGAATCAATTCATTT
GTAAATAATGATTTCTATATGGAAAAGCAAAAGAAAAACAAACCGCTAAA
TGAAAATGCAATAAAAATAATGGAAGCTTGGTATACAAATAATATCGAGT
TTCCCTACCCTTCGAATGCACTAAAAAAGAATATGGCTCAAGAAGGAAAC
ATTGGCGTCACACAGGTCAACTCGTGGTTTGCCAATAGACGAAACCGAAG
CGATAACACAAAACCAAAAAAGAATCGCAAGCAGCTCCAAGTCCGACTAT
ACAAATTTGCGCAAGAACTCGAACTTAATTCAGAAGGACGCCTAAAAGCA
TATGATATTGCAACGAAAATGAATAATATGATTGACGAATATCTTTCATA
ATTATTATTTATCGATTTGTAA
back to top

protein sequence of SMED30000970-orf-1

>SMED30000970-orf-1 ID=SMED30000970-orf-1|Name=SMED30000970-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MQQSNESENSSTGFNIRVSEENSTDFHKSNWNMSSWPNTFDVDLLKAYEI
EKLKETNPTNQNPSSSIFSEPQSAITDEFRILLDSIKCFEKEKLQNSETA
NRLVANTLEKINSDRINSFVNNDFYMEKQKKNKPLNENAIKIMEAWYTNN
IEFPYPSNALKKNMAQEGNIGVTQVNSWFANRRNRSDNTKPKKNRKQLQV
RLYKFAQELELNSEGRLKAYDIATKMNNMIDEYLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR008422Homeobox_KN_domain
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 128..193
e-value: 2.6E-5
score: 33.7
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 126..189
score: 11.839
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 130..186
e-value: 1.43209E-7
score: 45.3121
IPR008422Homeobox KN domainPFAMPF05920Homeobox_KNcoord: 146..185
e-value: 5.3E-10
score: 39.0
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 95..187
e-value: 5.6E-16
score: 60.2
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 122..185
NoneNo IPR availablePANTHERPTHR11850:SF266HOMEOBOX PROTEIN HOMOTHORAXcoord: 122..185
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 121..185