hypothetical protein

Overview
Namehypothetical protein (AFJ24794.1)
Smed IDSMED30000968
Length (bp)3093
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of hypothetical protein (SMED30000968) t-SNE clustered cells

Violin plots show distribution of expression levels for hypothetical protein (SMED30000968) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of hypothetical protein (SMED30000968) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for hypothetical protein (SMED30000968) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000968

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30000968h1SMcG0002159 SmedASXL_017653SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30000968h1SMcG0002159 Contig43289newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000968h1SMcG0002159 Contig43289uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hypothetical protein vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 98.5969 bits (244), Expect = 4.176e-20
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +    GG I +K    P+E   N     +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  102 DDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRK---IPVE---NTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 230          
BLAST of hypothetical protein vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 98.5969 bits (244), Expect = 4.176e-20
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +    GG I +K    P+E   N     +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  102 DDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRK---IPVE---NTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 230          
BLAST of hypothetical protein vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 98.5969 bits (244), Expect = 4.177e-20
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +    GG I +K    P+E   N     +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  103 DDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRK---IPVE---NTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 231          
BLAST of hypothetical protein vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 98.5969 bits (244), Expect = 4.213e-20
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +    GG I +K    P+E   N     +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  103 DDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRK---IPVE---NTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 231          
BLAST of hypothetical protein vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 98.5969 bits (244), Expect = 4.248e-20
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +    GG I +K    P+E   N     +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  103 DDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRK---IPVE---NTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 231          
BLAST of hypothetical protein vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 60.4622 bits (145), Expect = 6.918e-9
Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1
Query:  538 TTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            T CE C  G ++  LLLCD C+  YHIYC+   L +IP+G W C+ CS
Sbjct:  478 TVCEGCGTGGDEANLLLCDECDVSYHIYCMKPLLDKIPQGPWRCQWCS 525          
BLAST of hypothetical protein vs. Ensembl Celegans
Match: dpff-1 (Zinc finger protein dpff-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09477])

HSP 1 Score: 56.6102 bits (135), Expect = 4.968e-8
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            +C IC    ND +LL CD+C+RGYH+YCL   L + P+ ++ C  C
Sbjct:  313 SCTICGTSENDDKLLFCDDCDRGYHLYCLTPALEKAPDDEYSCRLC 358          
BLAST of hypothetical protein vs. Ensembl Celegans
Match: phf-14 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9GRZ5])

HSP 1 Score: 55.4546 bits (132), Expect = 1.868e-7
Identity = 30/99 (30.30%), Postives = 46/99 (46.46%), Query Frame = 1
Query:  433 LLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGD---WFCEECSNDMEINNQILPRG 720
            LLLSDF       +  P  I           + +N TC +C      H+   CD C++ YHI CL+ PL+ +P+ +   W C EC+   +   +I+P  
Sbjct:  487 LLLSDFNNRQSCSRSSPAIIAP---------KKMNYTCVVCRKSTEQHKQTQCDECHKSYHIGCLSPPLTRLPKRNNFGWICHECNESSDSEQEIIPEA 576          
BLAST of hypothetical protein vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 53.9138 bits (128), Expect = 7.172e-7
Identity = 21/45 (46.67%), Postives = 28/45 (62.22%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            CE+CN    D +L+LCD C R YH+ C+   + + PEGDW C  C
Sbjct:  268 CEVCN---QDGELMLCDTCTRAYHVACIDENMEQPPEGDWSCPHC 309          

HSP 2 Score: 53.5286 bits (127), Expect = 9.806e-7
Identity = 23/45 (51.11%), Postives = 28/45 (62.22%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC   +N   +LLCD C   YH YC+  PL+EIPEG+W C  C
Sbjct:  331 CRICKETSN---ILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRC 372          
BLAST of hypothetical protein vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 53.5286 bits (127), Expect = 1.089e-6
Identity = 23/48 (47.92%), Postives = 26/48 (54.17%), Query Frame = 1
Query:  535 NTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            N  CE C     D +LLLCD C R YH  C+   + E PEGDW C  C
Sbjct:  256 NDYCEECK---QDGELLLCDTCPRAYHTVCIDENMEEPPEGDWSCAHC 300          
BLAST of hypothetical protein vs. Ensembl Fly
Match: CG2926 (gene:FBgn0037344 transcript:FBtr0336762)

HSP 1 Score: 91.6633 bits (226), Expect = 1.945e-18
Identity = 54/162 (33.33%), Postives = 83/162 (51.23%), Query Frame = 1
Query:  259 FQNVILSNDETQ-CCICFSKYKS-PVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQ---DLNGDGDND-----EILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC--SNDMEINNQI 708
            F + I SND  + C IC   ++   + +  +C H FC  C+  W      CP+DR+    +++ D        +EV   + +   +L  D + D     E   T CEIC   + +  +LLCD+CN+GYH+ CL  PL EIP G W+C+ C  S+D + N Q+
Sbjct:  142 FSSDISSNDLLEKCPICLLTFRQQEIGTPATCEHIFCAACIDAWSRNVQTCPIDRIEFDRIIVRDSYASRRVVREVRLDLSKSNTELVVDDEADTAALSEEEVTNCEICESPDREDVMLLCDSCNQGYHMDCLDPPLYEIPAGSWYCDNCIDSDDEDDNEQL 303          
BLAST of hypothetical protein vs. Ensembl Fly
Match: CG2926 (gene:FBgn0037344 transcript:FBtr0078752)

HSP 1 Score: 90.8929 bits (224), Expect = 4.597e-18
Identity = 55/165 (33.33%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  250 DILFQNVILSNDETQ-CCICFSKYKS-PVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQ---DLNGDGDND-----EILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC--SNDMEINNQI 708
            D  F + I SND  + C IC   ++   + +  +C H FC  C+  W      CP+DR+    +++ D        +EV   + +   +L  D + D     E   T CEIC   + +  +LLCD+CN+GYH+ CL  PL EIP G W+C+ C  S+D + N Q+
Sbjct:  139 DDGFSSDISSNDLLEKCPICLLTFRQQEIGTPATCEHIFCAACIDAWSRNVQTCPIDRIEFDRIIVRDSYASRRVVREVRLDLSKSNTELVVDDEADTAALSEEEVTNCEICESPDREDVMLLCDSCNQGYHMDCLDPPLYEIPAGSWYCDNCIDSDDEDDNEQL 303          
BLAST of hypothetical protein vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0088091)

HSP 1 Score: 70.4774 bits (171), Expect = 9.584e-12
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSN 684
            I+   C+ C  G N+ +LLLCD C++GYH YC    +  IP+GDW+C EC N
Sbjct: 2504 IMKANCQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVN 2555          
BLAST of hypothetical protein vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0111115)

HSP 1 Score: 66.6254 bits (161), Expect = 3.557e-11
Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC   +ND QLL CD+C+RGYH+YCL+ PL   PEG W C+ C
Sbjct:  287 CSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 331          
BLAST of hypothetical protein vs. Ensembl Fly
Match: d4 (gene:FBgn0033015 transcript:FBtr0086083)

HSP 1 Score: 67.0106 bits (162), Expect = 5.074e-11
Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC   +ND QLL CD+C+RGYH+YCL+ PL   PEG W C+ C
Sbjct:  443 CSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLC 487          
BLAST of hypothetical protein vs. Ensembl Zebrafish
Match: phrf1 (PHD and ring finger domains 1 [Source:ZFIN;Acc:ZDB-GENE-030131-624])

HSP 1 Score: 97.4413 bits (241), Expect = 8.538e-23
Identity = 54/142 (38.03%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  274 LSNDE--TQCCICFSKY-KSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITK----KEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            LS+DE   +C IC + + + PVA+ ++C H FC +C+ +W    + CP+DR+    ++L    GG I K    K+   P E+ +  D D      T+CEIC   + + +LLLCD C+ GYH+ CL  PL  +P  +WFC EC
Sbjct:   22 LSSDEDSEKCPICLNSFHEQPVATPETCEHYFCLDCILEWSKNANSCPVDRIVFNNIILRKCHGGKIQKTIAVKKPVKPAEEQVEVDLDQ-----TSCEICGGRDREDRLLLCDGCDAGYHMECLTPPLDAVPVEEWFCPEC 158          
BLAST of hypothetical protein vs. Ensembl Zebrafish
Match: phrf1 (PHD and ring finger domains 1 [Source:ZFIN;Acc:ZDB-GENE-030131-624])

HSP 1 Score: 105.145 bits (261), Expect = 2.417e-22
Identity = 54/142 (38.03%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  274 LSNDE--TQCCICFSKY-KSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITK----KEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            LS+DE   +C IC + + + PVA+ ++C H FC +C+ +W    + CP+DR+    ++L    GG I K    K+   P E+ +  D D      T+CEIC   + + +LLLCD C+ GYH+ CL  PL  +P  +WFC EC
Sbjct:   93 LSSDEDSEKCPICLNSFHEQPVATPETCEHYFCLDCILEWSKNANSCPVDRIVFNNIILRKCHGGKIQKTIAVKKPVKPAEEQVEVDLDQ-----TSCEICGGRDREDRLLLCDGCDAGYHMECLTPPLDAVPVEEWFCPEC 229          
BLAST of hypothetical protein vs. Ensembl Zebrafish
Match: dpf1 (D4, zinc and double PHD fingers family 1 [Source:ZFIN;Acc:ZDB-GENE-050913-31])

HSP 1 Score: 67.781 bits (164), Expect = 2.433e-11
Identity = 26/46 (56.52%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            +C +C    ND QLL CD+C+RGYH+YCL+ P+SE PEG W C  C
Sbjct:  334 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMSEPPEGSWSCHLC 379          
BLAST of hypothetical protein vs. Ensembl Zebrafish
Match: baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:ZFIN;Acc:ZDB-GENE-041010-202])

HSP 1 Score: 69.3218 bits (168), Expect = 2.869e-11
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            I+  TC++C  G++D  LLLCD C+RG H++CL   + ++P+GDWFC  C
Sbjct: 2231 IIKVTCQVCRKGDDDEYLLLCDGCDRGCHMFCLRPKVLQVPDGDWFCPNC 2280          
BLAST of hypothetical protein vs. Ensembl Zebrafish
Match: baz1a (bromodomain adjacent to zinc finger domain, 1A [Source:ZFIN;Acc:ZDB-GENE-030131-6105])

HSP 1 Score: 67.781 bits (164), Expect = 4.328e-11
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEIN 699
            ILNT C++C    +   +LLCD C RGYHI+C+   L  +P  DWFC EC     +N
Sbjct:  226 ILNTRCKVCRRKGDAENMLLCDGCGRGYHIFCVRPKLKAVPSEDWFCPECRPKQRLN 282          
BLAST of hypothetical protein vs. Ensembl Xenopus
Match: PHRF1 (PHD and ring finger domains 1 [Source:NCBI gene;Acc:100127807])

HSP 1 Score: 101.679 bits (252), Expect = 4.873e-21
Identity = 49/138 (35.51%), Postives = 80/138 (57.97%), Query Frame = 1
Query:  277 SNDETQCC-ICFSKYKSPVAST-DSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSN 684
            S+DE + C IC + ++  V  T ++C+H FC +C+ +W    + CP+DR+    + +    GG I KK    PI++  +   + D+  N  C +C   + + +LLLCD C+ GYH+ CL  PL+ +P  +WFC ECS+
Sbjct:   93 SDDERESCPICLNGFRDQVVGTPENCSHYFCLDCIVEWSKNANSCPVDRIAFSCIHIRAHFGGEILKKV---PIQKKADEVQEEDDATN--CAVCGRSDREDRLLLCDGCDAGYHMECLTPPLNAVPVDEWFCPECSD 225          
BLAST of hypothetical protein vs. Ensembl Xenopus
Match: dpf2 (double PHD fingers 2 [Source:NCBI gene;Acc:100126056])

HSP 1 Score: 67.3958 bits (163), Expect = 3.383e-11
Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC    ND QLL CD+C+RGYH+YCL+ P++E PEG W C  C
Sbjct:  283 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 327          
BLAST of hypothetical protein vs. Ensembl Xenopus
Match: dpf2 (double PHD fingers 2 [Source:NCBI gene;Acc:100126056])

HSP 1 Score: 67.781 bits (164), Expect = 3.457e-11
Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC    ND QLL CD+C+RGYH+YCL+ P++E PEG W C  C
Sbjct:  343 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 387          
BLAST of hypothetical protein vs. Ensembl Xenopus
Match: dpf2 (double PHD fingers 2 [Source:NCBI gene;Acc:100126056])

HSP 1 Score: 67.0106 bits (162), Expect = 3.555e-11
Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC    ND QLL CD+C+RGYH+YCL+ P++E PEG W C  C
Sbjct:  245 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 289          
BLAST of hypothetical protein vs. Ensembl Xenopus
Match: BAZ1A (bromodomain adjacent to zinc finger domain 1A [Source:NCBI gene;Acc:100497377])

HSP 1 Score: 69.3218 bits (168), Expect = 3.661e-11
Identity = 25/50 (50.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            ILN  C++C    +   ++LCD C+RG+HIYC+   L  +PEGDWFC EC
Sbjct: 1159 ILNARCKVCRKKGDGESMVLCDGCDRGHHIYCVRPKLKYVPEGDWFCPEC 1208          
BLAST of hypothetical protein vs. Ensembl Mouse
Match: Phrf1 (PHD and ring finger domains 1 [Source:MGI Symbol;Acc:MGI:2141847])

HSP 1 Score: 95.5153 bits (236), Expect = 2.329e-19
Identity = 46/135 (34.07%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +     G I KK    P+E     + + ++   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  104 DDAESCPICLNAFRDQAVGTPETCAHYFCLDCIIEWSRNANSCPVDRTVFKCICIRAQFNGKILKK---IPVENTKACEAEEED--PTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECT 233          
BLAST of hypothetical protein vs. Ensembl Mouse
Match: Dpf1 (D4, zinc and double PHD fingers family 1 [Source:MGI Symbol;Acc:MGI:1352748])

HSP 1 Score: 65.855 bits (159), Expect = 1.044e-10
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            +C +C    ND QLL CD+C+RGYH+YCL+ P++E PEG W C  C
Sbjct:  327 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 372          
BLAST of hypothetical protein vs. Ensembl Mouse
Match: Dpf1 (D4, zinc and double PHD fingers family 1 [Source:MGI Symbol;Acc:MGI:1352748])

HSP 1 Score: 65.855 bits (159), Expect = 1.059e-10
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            +C +C    ND QLL CD+C+RGYH+YCL+ P++E PEG W C  C
Sbjct:  328 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 373          
BLAST of hypothetical protein vs. Ensembl Mouse
Match: Baz1a (bromodomain adjacent to zinc finger domain 1A [Source:MGI Symbol;Acc:MGI:1309478])

HSP 1 Score: 66.2402 bits (160), Expect = 2.111e-10
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            ILN  C+IC    +   ++LCD C+RG+H YC+   L  +P+GDWFC EC
Sbjct: 1147 ILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPEC 1196          
BLAST of hypothetical protein vs. Ensembl Mouse
Match: Baz1a (bromodomain adjacent to zinc finger domain 1A [Source:MGI Symbol;Acc:MGI:1309478])

HSP 1 Score: 66.2402 bits (160), Expect = 2.128e-10
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            ILN  C+IC    +   ++LCD C+RG+H YC+   L  +P+GDWFC EC
Sbjct: 1144 ILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPEC 1193          
BLAST of hypothetical protein vs. UniProt/SwissProt
Match: sp|Q9P1Y6|PHRF1_HUMAN (PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 2.041e-19
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +    GG I +K    P+E   N     +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  103 DDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRK---IPVE---NTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 231          
BLAST of hypothetical protein vs. UniProt/SwissProt
Match: sp|A6H619|PHRF1_MOUSE (PHD and RING finger domain-containing protein 1 OS=Mus musculus OX=10090 GN=Phrf1 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 1.629e-18
Identity = 46/135 (34.07%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +     G I KK    P+E     + + ++   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  104 DDAESCPICLNAFRDQAVGTPETCAHYFCLDCIIEWSRNANSCPVDRTVFKCICIRAQFNGKILKK---IPVENTKACEAEEED--PTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECT 233          
BLAST of hypothetical protein vs. UniProt/SwissProt
Match: sp|Q63625|PHRF1_RAT (PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 2.204e-17
Identity = 48/136 (35.29%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  280 NDETQCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLN-GDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            +D   C IC + ++   V + ++C H FC +C+ +W    + CP+DR   K + +     G I KK    P+E      D + +E   T CE+C   + + +LLLCD C+ GYH+ CL  PL E+P  +WFC EC+
Sbjct:  104 DDAESCPICLNAFRDQAVGTPETCAHYFCLDCIIEWSRNANSCPVDRTIFKCICIRAQFNGKILKKI---PVENTRACEDEEAEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA 236          
BLAST of hypothetical protein vs. UniProt/SwissProt
Match: sp|Q8UVR5|BAZ1A_XENLA (Bromodomain adjacent to zinc finger domain protein 1A (Fragment) OS=Xenopus laevis OX=8355 GN=baz1a PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.462e-10
Identity = 25/50 (50.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            ILN  C++C    +   ++LCD C+RG+HIYC+   L  +PEGDWFC EC
Sbjct:  220 ILNARCKVCRKKGDGESMVLCDGCDRGHHIYCVRPKLKYVPEGDWFCPEC 269          
BLAST of hypothetical protein vs. UniProt/SwissProt
Match: sp|P58268|REQU_CHICK (Zinc finger protein ubi-d4 OS=Gallus gallus OX=9031 GN=REQ PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.794e-10
Identity = 27/45 (60.00%), Postives = 31/45 (68.89%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC    ND QLL CD+C+RGYH+YCL  P+SE PEG W C  C
Sbjct:  344 CNICGTSENDDQLLFCDDCDRGYHMYCLTPPMSEPPEGSWSCHLC 388          
BLAST of hypothetical protein vs. TrEMBL
Match: I1ZIE0 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 5.007e-87
Identity = 196/202 (97.03%), Postives = 197/202 (97.52%), Query Frame = 1
Query: 2083 TNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICXXXXXXXXXXXXXXDTKSSADKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKIMKRNNQSKTPGDQSIKDFSKKYLKFYLSKRK 2682
            TNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQ     HPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSS+DKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKIMKRNNQSKTPGDQSIKDFSKKYLKFYLSKRK
Sbjct:    2 TNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQQQPIIHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSSSDKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKIMKRNNQSKTPGDQSIKDFSKKYLKFYLSKRK 203          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A2H1BTK8 (PHD-finger OS=Fasciola hepatica OX=6192 GN=D915_14755 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 7.758e-44
Identity = 87/206 (42.23%), Postives = 120/206 (58.25%), Query Frame = 1
Query:   67 CILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPI--CNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C LC++ + +    P  C H FH  C  ++        E   CP   C   F +I    +K    L   V+   +  QC IC    ++PVA  +SC H+FC+ CL++W   +HECP+DR    L+LLSD  GG ITK+  PPP+ Q  +   D  E+L+T CE+C L NN+ +LLLCD+C+RGYH YCL++PLS IP GDWFC +C
Sbjct:   14 CPLCSEAIHNDNCSPKGCKHVFHSSCFENWTVAH-GSSEEYTCPAPHCTSTFFEIV--VRKIPHGLATKVVSLRESHQCPICCEPLQTPVAMPESCNHTFCYVCLREWSRVRHECPLDRGSFDLILLSDTIGGPITKRVAPPPVNQLPD---DPPEMLDTQCEVCGLSNNEDRLLLCDHCDRGYHTYCLSSPLSSIPPGDWFCPDC 213          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A504YQ69 (PHD and RING finger domain-containing protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_08827 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.475e-43
Identity = 88/206 (42.72%), Postives = 120/206 (58.25%), Query Frame = 1
Query:   67 CILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPI--CNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C LC++ + +    P  C H FH  C  ++        E   CP   C   F +I    +K    L   V+   +  QC IC    ++PVA  +SC H+FC+ CL++W   +HECP+DR    L+LLSD  GG ITK+  PPP+ Q  +   D  E+L+T CE+C L NN+ +LLLCD+C+RGYH YCL+NPLS IP GDWFC +C
Sbjct:   14 CPLCSEAIHNDNCSPKGCKHVFHSSCFENWTVAH-GSSEEYTCPAPHCTSTFFEIV--VRKIPHGLATKVVSLRESHQCPICCEPLQTPVAMPESCNHTFCYVCLREWSRVRHECPLDRGSFDLILLSDTIGGPITKRVAPPPVNQLPD---DPPEMLDTQCEVCGLSNNEDRLLLCDHCDRGYHTYCLSNPLSSIPPGDWFCPDC 213          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A0X3PVM7 (PHD and RING finger domain-containing protein 1 OS=Schistocephalus solidus OX=70667 GN=PHRF1 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 8.098e-43
Identity = 93/224 (41.52%), Postives = 124/224 (55.36%), Query Frame = 1
Query:   52 NRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPI--CNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTT-CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQILP 714
            N    C +C   +    S P+ CDH FH  CL+ +V+    K     CPI  C + F  I+ + K     + +N+ L+  ETQC IC    + PVA+ +SC H FCF CL +W   +HECP+DR   +L+L+S F GG I ++   PP  Q         E+ +TT CEIC+   ++  LLLCD C+RGYH YCL +PLS IPEGDWFC EC N        LP
Sbjct:   11 NGGGLCSICGDCIKAEHSSPSCCDHTFHVDCLKDWVETH-KKDSQATCPIESCGRTFTAISVR-KVMGGAVVRNISLAV-ETQCPICCEDIQPPVATPESCNHHFCFSCLNEWSKIRHECPLDRGSFELILISTFIGGPIVERRFAPPAYQP------PPEVEDTTACEICHSQEDEENLLLCDGCDRGYHTYCLPSPLSSIPEGDWFCPECDNSASTATPQLP 225          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A4E0QX63 (PHD and RING finger domain-containing protein 1 OS=Fasciola hepatica OX=6192 GN=D915_010108 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.193e-42
Identity = 87/206 (42.23%), Postives = 120/206 (58.25%), Query Frame = 1
Query:   67 CILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPI--CNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C LC++ + +    P  C H FH  C  ++        E   CP   C   F +I    +K    L   V+   +  QC IC    ++PVA  +SC H+FC+ CL++W   +HECP+DR    L+LLSD  GG ITK+  PPP+ Q  +   D  E+L+T CE+C L NN+ +LLLCD+C+RGYH YCL++PLS IP GDWFC +C
Sbjct:   14 CPLCSEAIHNDNCSPKGCKHVFHSSCFENWTVAH-GSSEEYTCPAPHCTSTFFEIV--VRKIPHGLATKVVSLRESHQCPICCEPLQTPVAMPESCNHTFCYVCLREWSRVRHECPLDRGSFDLILLSDTIGGPITKRVAPPPVNQLPD---DPPEMLDTQCEVCGLSNNEDRLLLCDHCDRGYHTYCLSSPLSSIPPGDWFCPDC 213          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: phrf1 (PHD and ring finger domains 1 [Source:ZFIN;Acc:ZDB-GENE-030131-624])

HSP 1 Score: 104.76 bits (260), Expect = 2.809e-22
Identity = 48/139 (34.53%), Postives = 79/139 (56.83%), Query Frame = 1
Query:  274 LSNDE--TQCCICFSKY-KSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            LS+DE   +C IC + + + PVA+ +SC H FC +C+ +W    + CP+DR+    +LL    GG + K  +     +    +  + ++  T+CE+C   + + +LLLCD C+ GYH+ CL  PL  +P  +WFC  C+
Sbjct:   95 LSSDEDAEKCPICLNSFHEQPVATPESCEHYFCLDCILEWAKNANSCPVDRIVFSNILLRKCHGGKVQKTIMVKKTAKATEEEQVDVDLEQTSCEVCGGSDREDRLLLCDGCDAGYHMECLTPPLDAVPVEEWFCPGCA 233          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:103024561])

HSP 1 Score: 78.1814 bits (191), Expect = 4.389e-14
Identity = 38/102 (37.25%), Postives = 58/102 (56.86%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQI--LPRGIRGLQHVIDNLQSRYTNGHQ--NHQNGNARSTRSRR 822
            I+  TC+ C  G+ND  LLLCD C+RG+H++CL   ++E+PEGDWFC  C     I   I   PR  R  +   +  + R+  G +  + + G  R+T +R+
Sbjct: 2326 IVRVTCQFCRKGDNDECLLLCDGCDRGWHMFCLKPKVTEVPEGDWFCPNC-----IAKGIGEGPRSPRSARQRTNARKRRFVYGAEASDEEEGQKRNTSTRQ 2422          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:103024561])

HSP 1 Score: 78.1814 bits (191), Expect = 4.730e-14
Identity = 38/102 (37.25%), Postives = 58/102 (56.86%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQI--LPRGIRGLQHVIDNLQSRYTNGHQ--NHQNGNARSTRSRR 822
            I+  TC+ C  G+ND  LLLCD C+RG+H++CL   ++E+PEGDWFC  C     I   I   PR  R  +   +  + R+  G +  + + G  R+T +R+
Sbjct: 2304 IVRVTCQFCRKGDNDECLLLCDGCDRGWHMFCLKPKVTEVPEGDWFCPNC-----IAKGIGEGPRSPRSARQRTNARKRRFVYGAEASDEEEGQKRNTSTRQ 2400          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: dpf2l (zinc finger protein ubi-d4 [Source:NCBI gene;Acc:103044730])

HSP 1 Score: 66.2402 bits (160), Expect = 6.601e-11
Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C +C    ND QLL CD+C+RGYH+YCL+ P+S+ PEG W C  C
Sbjct:  341 CNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSWSCRLC 385          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: dpf2l (zinc finger protein ubi-d4 [Source:NCBI gene;Acc:103044730])

HSP 1 Score: 66.2402 bits (160), Expect = 6.944e-11
Identity = 25/45 (55.56%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C +C    ND QLL CD+C+RGYH+YCL+ P+S+ PEG W C  C
Sbjct:  321 CNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSWSCRLC 365          
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004580.1 (pep scaffold:Pmarinus_7.0:GL479395:1031:10600:-1 gene:ENSPMAG00000004170.1 transcript:ENSPMAT00000004580.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 2.415e-19
Identity = 48/143 (33.57%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  274 LSNDET--QCCICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEIL-----NTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            LS+DE    C IC + ++   V   +SC H+FC +CL +W    + CP+DR P K++      GG + +    P  +Q  +   D+          T C  C L + + ++LLCD C+ G+H+ CL  PL  IP  +WFC  C
Sbjct:    2 LSSDEEGDSCPICLNGFRVQAVGIPESCQHAFCLDCLLEWAKNVNSCPVDRKPFKVISALSCFGGDVVRTIAVPNRKQKAHLWDDDGGSGGADEEETPCRACGLSDREERMLLCDACDAGFHMECLVPPLDSIPVEEWFCPTC 144          
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008781.1 (pep scaffold:Pmarinus_7.0:GL478673:190102:212513:-1 gene:ENSPMAG00000007949.1 transcript:ENSPMAT00000008781.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 2.744e-17
Identity = 44/139 (31.65%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  277 SNDETQCC-ICFSKYK-SPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNG---DGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            S+DE + C IC +  +   + + ++C H FC +C+ +W    + CP+DR     + +    GG + ++    P++  L     DG  +E   T CE+C   + + +LLLCD C+ GYH+ CL   L  +P  +WFC +C
Sbjct:   89 SDDEREGCPICLNGLRDQELGTPENCAHLFCLDCILEWAKNMNSCPVDRKVFTSVSVRACVGGPVLRQV---PVQDHLGAAKDDGQEEE--PTFCEVCRSSDREDRLLLCDGCDAGYHMECLDPALDTVPVEEWFCPQC 222          
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Match: dpf2 (D4, zinc and double PHD fingers family 2 [Source:ZFIN;Acc:ZDB-GENE-041024-2])

HSP 1 Score: 65.855 bits (159), Expect = 1.897e-11
Identity = 26/45 (57.78%), Postives = 31/45 (68.89%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C IC    ND QLL CD+C+RGYH+YCL+  +SE PEG W C  C
Sbjct:  346 CNICGTSENDDQLLFCDDCDRGYHMYCLSPAMSEPPEGSWSCRLC 390          
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 61.2326 bits (147), Expect = 1.357e-9
Identity = 21/45 (46.67%), Postives = 32/45 (71.11%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C +C  G+++ +LLLCD C+  YH +CL  PL ++P+GDW C +C
Sbjct:  323 CLVCGRGDDEAKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKC 367          
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 59.6918 bits (143), Expect = 3.240e-9
Identity = 25/56 (44.64%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFC-----EECSNDME 693
             C +C  G+ + +LLLCD C+  YH +CL  PL ++P+GDW C     EECS   E
Sbjct:  315 VCLVCGRGDEEDKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAEECSKPQE 370          
BLAST of hypothetical protein vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 59.3066 bits (142), Expect = 2.676e-9
Identity = 26/77 (33.77%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  448 FPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            +P   ++  E    +  D N   D +E  +  C +C   N+  + +LCD+C++ +HIYCL+ PL  +P GDW C  C
Sbjct:  206 YPKSLLSDDEDDFDLGPDSNSGSDFEEDDDDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSGDWICNTC 282          
BLAST of hypothetical protein vs. Ensembl Nematostella
Match: EDO44814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU7])

HSP 1 Score: 69.3218 bits (168), Expect = 1.320e-12
Identity = 26/50 (52.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            I+   C++C  G+N+  LLLCD C+RGYH YC    L+ IPEGDW+C +C
Sbjct:   97 IMKVFCQMCRKGDNEELLLLCDGCDRGYHTYCCMPKLTTIPEGDWYCMDC 146          
BLAST of hypothetical protein vs. Ensembl Nematostella
Match: EDO44054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWY0])

HSP 1 Score: 65.855 bits (159), Expect = 6.873e-12
Identity = 22/45 (48.89%), Postives = 33/45 (73.33%), Query Frame = 1
Query:  544 CEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            C++C    +  ++LLCD C+RG+H+YCL  P+  IPEG+WFC +C
Sbjct:    1 CKLCRRKGDAEKMLLCDACDRGHHMYCLKPPIKHIPEGNWFCPDC 45          
BLAST of hypothetical protein vs. Ensembl Nematostella
Match: EDO41238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z1])

HSP 1 Score: 64.6994 bits (156), Expect = 4.952e-11
Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            +C +C   +ND QLL CD+C+RGYH+YCL  P+ + PEG W C  C
Sbjct:  248 SCTLCGTSDNDDQLLFCDDCDRGYHMYCLNPPMDKPPEGHWMCSLC 293          
BLAST of hypothetical protein vs. Ensembl Nematostella
Match: EDO31764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX13])

HSP 1 Score: 53.1434 bits (126), Expect = 6.769e-9
Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            TC +C+ G   ++LLLCDNC+RGYH+ CL   L++ P+G W C  C
Sbjct:   33 TCHLCDTGEVQNELLLCDNCDRGYHMSCLDPKLTKAPKGAWHCVLC 78          
BLAST of hypothetical protein vs. Ensembl Nematostella
Match: EDO37588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA6])

HSP 1 Score: 55.0694 bits (131), Expect = 4.320e-8
Identity = 23/47 (48.94%), Postives = 32/47 (68.09%), Query Frame = 1
Query:  538 TTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            T CE C  G+++ +LLLCD+C+  YH YCL  PL ++P G W C+ C
Sbjct:   50 TLCEGCGKGSDEARLLLCDSCDISYHTYCLDPPLEKVPPGGWKCKWC 96          
BLAST of hypothetical protein vs. Ensembl Medaka
Match: phrf1 (PHD and ring finger domains 1 [Source:NCBI gene;Acc:101165783])

HSP 1 Score: 105.531 bits (262), Expect = 1.898e-22
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  259 FQNVILSNDETQCCICFSKY-KSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQ 705
            F  +    D  +C IC + + + PVA+ ++C H FCF+C+ +W    + CP+DR     + +    GG + K        Q    D  + ++  T CE+C   + + +LLLCD C+ GYH+ CL  PL  +P  +WFC EC    E  NQ
Sbjct:   92 FTGISSDEDSEKCPICLNTFSEQPVATPENCEHYFCFDCILEWTKNANSCPVDRTTFNSIYIRKCYGGKVKKMVTVQKPAQKSQEDAVDLDLEQTNCEVCGGSDREDRLLLCDGCDAGYHMECLTPPLDSVPVEEWFCPEC----EATNQ 237          
BLAST of hypothetical protein vs. Ensembl Medaka
Match: phrf1 (PHD and ring finger domains 1 [Source:NCBI gene;Acc:101165783])

HSP 1 Score: 105.145 bits (261), Expect = 2.076e-22
Identity = 50/150 (33.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  259 FQNVILSNDETQCCICFSKY-KSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQ 705
            F  +    D  +C IC + + + PVA+ ++C H FCF+C+ +W    + CP+DR     + +    GG + K        Q    D  + ++  T CE+C   + + +LLLCD C+ GYH+ CL  PL  +P  +WFC EC    E  NQ
Sbjct:   92 FTGISSDEDSEKCPICLNTFSEQPVATPENCEHYFCFDCILEWTKNANSCPVDRTTFNSIYIRKCYGGKVKKMVTVQKPAQKSQEDAVDLDLEQTNCEVCGGSDREDRLLLCDGCDAGYHMECLTPPLDSVPVEEWFCPEC----EATNQ 237          
BLAST of hypothetical protein vs. Ensembl Medaka
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:101161807])

HSP 1 Score: 73.559 bits (179), Expect = 1.268e-12
Identity = 27/51 (52.94%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            I   TC++C  G+ND  LLLCD+C+RG H+YCL   ++++PEGDWFC  C+
Sbjct: 2431 ITKVTCQVCRKGDNDECLLLCDSCDRGCHMYCLKPKITQVPEGDWFCPTCT 2481          
BLAST of hypothetical protein vs. Ensembl Medaka
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:101161807])

HSP 1 Score: 73.559 bits (179), Expect = 1.268e-12
Identity = 27/51 (52.94%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  529 ILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECS 681
            I   TC++C  G+ND  LLLCD+C+RG H+YCL   ++++PEGDWFC  C+
Sbjct: 2431 ITKVTCQVCRKGDNDECLLLCDSCDRGCHMYCLKPKITQVPEGDWFCPTCT 2481          
BLAST of hypothetical protein vs. Ensembl Medaka
Match: dpf1 (double PHD fingers 1 [Source:NCBI gene;Acc:101156029])

HSP 1 Score: 67.3958 bits (163), Expect = 2.225e-11
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1
Query:  541 TCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDME 693
            +C +C    ND QLL CD+C+RGYH+YCL+ P+SE PEG W C  C   ++
Sbjct:  283 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMSEPPEGSWSCHLCLRQLK 333          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 843/850 (99.18%), Postives = 847/850 (99.65%), Query Frame = 1
Query:   43 YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQN-GNARSTRSRRNQTRAQHXXXXXXXXXXXXLPRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQTRSRRRXXXXXXXXXXXXXXXXXNLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKXXXXXXXXXXXAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMXXXXXXXXXXXXXXXXXVGNSRKRKIIXXXXXXXXXXXXXXNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPIXXXXXXXXXXXXXXCAPSTSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICXXXXXXXXXXXXXXDTKSSADKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKI 2589
            YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLA+PLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQN GNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNS QTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNS+KRKIIESSDSSDYS EESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSSKRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSS+DKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQK+
Sbjct:    8 YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLADPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQNQGNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNSLQTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNSKKRKIIESSDSSDYSAEESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSSKRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSSSDKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKV 857          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 1224.15 bits (3166), Expect = 0.000e+0
Identity = 843/850 (99.18%), Postives = 847/850 (99.65%), Query Frame = 1
Query:   43 YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQN-GNARSTRSRRNQTRAQHXXXXXXXXXXXXLPRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQTRSRRRXXXXXXXXXXXXXXXXXNLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKXXXXXXXXXXXAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMXXXXXXXXXXXXXXXXXVGNSRKRKIIXXXXXXXXXXXXXXNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPIXXXXXXXXXXXXXXCAPSTSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICXXXXXXXXXXXXXXDTKSSADKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKI 2589
            YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLA+PLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQN GNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNS QTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNS+KRKIIESSDSSDYS EESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSSKRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSS+DKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQK+
Sbjct:    4 YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLADPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQNQGNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNSLQTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNSKKRKIIESSDSSDYSAEESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSSKRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSSSDKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKV 853          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 1224.15 bits (3166), Expect = 0.000e+0
Identity = 843/850 (99.18%), Postives = 847/850 (99.65%), Query Frame = 1
Query:   43 YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQN-GNARSTRSRRNQTRAQHXXXXXXXXXXXXLPRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQTRSRRRXXXXXXXXXXXXXXXXXNLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKXXXXXXXXXXXAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMXXXXXXXXXXXXXXXXXVGNSRKRKIIXXXXXXXXXXXXXXNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPIXXXXXXXXXXXXXXCAPSTSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICXXXXXXXXXXXXXXDTKSSADKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKI 2589
            YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLA+PLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQN GNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNS QTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNS+KRKIIESSDSSDYS EESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSSKRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSS+DKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQK+
Sbjct:    5 YDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNRLDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLADPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYTNGHQNHQNQGNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNSLQTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNSKKRKIIESSDSSDYSAEESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSSKRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSSSDKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKV 854          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000045177.1 (SMESG000045177.1)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 573/599 (95.66%), Postives = 585/599 (97.66%), Query Frame = 1
Query:  793 GNARSTRSRRNQTRAQHXXXXXXXXXXXXLPRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQTRSRRRXXXXXXXXXXXXXXXXXNLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKXXXXXXXXXXXAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMXXXXXXXXXXXXXXXXXVGNSRKRKIIXXXXXXXXXXXXXXNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPIXXXXXXXXXXXXXXCAPSTSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICXXXXXXXXXXXXXXDTKSSADKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKI 2589
            GNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNSPQTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNS+KRKIIESSDSSDYS EESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSK SK ++ ++ ++  + K  K ++   PTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSS+DKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQK+
Sbjct:    5 GNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDVRVTRSRRNRVVNSNVTSSVSDNSPQTRSRRRVIEDSEEEQETVVVENENLSNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESDSYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPRMIDESSESSDEDSSESIIVGNSKKRKIIESSDSSDYSAEESDNYTNTVDEEEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYPISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKRSKSARKSKSARVKKRKSTKRSR---PTISTHSLDIGNSMTLSIFGREKQLPVVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVVRLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHHQHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSASNVSNSGQSAVDTKSSSDKHIANITNTIKRFLNIYTEKGEITHDENKNLSERITQKV 600          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.063e-12
Identity = 29/58 (50.00%), Postives = 37/58 (63.79%), Query Frame = 1
Query:  505 NGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLANPLSEIPEGDWFCEEC 678
            N    +  I+   C+IC    N+ QLLLCD+C++GYH YC   PLS IPEG WFC +C
Sbjct: 1517 NAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC 1574          
The following BLAST results are available for this feature:
BLAST of hypothetical protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHRF14.176e-2035.56PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF14.176e-2035.56PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF14.177e-2035.56PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF14.213e-2035.56PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF14.248e-2035.56PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-166.918e-950.00Histone-lysine N-methyltransferase [Source:UniPro... [more]
dpff-14.968e-845.65Zinc finger protein dpff-1 [Source:UniProtKB/Swis... [more]
phf-141.868e-730.30PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
chd-37.172e-746.67Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
let-4181.089e-647.92pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29261.945e-1833.33gene:FBgn0037344 transcript:FBtr0336762[more]
CG29264.597e-1833.33gene:FBgn0037344 transcript:FBtr0078752[more]
tou9.584e-1248.08gene:FBgn0033636 transcript:FBtr0088091[more]
d43.557e-1157.78gene:FBgn0033015 transcript:FBtr0111115[more]
d45.074e-1157.78gene:FBgn0033015 transcript:FBtr0086083[more]
back to top
BLAST of hypothetical protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phrf18.538e-2338.03PHD and ring finger domains 1 [Source:ZFIN;Acc:ZDB... [more]
phrf12.417e-2238.03PHD and ring finger domains 1 [Source:ZFIN;Acc:ZDB... [more]
dpf12.433e-1156.52D4, zinc and double PHD fingers family 1 [Source:Z... [more]
baz2a2.869e-1148.00bromodomain adjacent to zinc finger domain, 2A [So... [more]
baz1a4.328e-1145.61bromodomain adjacent to zinc finger domain, 1A [So... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHRF14.873e-2135.51PHD and ring finger domains 1 [Source:NCBI gene;Ac... [more]
dpf23.383e-1157.78double PHD fingers 2 [Source:NCBI gene;Acc:1001260... [more]
dpf23.457e-1157.78double PHD fingers 2 [Source:NCBI gene;Acc:1001260... [more]
dpf23.555e-1157.78double PHD fingers 2 [Source:NCBI gene;Acc:1001260... [more]
BAZ1A3.661e-1150.00bromodomain adjacent to zinc finger domain 1A [Sou... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phrf12.329e-1934.07PHD and ring finger domains 1 [Source:MGI Symbol;A... [more]
Dpf11.044e-1054.35D4, zinc and double PHD fingers family 1 [Source:M... [more]
Dpf11.059e-1054.35D4, zinc and double PHD fingers family 1 [Source:M... [more]
Baz1a2.111e-1048.00bromodomain adjacent to zinc finger domain 1A [Sou... [more]
Baz1a2.128e-1048.00bromodomain adjacent to zinc finger domain 1A [Sou... [more]
back to top
BLAST of hypothetical protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P1Y6|PHRF1_HUMAN2.041e-1935.56PHD and RING finger domain-containing protein 1 OS... [more]
sp|A6H619|PHRF1_MOUSE1.629e-1834.07PHD and RING finger domain-containing protein 1 OS... [more]
sp|Q63625|PHRF1_RAT2.204e-1735.29PHD and RING finger domain-containing protein 1 OS... [more]
sp|Q8UVR5|BAZ1A_XENLA1.462e-1050.00Bromodomain adjacent to zinc finger domain protein... [more]
sp|P58268|REQU_CHICK1.794e-1060.00Zinc finger protein ubi-d4 OS=Gallus gallus OX=903... [more]
back to top
BLAST of hypothetical protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIE05.007e-8797.03Uncharacterized protein (Fragment) OS=Schmidtea me... [more]
A0A2H1BTK87.758e-4442.23PHD-finger OS=Fasciola hepatica OX=6192 GN=D915_14... [more]
A0A504YQ694.475e-4342.72PHD and RING finger domain-containing protein 1 OS... [more]
A0A0X3PVM78.098e-4341.52PHD and RING finger domain-containing protein 1 OS... [more]
A0A4E0QX631.193e-4242.23PHD and RING finger domain-containing protein 1 OS... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phrf12.809e-2234.53PHD and ring finger domains 1 [Source:ZFIN;Acc:ZDB... [more]
baz2a4.389e-1437.25bromodomain adjacent to zinc finger domain 2A [Sou... [more]
baz2a4.730e-1437.25bromodomain adjacent to zinc finger domain 2A [Sou... [more]
dpf2l6.601e-1155.56zinc finger protein ubi-d4 [Source:NCBI gene;Acc:1... [more]
dpf2l6.944e-1155.56zinc finger protein ubi-d4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004580.12.415e-1933.57pep scaffold:Pmarinus_7.0:GL479395:1031:10600:-1 g... [more]
ENSPMAT00000008781.12.744e-1731.65pep scaffold:Pmarinus_7.0:GL478673:190102:212513:-... [more]
dpf21.897e-1157.78D4, zinc and double PHD fingers family 2 [Source:Z... [more]
kdm5c1.357e-946.67lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
kdm5c3.240e-944.64lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
JHD22.676e-933.77JmjC domain family histone demethylase; promotes g... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448141.320e-1252.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440546.873e-1248.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412384.952e-1152.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317646.769e-950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375884.320e-848.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phrf11.898e-2233.33PHD and ring finger domains 1 [Source:NCBI gene;Ac... [more]
phrf12.076e-2233.33PHD and ring finger domains 1 [Source:NCBI gene;Ac... [more]
baz2a1.268e-1252.94bromodomain adjacent to zinc finger domain 2A [Sou... [more]
baz2a1.268e-1252.94bromodomain adjacent to zinc finger domain 2A [Sou... [more]
dpf12.225e-1150.98double PHD fingers 1 [Source:NCBI gene;Acc:1011560... [more]
back to top
BLAST of hypothetical protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045165.10.000e+099.18SMESG000045165.1[more]
SMESG000045165.10.000e+099.18SMESG000045165.1[more]
SMESG000045165.10.000e+099.18SMESG000045165.1[more]
SMESG000045177.10.000e+095.66SMESG000045177.1[more]
SMESG000068165.17.063e-1250.00SMESG000068165.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000968
GenBankAFJ24794.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000968 ID=SMED30000968|Name=hypothetical protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3093bp
CGTTTTATATAAAATTGAATGATGCTATCCATGATGTCTATGTACGATCA
AAATCGTAACGATCATTGTATACTATGTAACAAAATTTTAGCTGATATTA
AATCATATCCCAATGTTTGTGATCATTACTTTCATTACAAATGTCTTCGA
AGTTATGTTGACAATAGGTTAGATAAATGTGAATCAATCGTTTGCCCGAT
TTGTAACAAAATATTCAATCAAATTGCTAACAAATTTAAAAAGTCTAAAG
ATATTTTGTTCCAAAATGTTATCTTGTCAAATGATGAAACTCAGTGTTGT
ATTTGTTTTTCCAAATATAAAAGCCCAGTAGCATCCACTGATTCATGTAC
TCATTCGTTTTGTTTCGAATGCTTAAAAAAGTGGTGTACTTTTAAGCACG
AATGCCCAATGGATCGTATGCCCATCAAACTTTTATTATTAAGTGATTTC
CCAGGAGGTCATATTACTAAAAAAGAAGTTCCACCGCCGATTGAACAGGA
CTTAAATGGAGACGGAGATAATGATGAAATTCTCAACACTACTTGCGAGA
TATGTAATTTGGGTAATAATGATCATCAACTTCTACTTTGTGATAACTGC
AATCGTGGTTATCACATCTACTGTTTGGCAAATCCATTATCAGAAATTCC
AGAAGGTGATTGGTTTTGCGAAGAGTGTTCTAACGACATGGAAATTAACA
ATCAAATACTTCCTCGGGGGATTAGGGGATTGCAACATGTTATCGATAAT
TTGCAATCCAGATATACAAACGGCCATCAGAATCATCAGAATGGAAATGC
ACGATCAACGCGAAGTCGACGAAATCAAACAAGAGCTCAACATGATTCTA
GCGATGAAAGCGACTGGAGTAGTGAATCATTACCGAGACCTCGCACCAGA
AGGCAAACAACGGATGTGAGGGTCACGAGGTCACGTAGGAATAGAGTGGT
AAATTCAAACGTAACAAGTTCTGTTAGTGATAATTCACCTCAGACAAGGA
GTAGGAGACGAGTAATTGAAGATTCTGAGGAAGAACAAGAGACAGTTGTA
GTAGAAAACGAGAATTTAAGTAATCCCTCAGTATCAAATACATATAATGA
CGAAAGCTCATCACCTAAAGGTGAGACTGCTGCCAAAAGACGTAATAGGC
AGGGTTCATTAAGCTCCGAAGCCGAATCTGAGATGGATCAAGCAAGAAGA
AAAAGCGAAGAGAGCGATAGCTATGAGGAAAGTAGTGCCCCGACTTCTGA
TGACGAGTCAGTTACTAGTTTACAACCTATTGTCCGTAAAAGAGGACGAG
CTCAAACTCACAGTTCTTTTGCAGTGGAAGAGGACAGTCCACTGCCGAGA
CCCATTAAACGACCGCGTATGATAGACGAAAGTTCTGAAAGCAGCGATGA
AGATTCCAGTGAATCTATAATAGTTGGAAACTCGAGAAAGCGCAAAATTA
TCGAAAGTAGTGATTCAAGCGATTATTCACCTGAGGAAAGTGACAATTAT
ACAAACACTGTCGACGAAGAAGAAGAAAGAAAAAGAAATTTTTCCACGTC
TTCTTCTTTGTCAACAATTCCTTGTCGACTTCCTTTGGCTAGTACGTCGC
ATGCTCCATCTGTAACCGCTGCTTCACCAGGAGTCAGACCATCCAGATAT
CGATCGATGAAATATCCCATATCAGACAGCACTGACAGTGATCTATCTAA
CGACTTGAATTCCTGTGCACCATCGACATCGCAACGGCGGTCAGCGGCCA
GACACTGTAAGGCAAAAAAGCGAAAAACTGCTACAAAAAAAACTTCGAAA
AAATCTTCGAAATCTTCCAAAAGGAGTAAATCCGCAAGGAAAAGTAAATC
GGCTCGGGTTAAGAAAAGGAAGTCCACTAAAAGATCTCGACCAACTATAT
CAACTCACAGTTTGGACATCGGTAATTCGATGACACTCAGTATTTTTGGC
CGCGAGAAGCAGTTGCCAGTGGTCACGGATGAGGAATTGAGTATCAAACG
GGTGGCGACAGCACCGGCGATTTCTGCCGTTAGACCAAACCCTTCCAGTA
ACAGCATTCTATCAGAAATCAATGAAGCTCAAACAAATTTTCGCCACATC
AGTTTATCGACAGTTGTGCGATTGTCTGACGGCACGTTGATTCACAAATC
TCGAACCGAGCCCAATGTTTCCAGTGAAAACAAAGACCCGCAACACACTA
AGAATGTTCCATCGACCTCAAGTTCACAACCTCAATCATCTTCCTCCGTG
TCAACCACAGTTCACCACCAGCATAGCCATCAGCTACAACAACAACCAAT
CAGTCACCCAAAACCGACTACAGCCCGCCCAAAACCTCCTGTCCAGATTG
TCCATCCAATGACTGAATCTACCCCAATTCCGAAACCTGCCAATCAAATT
CCAATTTGTTCATCAGCTAGCAATGTCAGTAACTCAGGTCAGTCTGCTGT
CGATACAAAATCATCGGCAGATAAGCATATCGCCAATATCACAAACACAA
TCAAGAGATTCCTCAACATATACACTGAAAAAGGAGAAATCACCCACGAC
GAAAACAAAAATCTTTCGGAGCGAATTACACAAAAAATAATGAAGAGAAA
TAATCAAAGTAAAACTCCAGGAGATCAAAGTATCAAGGACTTCTCAAAAA
AATATCTTAAATTCTATTTGTCAAAACGAAAATAATGCTCAAATATTGTT
TTATTCTTTTTTTAAAACAAAATGTGCCTCAACCAAAGCCCTCTTTCTTT
CAAAAAAATTGATGAGTTTTATTGTGTTTTTCGTAAATTTCTTTTATTTC
AAATTATTTTTGCCGATTGAATTGTTTTGCTGCGACAAACCTACGAATCT
AGTATTAATATTATCTTCCGCAATTATAATATTATTATTATTTGACAAGT
GATTCTTGTCAGAATAATCCAGGAAAGACGCAAACATGGAAATTCTTGCG
TCACAGCTAAATTGCTATTGTATTATAATTATGTAAATATAAATATGGTG
AAAAATAATAATAATTTTCACAATAGTTATTTTTATTTTCAAAAAATATT
ACATTACTCTAAATATACTTTTAATTGTCTAAAAAAAAAGATC
back to top

protein sequence of SMED30000968-orf-1

>SMED30000968-orf-1 ID=SMED30000968-orf-1|Name=SMED30000968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=889bp
MMLSMMSMYDQNRNDHCILCNKILADIKSYPNVCDHYFHYKCLRSYVDNR
LDKCESIVCPICNKIFNQIANKFKKSKDILFQNVILSNDETQCCICFSKY
KSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHIT
KKEVPPPIEQDLNGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHI
YCLANPLSEIPEGDWFCEECSNDMEINNQILPRGIRGLQHVIDNLQSRYT
NGHQNHQNGNARSTRSRRNQTRAQHDSSDESDWSSESLPRPRTRRQTTDV
RVTRSRRNRVVNSNVTSSVSDNSPQTRSRRRVIEDSEEEQETVVVENENL
SNPSVSNTYNDESSSPKGETAAKRRNRQGSLSSEAESEMDQARRKSEESD
SYEESSAPTSDDESVTSLQPIVRKRGRAQTHSSFAVEEDSPLPRPIKRPR
MIDESSESSDEDSSESIIVGNSRKRKIIESSDSSDYSPEESDNYTNTVDE
EEERKRNFSTSSSLSTIPCRLPLASTSHAPSVTAASPGVRPSRYRSMKYP
ISDSTDSDLSNDLNSCAPSTSQRRSAARHCKAKKRKTATKKTSKKSSKSS
KRSKSARKSKSARVKKRKSTKRSRPTISTHSLDIGNSMTLSIFGREKQLP
VVTDEELSIKRVATAPAISAVRPNPSSNSILSEINEAQTNFRHISLSTVV
RLSDGTLIHKSRTEPNVSSENKDPQHTKNVPSTSSSQPQSSSSVSTTVHH
QHSHQLQQQPISHPKPTTARPKPPVQIVHPMTESTPIPKPANQIPICSSA
SNVSNSGQSAVDTKSSADKHIANITNTIKRFLNIYTEKGEITHDENKNLS
ERITQKIMKRNNQSKTPGDQSIKDFSKKYLKFYLSKRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019786Zinc_finger_PHD-type_CS
IPR017907Znf_RING_CS
IPR011011Znf_FYVE_PHD
IPR001841Znf_RING
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 175..219
e-value: 0.99
score: 11.3
coord: 16..61
e-value: 0.17
score: 17.8
coord: 92..131
e-value: 0.029
score: 23.5
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 91..132
e-value: 1.9E-6
score: 28.1
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 16..62
score: 10.394
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 92..132
score: 12.12
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 15..62
e-value: 9.4
score: 6.3
coord: 174..220
e-value: 1.6E-12
score: 57.6
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 4..86
e-value: 2.8E-7
score: 32.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 146..230
e-value: 1.2E-20
score: 75.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 87..141
e-value: 6.1E-10
score: 40.3
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 175..221
e-value: 6.2E-12
score: 45.2
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 172..222
score: 10.647
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 508..532
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 249..628
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 344..365
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 440..456
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 268..305
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 575..620
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 249..266
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 547..574
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 708..768
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 718..761
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..401
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 306..325
NoneNo IPR availablePANTHERPTHR12618FAMILY NOT NAMEDcoord: 82..328
NoneNo IPR availableCDDcd15543PHD_RSF1coord: 175..219
e-value: 1.36429E-19
score: 80.7764
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 85..138
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 10..69
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 175..219
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 109..118
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 167..225