DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30000967
Length (bp)678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30000967) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30000967) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30000967) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30000967) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000967

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30000967SMESG000068156.1 SMESG000064685.1 SMESG000010609.1 SMESG000076470.1 SMESG000073857.1 SMESG000062429.1 SMESG000060487.1 SMESG000058575.1 SMESG000053533.1 SMESG000026676.1 SMESG000020635.1 SMESG000015751.1 SMESG000005260.1 Contig239GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000967SMESG000068156.1 SMESG000064685.1 SMESG000010609.1 SMESG000076470.1 SMESG000073857.1 SMESG000062429.1 SMESG000060487.1 SMESG000058575.1 SMESG000053533.1 SMESG000026676.1 SMESG000020635.1 SMESG000015751.1 SMESG000005260.1 Contig239GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30000967SMESG000057816.1 Contig239GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000967SMESG000057816.1 Contig239GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30000967SMESG000057816.1 dd_Smed_v4_87_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000967SMESG000057816.1 dd_Smed_v4_87_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30000967SMESG000057816.1 dd_Smed_v6_87_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30000967SMESG000057816.1 dd_Smed_v6_87_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000967SMESG000057816.1 dd_Smed_v6_87_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30000967SMESG000057816.1 dd_Smed_v6_87_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 92.0485 bits (227), Expect = 5.100e-22
Identity = 54/141 (38.30%), Postives = 75/141 (53.19%), Query Frame = 3
Query:  114 WLPGEYGQVPPNAVQ----ADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEV 524
            W+P   G+VPPNA++    +   LYI RAR +GD+  GK    H   +  + G E     YEVLC  G         W  +  G +P NA+  G T+  EPL+I RA   G + VGKV  SH C ++PYGG+E    ++E+
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGG-------GQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          

HSP 2 Score: 57.7658 bits (138), Expect = 1.206e-9
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 3
Query:  333 WQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            W    NG VP NA+ GG  S+ E LYIARAR  G++  GK+  SH   ++ +GG EH   +YEVLC
Sbjct:  159 WVPAANGEVPPNALEGGFDSS-EQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC 223          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 85.8853 bits (211), Expect = 7.869e-20
Identity = 51/140 (36.43%), Postives = 74/140 (52.86%), Query Frame = 3
Query:  129 YGQVPPNAVQA------DPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            YG +PP A+ A      DP +++ RA  +G++   K   G Q  + P+ G+E     +EVL        G  F W     G+VP +A+  G T   EPLY+ R    G +  GKV  SH+C ++PYGG+EH++  YEVL 
Sbjct:   12 YGSLPPGAILAGHDSDQDP-IFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 78.9518 bits (193), Expect = 2.837e-17
Identity = 52/147 (35.37%), Postives = 73/147 (49.66%), Query Frame = 3
Query:  108 LSWLPGEYGQVPPNAVQ------ADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
             SW+P   G VPP+A+Q       +P LY+ R    G +T GK    HQ  + PY G+E  +  YEVL      +  S       G G VP   VVGGH +  + +Y+ RA   G++   KV  +  C ++PYGG E   + YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEP-LYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPETWIASS-------GRGIVP-GTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 76.2554 bits (186), Expect = 2.466e-16
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  171 LYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            +Y+ RA  +GD+   K        + PY G E +   YE+L   G       + W +  +G VP NAV+ G TS  EPL+I RA  HG +  GK+  SH C ++P+ G+E ++  YEVL 
Sbjct:  172 IYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYG-------YGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 85.8853 bits (211), Expect = 7.869e-20
Identity = 51/140 (36.43%), Postives = 74/140 (52.86%), Query Frame = 3
Query:  129 YGQVPPNAVQA------DPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            YG +PP A+ A      DP +++ RA  +G++   K   G Q  + P+ G+E     +EVL        G  F W     G+VP +A+  G T   EPLY+ R    G +  GKV  SH+C ++PYGG+EH++  YEVL 
Sbjct:   12 YGSLPPGAILAGHDSDQDP-IFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 78.9518 bits (193), Expect = 2.837e-17
Identity = 52/147 (35.37%), Postives = 73/147 (49.66%), Query Frame = 3
Query:  108 LSWLPGEYGQVPPNAVQ------ADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
             SW+P   G VPP+A+Q       +P LY+ R    G +T GK    HQ  + PY G+E  +  YEVL      +  S       G G VP   VVGGH +  + +Y+ RA   G++   KV  +  C ++PYGG E   + YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEP-LYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPETWIASS-------GRGIVP-GTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 76.2554 bits (186), Expect = 2.466e-16
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  171 LYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            +Y+ RA  +GD+   K        + PY G E +   YE+L   G       + W +  +G VP NAV+ G TS  EPL+I RA  HG +  GK+  SH C ++P+ G+E ++  YEVL 
Sbjct:  172 IYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYG-------YGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 75.0998 bits (183), Expect = 6.584e-16
Identity = 51/146 (34.93%), Postives = 68/146 (46.58%), Query Frame = 3
Query:  108 LSWLPGEYGQVPPNAVQA------DPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVL 527
             +W+P   G VPPNAV++      +P LY+ R    G +TVGK    H   + P+ G+E  +  YEVL      VW              P  AV+ GH S   P+Y  RA   GEM   KV  S    ++ +GG E +   YEVL
Sbjct:   75 FAWVPSSSGGVPPNAVRSGTTRTGEP-LYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHDVWVP------ASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 213          

HSP 2 Score: 72.4034 bits (176), Expect = 6.400e-15
Identity = 49/138 (35.51%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  129 YGQVPPNAV-----QADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVL 527
            Y  +PP AV          +Y+ R+  +G+    K        +  Y G E     YEVL   G       F W    +G VP NAV  G T T EPLY+ R    G + VGKV  SH C ++P+GG+E ++  YEVL
Sbjct:   11 YSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQG-------FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 141          

HSP 3 Score: 68.9366 bits (167), Expect = 1.405e-13
Identity = 45/144 (31.25%), Postives = 67/144 (46.53%), Query Frame = 3
Query:  114 WLPGEYGQVPPNAVQA-----DPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            W+P      PP AV A        +Y  RA  +G++   K      + +  + G E   P YEVL   G +VW +  H       ++P NAV  G     E LY  R    G +  G ++ S +C ++PYGG+E ++  YE+LC
Sbjct:  149 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYG-YVWMNCGH-------SIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 75.0998 bits (183), Expect = 7.236e-16
Identity = 51/146 (34.93%), Postives = 68/146 (46.58%), Query Frame = 3
Query:  108 LSWLPGEYGQVPPNAVQA------DPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVL 527
             +W+P   G VPPNAV++      +P LY+ R    G +TVGK    H   + P+ G+E  +  YEVL      VW              P  AV+ GH S   P+Y  RA   GEM   KV  S    ++ +GG E +   YEVL
Sbjct:   86 FAWVPSSSGGVPPNAVRSGTTRTGEP-LYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHDVWVP------ASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 224          

HSP 2 Score: 72.7886 bits (177), Expect = 6.187e-15
Identity = 49/138 (35.51%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  129 YGQVPPNAV-----QADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVL 527
            Y  +PP AV          +Y+ R+  +G+    K        +  Y G E     YEVL   G       F W    +G VP NAV  G T T EPLY+ R    G + VGKV  SH C ++P+GG+E ++  YEVL
Sbjct:   22 YSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQG-------FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 152          

HSP 3 Score: 68.9366 bits (167), Expect = 1.451e-13
Identity = 45/144 (31.25%), Postives = 67/144 (46.53%), Query Frame = 3
Query:  114 WLPGEYGQVPPNAVQA-----DPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLC 530
            W+P      PP AV A        +Y  RA  +G++   K      + +  + G E   P YEVL   G +VW +  H       ++P NAV  G     E LY  R    G +  G ++ S +C ++PYGG+E ++  YE+LC
Sbjct:  160 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYG-YVWMNCGH-------SIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A2H1CPU9 (DUF3421 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_03029 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.801e-42
Identity = 76/150 (50.67%), Postives = 96/150 (64.00%), Query Frame = 3
Query:   93 GRQISLSWLPG-EYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
             R++SLSWLP   + Q PPNAV A PGL+++R R + DV  GK      SGF P+ GRE  V  +EVLC+T L+   + + W   G G VPHNAV GG T + EPLYIAR  ++ E CVGKV  SH C + P+GG EH   +YEVLCY +
Sbjct:    8 AREVSLSWLPVYPHTQPPPNAVAAQPGLFVIRGRENVDVLPGKWPAQVGSGFIPFDGREKPVSSFEVLCNTSLYQDSTPYTWIPSGRGDVPHNAVQGGITESMEPLYIARGLVNNEWCVGKVHPSHGCAYFPWGGGEHSSQQYEVLCYTN 157          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4E0RKT4 (DM9 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002121 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.118e-42
Identity = 76/150 (50.67%), Postives = 96/150 (64.00%), Query Frame = 3
Query:   93 GRQISLSWLPG-EYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
             R++SLSWLP   + Q PPNAV A PGL+++R R + DV  GK      SGF P+ GRE  V  +EVLC+T L+   + + W   G G VPHNAV GG T + EPLYIAR  ++ E CVGKV  SH C + P+GG EH   +YEVLCY +
Sbjct:   59 AREVSLSWLPVYPHTQPPPNAVAAQPGLFVIRGRENVDVLPGKWPAQVGSGFIPFDGREKPVSSFEVLCNTSLYQDSTPYTWIPSGRGDVPHNAVQGGITESMEPLYIARGLVNNEWCVGKVHPSHGCAYFPWGGGEHSSQQYEVLCYTN 208          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A504YBL5 (DM9 domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_11523 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 7.074e-42
Identity = 76/150 (50.67%), Postives = 96/150 (64.00%), Query Frame = 3
Query:   93 GRQISLSWLPG-EYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
             R+ SLSWLP   + Q PPNAV A PGLY++R R + DV  GK      SGF P+ GRE  V  +EVLC+T L+     + W   G G VPH+AV GG T + EPLYIAR  ++ E CVGKV  SH C + P+GG+EH + +YEVLCY +
Sbjct:    8 AREASLSWLPVYPHTQPPPNAVAAQPGLYVIRGRENVDVLPGKWLAQVGSGFIPFDGREKPVSSFEVLCNTSLYQDSMPYTWIPSGGGNVPHDAVQGGITESMEPLYIARGMVNNEWCVGKVHPSHGCAYFPWGGEEHSLQQYEVLCYTN 157          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4E0S3C5 (DM9 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002120 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.051e-39
Identity = 69/148 (46.62%), Postives = 91/148 (61.49%), Query Frame = 3
Query:   99 QISLSWLPG-EYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            ++SLSW+P       PPNAV+A PGL ++R R   DV  GK     +  + PY GRE     +EVLC+T L+     + W   G G +P  A+ GG T T EPLYIARA ++GE CVGKV  SH C + P+GG EH + +YE+LCYR+
Sbjct:   15 EVSLSWIPAFSNSSPPPNAVEAKPGLIVIRVREVSDVLPGKWPTEAECAYIPYGGREKSANSFEVLCNTSLYSERDPYTWIPSGAGYIPTEAIQGGVTETMEPLYIARAMVNGEWCVGKVHPSHDCAYFPWGGGEHALQQYELLCYRN 162          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A2H1CPX5 (DUF3421 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_03028 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.997e-39
Identity = 69/148 (46.62%), Postives = 91/148 (61.49%), Query Frame = 3
Query:   99 QISLSWLPG-EYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            ++SLSW+P       PPNAV+A PGL ++R R   DV  GK     +  + PY GRE     +EVLC+T L+     + W   G G +P  A+ GG T T EPLYIARA ++GE CVGKV  SH C + P+GG EH + +YE+LCYR+
Sbjct:   41 EVSLSWIPAFSNSSPPPNAVEAKPGLIVIRVREVSDVLPGKWPTEAECAYIPYGGREKSANSFEVLCNTSLYSERDPYTWIPSGAGYIPTEAIQGGVTETMEPLYIARAMVNGEWCVGKVHPSHDCAYFPWGGGEHALQQYELLCYRN 188          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000057816.1 (SMESG000057816.1)

HSP 1 Score: 324.709 bits (831), Expect = 1.073e-114
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 3
Query:   75 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD
Sbjct:    1 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046710.1 (SMESG000046710.1)

HSP 1 Score: 255.373 bits (651), Expect = 2.120e-87
Identity = 117/155 (75.48%), Postives = 133/155 (85.81%), Query Frame = 3
Query:   75 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            MSRAG+GRQ SLSW PG+YGQVP NA+QAD GLYIVR RT GD+T+GKTKVGH SG+FPYAGRED +  YEVLCDTGLHV+G E HWQ+M NG+VPHNAVVGGHT++ EPLYIA+ARI+GEMCVGKV  SH C FMPYGG EHK + YEVLC+ D
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046697.1 (SMESG000046697.1)

HSP 1 Score: 255.373 bits (651), Expect = 2.120e-87
Identity = 117/155 (75.48%), Postives = 133/155 (85.81%), Query Frame = 3
Query:   75 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            MSRAG+GRQ SLSW PG+YGQVP NA+QAD GLYIVR RT GD+T+GKTKVGH SG+FPYAGRED +  YEVLCDTGLHV+G E HWQ+M NG+VPHNAVVGGHT++ EPLYIA+ARI+GEMCVGKV  SH C FMPYGG EHK + YEVLC+ D
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046742.1 (SMESG000046742.1)

HSP 1 Score: 214.157 bits (544), Expect = 3.789e-71
Identity = 100/155 (64.52%), Postives = 120/155 (77.42%), Query Frame = 3
Query:   75 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            M   G+GRQ SLSW PG  GQVP NA+QAD GL+I RART GDVT GK KVG+ +G+F YAG+E+ +  YEVLCDTGLHV+G E  W +M NG VP NA+VGGHTS+ EPLYI RARI G+MCVGK+  SH C +MPYGG+EH++  YEVLCY +
Sbjct:    1 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046728.1 (SMESG000046728.1)

HSP 1 Score: 202.216 bits (513), Expect = 1.949e-66
Identity = 89/155 (57.42%), Postives = 117/155 (75.48%), Query Frame = 3
Query:   75 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 539
            MSRAG GRQ  +SWLPG+YGQ+P NA+ A  G++I RA+T  DVT G  ++G+ + FFP+ GRE+ +  YEVLCDTGLHV+G E  W++MG G VP  A+VGG+TS  EPLYIARA ++GE+CVGKV  SHKC +MP   KEH++  YE+LC+ +
Sbjct:    1 MSRAGKGRQACVSWLPGQYGQIPYNAISAGDGVFIARAKTGSDVTPGMVRIGYNNAFFPFDGREEFITNYEVLCDTGLHVFGPEIVWKHMGGGCVPSGAIVGGNTSNGEPLYIARAHVNGELCVGKVCQSHKCAYMPNQSKEHRIQNYEILCFHE 155          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG105275.100e-2238.30gene:FBgn0034583 transcript:FBtr0071541[more]
CG133217.869e-2036.43gene:FBgn0033787 transcript:FBtr0345371[more]
CG133217.869e-2036.43gene:FBgn0033787 transcript:FBtr0087792[more]
CG442506.584e-1634.93gene:FBgn0265185 transcript:FBtr0339104[more]
CG442507.236e-1634.93gene:FBgn0265185 transcript:FBtr0339105[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CPU91.801e-4250.67DUF3421 domain-containing protein OS=Fasciola hepa... [more]
A0A4E0RKT43.118e-4250.67DM9 domain-containing protein OS=Fasciola hepatica... [more]
A0A504YBL57.074e-4250.67DM9 domain-containing protein OS=Fasciola gigantic... [more]
A0A4E0S3C51.051e-3946.62DM9 domain-containing protein OS=Fasciola hepatica... [more]
A0A2H1CPX51.997e-3946.62DUF3421 domain-containing protein OS=Fasciola hepa... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057816.11.073e-114100.00SMESG000057816.1[more]
SMESG000046710.12.120e-8775.48SMESG000046710.1[more]
SMESG000046697.12.120e-8775.48SMESG000046697.1[more]
SMESG000046742.13.789e-7164.52SMESG000046742.1[more]
SMESG000046728.11.949e-6657.42SMESG000046728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000967 ID=SMED30000967|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=678bp
CTTTATTTTTTTAATTGAACTAAGTGAGAAAATATTTTATTGGATCAATT
GTAATAAAATTATCCAATTCAGAAATGTCGAGAGCTGGAACTGGGAGACA
AATATCATTATCATGGCTTCCCGGAGAATATGGACAAGTTCCTCCAAACG
CGGTGCAGGCTGATCCAGGGTTGTATATAGTTCGAGCTAGAACTGATGGA
GATGTGACTGTTGGTAAAACGAAAGTAGGACATCAAAGTGGATTTTTTCC
TTATGCAGGTCGGGAAGACATGGTTCCTCGCTATGAGGTTCTGTGTGATA
CTGGATTACATGTATGGGGGAGCGAATTTCATTGGCAATATATGGGAAAT
GGAGCTGTGCCTCACAATGCTGTTGTAGGAGGACATACATCAACCTACGA
GCCTCTCTATATTGCCAGAGCAAGAATACACGGAGAAATGTGTGTTGGTA
AAGTAGCCAATTCTCACAAATGCGGTTTCATGCCTTATGGAGGAAAAGAA
CACAAAGTTTACAAATATGAAGTTTTATGCTACAGAGATTGATAATGTTC
ATTAACTGATTGTGTTGAAAAACATTTTGTCAAACTAATAGAATTTGTAA
TCTGCTTATTATGGTCCACCGCTTTGTGCGTTTCGTAAATGCTGCGCTAT
GTGCCGGTATAATAAATTAAATTTTTTG
back to top

protein sequence of SMED30000967-orf-1

>SMED30000967-orf-1 ID=SMED30000967-orf-1|Name=SMED30000967-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTK
VGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAV
VGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEV
LCYRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006368transcription elongation from RNA polymerase II promoter
GO:0016570histone modification
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016593Cdc73/Paf1 complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 11..76
e-value: 1.6E-6
score: 34.4
coord: 84..154
e-value: 4.6E-22
score: 89.3
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 33..145
e-value: 7.0E-31
score: 106.6
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 12..154