FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30000964
Length (bp)1962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30000964) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30000964) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30000964) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30000964) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000964

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000964SMESG000029017.1 SmedASXL_010138SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30000964SMESG000029017.1 dd_Smed_v4_20466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000964SMESG000029017.1 dd_Smed_v4_20466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000964SMESG000029017.1 dd_Smed_v4_20466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000964SMESG000029017.1 dd_Smed_v4_20466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000964SMESG000029017.1 dd_Smed_v6_20466_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30000964SMESG000029017.1 SMED30000964smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30000964SMESG000029017.1 Contig39179newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000964SMESG000029017.1 Contig39179uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.956e-11
Identity = 120/556 (21.58%), Postives = 222/556 (39.93%), Query Frame = 3
Query:  132 DIFSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTMVLRDEVQNFYTGLTVNETINLSH-LKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTM----SGTFHDISSLIVVASLIPSSLIPELKDAFVMD--ILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEKFPYCFNVWRE-TVNEINET---------------IICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLEN-KYQNYRNSLDNDSLNEDRFT-------------YIKLIRKNK-NTTIKIEKLIL---------DVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQM 1658
            DI +   + S+  G+ KI  ++    KV+W   V        + + LLV++YL +     +  K      +P++++C+  P SL+       +++   N+    + +L  I  +      F+     + ++ FY  L   +   LSH L++    C  + +            L    +   F   NYFNC+T    + +    +G  + +S +  V    P   +P     +  D  IL    G+++V+H  G+ P     G +I PG  + +  + I    L  P   C +D   +++  + + YTF  C+    Q+L+++ C C SS  P   + N  F      W+E   N  NE                + C      N+   +       CF  C+  +Y  ++S++ W     +L  + R  ++     +N   KT  +    +LE   + + ++   NDS  +D  +                LIR+N     I +E L +          +A L + IGG   L++G++V   +ELIE +  L  +
Sbjct:   41 DIIAELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRT-----IRRMYFNNESQNLITWLRFIQKFR-----FEQDSFMNSIRAFYENLG-QDAKKLSHNLEDMLMHCRFNRE------------LCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDP---LPGTYGVYNFDNNILHSA-GVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTND---MLNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSALPEVPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYE----YLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIRLTGL 562          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183THX6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS16074 PE=3 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 8.512e-120
Identity = 208/548 (37.96%), Postives = 324/548 (59.12%), Query Frame = 3
Query:  117 MTDSNDIFSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHL-YDKISMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPR---HKTPNEKFPYCFNVWRETVN-----EINETIICTSNFMNNMKA-RKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQNYRNSLDNDSL------------NEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNSTEKTD 1694
            M +  + F +FC  +SIRG+Q+I KA T F +V+W  FV   T  L +TI  L +++L Y TAWH  T + D++ FPAIT+C+HNPFSL+AN +W+  +I +P  F KRL  + L  + +DK+   + +++L D  +N+Y  L  NE+  LSH  + F  C+V     ++++ NC  +     + R FSH  YFNCWT+E     S    +   L ++  L+PS  I E K+ F+MD   RGEG+K+V+HE+GTYP+IDKDG N+QPG++NE++++ IKW  L TP+  C +D K I D+   + Y  TQC+D+ LQ + +  C CL+S WPR       N K PYC  + ++  N     ++ E + C  + ++ +K  ++ +++   C   C+++TY  + SIT W P  +KL+      Q VE L  N      K+ F  +LE    +    +++ ++            NE  +TYI L+R + +TT++ E+LI D  IL+SR+GGLCS+F+GLT AF +ELIEFIYL+ +  + Q ++ +K D
Sbjct:    1 MPELRNNFDLFCELTSIRGLQRIKKAPTFFGRVIWSAFVIAMTLSLFITIGFLARDFLSYNTAWHARTIIGDKANFPAITVCAHNPFSLEANTIWKKNEILTPTGFNKRLSEITLEFIKHDKLE--YASVMLLDSTENYYANLRPNESQTLSHQTDMFPHCMVTADGVRILAENCAVEADTGFTKRYFSHPRYFNCWTLETAANHST--RETVRLTLLIRLVPSVEIDEAKNNFIMDTFSRGEGVKLVVHESGTYPEIDKDGINVQPGRMNELSFQTIKWVRLQTPIAPCLEDPKPIFDMGSTYTYRLTQCLDSILQNISINSCGCLNSEWPRTVDSALVNTKIPYCSALPKDPKNPDSLKDMVERLTCAGDLLHRVKELKEEAIRQRNCISACSYYTYPVSASITSWKPMPEKLNYFTEKCQRVESLQNNPQQ---KEKFIRYLERTLNSSSADINSSTITSLSSKFAKNFENEGLYTYISLVRTSYDTTLQEERLIFDFYILISRVGGLCSIFVGLTAAFLVELIEFIYLVCRQYKKQDSNVKKKD 541          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3UEW8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5596 PE=3 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 4.248e-115
Identity = 210/548 (38.32%), Postives = 316/548 (57.66%), Query Frame = 3
Query:  138 FSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTP---NEKFPYCFNVWR-----ETVNEINETIICTSNFMNNMKARKLSVQMNK-CFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQNY---------RNSLD-NDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNS-TEKTDRSGKSLGAD 1721
            F+IFC  +SIRG Q+I +AQTPF++++W  FV   T  L+VTI  L +++  + T+WH+ T ++D++ FPAIT+C+HNPFSL+AN +W    I +P +F ++L  + L  + +  +  +  ++L+D    ++  L   E+  L H    F  C+V      +V+ NC  +     + + FSH  YFNCWT+E     S    D   L V+ SLIPS  I E +  F+MD   RGEG+K+V+H++GTYP+IDK G N+QPG++NE+++    W  L TP   C DD   I D+ R ++Y  TQC+D+ LQ + + +C CL+S WPR   P   N K PYC  + +      T+  I   + CTSN ++N+K  K S  +N  C PRC+FFTY  + SIT W P  +KL       + VE L+ N  D   ++    +L+               ++SL   D  N+  +TYI L+R   +TT K E+LI D+ IL+SR+GGLCS+FIGLT A  +ELIEF+Y+   +  S + + + KTD     +G +
Sbjct:    8 FAIFCDLTSIRGFQRIKRAQTPFIRMIWTLFVILMTGALIVTIGFLARDFFSFTTSWHSRTLIDDKTDFPAITICAHNPFSLEANRIWAEASILTPTEFNRQLSAMTLAFIENG-NPEYAGLLLQDSTDTYFANLRPEESQRLGHQTTMFPHCMVTADGVNIVAENCMIEGDTGFTKKRFSHPKYFNCWTIETAANQST--KDTVRLTVLLSLIPSKEINESRKNFIMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTEWWVRLKTPTAPCLDDPPPITDMGRQYSYRMTQCLDSYLQNISINQCGCLNSEWPRPIHPDLVNSKIPYCSALPKNVSDSATLEGIIRRLNCTSNLLHNLKKIKESAILNHICTPRCSFFTYPISASITSWQPIPEKLQHFTDKFKRVERLLNNYDDPLERERLIQYLKEVIDPQEKLSTQIISKSSLRIEDFQNQGSYTYISLVRTTYDTTYKEERLIFDIYILISRVGGLCSIFIGLTAAIIVELIEFVYVGFWLARSDSLAVSTKTDTPELPVGGE 552          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0RFC3 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola hepatica OX=6192 GN=D915_003846 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 7.608e-113
Identity = 213/523 (40.73%), Postives = 308/523 (58.89%), Query Frame = 3
Query:  144 IFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHL-YDKI--SMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEK---FPYCFNVWRETVNEINETII-----CTSNFMNNMKA-RKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQNYRNSLDND---------SLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLL 1649
            +F   SSIRG+Q+I +A+TPF++ LW+ FV + T +L V+  +L+ +YL Y T+WHT +  +D+S FPAIT+C+HNPFSLKAN LW +  + SPNQ    +  ++L  L  DK+  S++   M L D  + +YT L+  ++  +SH  E    C++      +V+  C  +    +  R FSH  YFNC T+E     S +  DIS L+++A L+PSS I + + AF+MD   RGEG+K+V+HE  TYP I++ GFN+QP ++NEI YE + WK LSTPV  C+D Q  I DL   + Y  +QC+D A Q+ ++  C C++S WPR           PYC ++ R +  E+  T++     C+  F   +   R+  ++   C PRC FFTY T LS+T W PS  KL       + VE  +    +   K   SSFL++      +S D              +  +TYI LIR++ +TT+K EKL+ D  ILLSRIGGLCSL IGLT+AFFIE+IEFIY +
Sbjct:   75 LFGEISSIRGVQRIFRAETPFIRTLWILFVISMTCLLTVSSFMLIVDYLQYTTSWHTRSLPDDKSEFPAITLCAHNPFSLKANKLWSTGHVISPNQVKSNMAAVSLEMLNQDKVEDSVI---MALSDSFEFYYTNLSPEDSQKISHDFEIIPHCILYSPEHTVVAEKCEMENVTAMVRRTFSHPKYFNCLTIEGGGNESTS--DISRLVLLAHLVPSSKIVQARSAFIMDTFTRGEGIKVVIHERNTYPQIERYGFNVQPNRMNEIIYETLSWKRLSTPVAPCKDSQPPISDLGVNYTYETSQCLDIATQEEMIRRCGCMNSEWPRPTRAVHGPRLVPYCTSMDRNSSVEVTATVLSERLACSRIFFEELPVIRERIIRAGICIPRCRFFTYDTKLSVTSWEPSPVKLSSYTANYRIVEEYLTEPIESK-KKELSSFLQSIIDPTLDSADEQWNKRIGDYKQFGDGTYTYISLIRRDFDTTLKEEKLVFDAPILLSRIGGLCSLCIGLTMAFFIEIIEFIYAV 591          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183MQX4 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS18449 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 6.905e-112
Identity = 215/566 (37.99%), Postives = 326/566 (57.60%), Query Frame = 3
Query:  138 FSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPR-------HKTPNEKFPYCFNVWRETVNEINET------IICTSNFMNNMKA-RKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKD----NFSSFLE-----NKYQNYRNSLDND--SLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLV---QMKESQTNSTEKTDRSGKSLGADKQKLNVHNSK 1751
              +FC  SSIRG+Q+I  +Q PF+++LW+ FV   T +L+V+   L+ +YL Y TAW+T + L+D+S FPAIT+C+HNPFSL  N+LW+   + SP     RL  L L  L + I+     +   D ++ +YT L +N+TI + H K+    C++  +   +V+  C  +    + +R F+H  YFNCWT++ K   S +  D++ LI++A LIP   I     +F+MD   RGEG+K+V+HE GTYP+I+K G NIQPG++NEI YE I WK L TPV  C ++   I DL   + Y  +QC++  LQ  L   C CL+S WPR       HK+     PYC  +    VN IN        + C    +N++K  ++ +VQ   C PRC ++TY T LS+T W P   KL    +  + V+  +     +   D    NF + ++     N+  + R    ND    ++   TYI LIR++ +T +K E+L+ D+ IL+SRIGGLCSL IGLT+AF +EL+EF+YLL     MK +Q+N   K + + K++  + ++  +HN +
Sbjct:   61 LELFCVLSSIRGVQRIYSSQIPFIRILWILFVIIMTCVLMVSSGFLISDYLCYSTAWNTRSLLDDKSEFPAITLCAHNPFSLNVNSLWKENIVPSPRHIKSRLRQLLLTMLDNGITDYTGDLAFSDSIEFYYTNLNLNDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLEPETSIRIRRFTHPKYFNCWTIDGKPNASTS--DVTRLIILAHLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETIFWKRLHTPVAPCTNENISIEDLGIYYTYKQSQCLNRMLQNELFTRCGCLNSEWPRSIKLLDQHKS----LPYCQKL-PINVNNINGAEEMKTRLDCFGTVLNDLKQLKEKAVQKGVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQRKHIDELLENFDASIDPIKNKNQLHSIRTLFSNDLQRFDDGTHTYISLIRQDFDTIMKEERLVFDIYILISRIGGLCSLCIGLTMAFLVELVEFVYLLCFKNNMKLTQSNENYKLNHNLKTMKINCKQHCLHNKE 619          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3W907 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6893 PE=3 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 8.154e-112
Identity = 202/525 (38.48%), Postives = 319/525 (60.76%), Query Frame = 3
Query:  138 FSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTP---NEKFPYCFNVWRE-----TVNEINETIICTSNFMNNMKARKLS-VQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLEN--------KYQNYRNSLDN----DSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLL 1649
            F+IFC  +SIRG+Q+I +AQTPF++++W  FV   T  L++TI  L +++  + T+WH+ T ++D++ FPAIT+C+HNPF+L+AN++W    I +P++F ++L  + L  + +  ++ + +++L+D    ++  L   E+  L H    F  C+V V    +V+ NCT +     + + FSH  YFNCWT+E     S    D   L ++ SL+ S  I E +  FVMD   RGEG+K+V+H++GTYP+IDK G N+QPG++NE+++   +W  L TP   C DD   I D+ + ++Y  TQC+D+ LQ + + +C CL+S WPR   P   N   PYC  + ++     T+  I + + CT+N ++N+K  K S ++   C PRC+F+TY  ++SI  W P  +KL       + VE L+ N  D   ++    +L+N          QN  +S+ N    D  N++ +TYI L+R +  TT K E+LI D+ IL+SR+GGLCS+FIGLT A F+ELIEFIY++
Sbjct:    7 FAIFCDLTSIRGVQRIKRAQTPFIRIIWSLFVVLMTGALIITIGFLARDFFSFSTSWHSRTLIDDKTDFPAITICAHNPFALEANHIWAKASILTPSEFNRQLSAITLAFIENG-NLEYASLLLQDSTDTYFANLRPEESRRLGHQTTMFPHCMVTVDGVNIVAENCTIEGDTGFTKQRFSHPKYFNCWTIETADNKST--KDTVRLTLLLSLVSSKEINESRKNFVMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTERWVRLQTPTAPCLDDPPPITDMGKQYSYRMTQCLDSFLQNISINQCGCLNSEWPRPIHPDLVNTNVPYCSALPKDARDPTTLESIVKRLNCTTNLLHNLKHIKESAIRERICIPRCSFYTYPLSVSIASWEPIPEKLHHFTDKFKRVERLLNNHDDAVERERLVKYLKNVIGLEADDTTQN--SSMSNLRIEDFENQESYTYISLVRTSYETTYKEERLIFDIYILISRVGGLCSIFIGLTAAIFVELIEFIYVV 526          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000029017.1 (SMESG000029017.1)

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 461/463 (99.57%), Postives = 462/463 (99.78%), Query Frame = 3
Query:  564 LSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQNYRNSLDNDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNSTEKTDRSGKSLGADKQKLNVHNSKNSILTKGYPSENVEIYIDNSVFNFDSDTKIEETSDNEVLIWHHGDPNNKLHDGKEGNSYPQTFVSEL 1952
            +SHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKLLLEECNCLSSLWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQNYRNSLDNDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNSTEKTDRSGKSL ADKQKLNVHNSKNSILTKGYPSENVEIYIDNSVFNFDSDTKIEETSDNEVLIWHHGDPNNKLHDGKEGNSYPQTFVSEL
Sbjct:    1 MSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKLLLEECNCLSSLWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQNYRNSLDNDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNSTEKTDRSGKSLAADKQKLNVHNSKNSILTKGYPSENVEIYIDNSVFNFDSDTKIEETSDNEVLIWHHGDPNNKLHDGKEGNSYPQTFVSEL 463          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000064696.1 (SMESG000064696.1)

HSP 1 Score: 439.499 bits (1129), Expect = 1.538e-146
Identity = 238/541 (43.99%), Postives = 359/541 (66.36%), Query Frame = 3
Query:   75 KRSSRITQFNSKPIMTDSNDIFSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDT-----MVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLENKYQN-YRNSLDNDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNS 1679
            K++SR ++ N   ++    + F++FC  SSIRGM KI KA T FLKVLW+ FVF  T +L +   LL+K+YL YYTAWH  TK +D S FPAIT+CSHNPFSL+AN+LW+     +P  F +RL  +    + D+++   D      M+  D+++N+Y  +  + ++ +SH  E  ++C +      +++ NC  +  + +   +FSH+ +FNC+T++  +T + +   I+SLI++ SL P++ IPELK++F+MDILERGEGLK+V+HE  +YP+I+++G ++QPGK+N I YEP+KW   STP + C++ Q  I DL R FNY+F+ C++  LQ  L+E C C+++L+PR   PNEK  YC N+     ++I   + C  +F  N+K  K   +  KC  +CN+FTY+T LSITKW+PS +KL RI  +  + E+ ++N  ++  K+++ S+++    N Y NS   D  NE++FTYI L RK +NT IK E+L+LD+AIL+SRIGGLCSLFIGLTV+FFIEL+EF YL+ +    Q  S
Sbjct:   10 KQASRKSESN---VLVIDKNAFNLFCEISSIRGMHKITKAPTLFLKVLWIAFVFCMTSLLFLVTGLLIKDYLNYYTAWHVRTKFDDNSEFPAITLCSHNPFSLRANSLWKKPNAPNPEMFRERLKQV----VIDEVNTTKDPNELTLMMFHDKIENYYMNIDYDFSLKISHGTEMLKYCAIFSDGLIIITYNCETEKDKVVEKIVFSHQKFFNCYTIQ--QTSNYSQQTITSLIILVSLTPAADIPELKNSFLMDILERGEGLKLVIHEPNSYPEIEEEGIDVQPGKMNNIKYEPVKWARHSTPPQKCKNGQSPIFDLKRQFNYSFSFCMNYNLQLKLIETCGCMNALFPRPFIPNEKIGYCMNLTHRNSSQIFTNLKCAQDFTMNVKTLKKQWENTKCMQKCNYFTYNTELSITKWVPSYEKLFRIADLINKTEIYLKNHRERESKEDYISYIQANITNSYINSSFLDLENENKFTYISLSRKTRNTVIKDEELVLDLAILMSRIGGLCSLFIGLTVSFFIELVEFGYLICRKYSFQKGS 541          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000016707.1 (SMESG000016707.1)

HSP 1 Score: 384.415 bits (986), Expect = 6.508e-125
Identity = 217/536 (40.49%), Postives = 330/536 (61.57%), Query Frame = 3
Query:  102 NSKPIMTDSNDIFSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRL--IYLNLIHLYDKISMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTF-------HDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEM------LVRNRTD--KTFKDNFSSFLENKYQNYRNSLDN----DSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYL 1646
            N  P +      F+IFC  SS+RGMQKI+K++TPFLK LW+ FVF  + +L++    LV ++  Y+TAWH ST+L++++ FPAI++CSHNPFS +A+  W+  KI  P +F +RL  + + LI      S       L D+ + +Y  +    +I L H+++  Q+CVV      +++ +C  +     +V  FSH NYFNC+T+E K   +G         ++  SLI++ ++   S + +  ++FVMD L RGEGL+IV+H  G+YPDIDK+G NIQPGK+NE+ ++ I W   S+P + C+DDQ  I+DLDR+++YTF QC+DA + K L+E+C C+S++WPR + P++  PYC +        +  T          +K  K +    KC+P C F TY +TLSIT+W PS+ KL +I +  + V        L +N T+  +  K N+ + L+ + + Y+ +L +    +  NE +  YI L+RKN +TT KIEKL +D+ I +SR+GGLCSL IGLT AFFIE+IEF+YL
Sbjct:   41 NHDPNLKTPISKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVIDFRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIK-----SGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELK-YKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 570          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000081715.1 (SMESG000081715.1)

HSP 1 Score: 355.91 bits (912), Expect = 2.900e-114
Identity = 222/605 (36.69%), Postives = 338/605 (55.87%), Query Frame = 3
Query:  144 IFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTMVLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDL-SEYLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEKFPYCFNVWRET-VNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDNFSSFLE--NKYQNYRNSLDNDSLN---------EDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNSTEKTDRSGKSLGADKQKLNVHNSKNSILTKGYPSENVEIYIDNSVFNFDSDTKIE----ETSDNEVLIWHHGDPNNKLHD 1907
            +FC  SSIRG+ KI+ A+T F + LW GFV   T +L V +V L+++YL Y TAWHTST+L+  S FPAIT+C+ NPFS+ AN LW  +KI SP++    L  ++L    DK     + + L D    FY  L   +TI L H K+  ++C++  ++  +++  C  DL +E  ++++FSH+ YFNC+T+E  +  +    D+  LI++  +IPS  IPEL ++F++DIL+RGEGLK+ +H+  TYPDI+  G N+ P K+N + Y P KW  +ST    CRD QK I DL+R F Y FTQCV A +Q+ ++++C C+ S  PR   PNE  PYC  +   T    I E + C  N  +     + ++Q + CF +C F TY TT+S+T+W  +  KL  +  + +       N + +      S  L   N+  N R+ ++ +  N         E+ FTYI L+R+N +   K EKL+LD   L SR+GGL S+ IGLT A F E IEF+Y +      ++  T KTD     +  +     V+     ++  G+P       ++ ++F+FD + K      E S +E       D N +L+D
Sbjct:    6 LFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKC--DLKNEKFNIKLFSHQEYFNCYTIEGLEQYTT---DVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTANELKLKNLENLYRSYFAYRHNSSSENIVKIKSILLNSLNRSHNLRHQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWI-----HRSPFTNKTDSDSNHVRKE-----VYFQSQRLI--GFP-------VEENMFDFDRNEKANNIFMERSSSERCPSSFNDVNEELND 586          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000045131.1 (SMESG000045131.1)

HSP 1 Score: 342.043 bits (876), Expect = 4.042e-109
Identity = 197/530 (37.17%), Postives = 315/530 (59.43%), Query Frame = 3
Query:  108 KPIMTDSNDIFSIFCATSSIRGMQKINKAQTPFLKVLWVGXXXXXXXXXXXXXXXXXKEYLGYYTAWHTSTKLEDQSLFPAITMCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTM----VLRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRM--FSHRNYFNCWTVE--PKKTMSGTFHDISS-----LIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKXXXXXXXXXXXXWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRV----QQEVEMLVRNRTDKTFKDNFSSFLENKYQNYRNSLDNDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYL 1646
            KP+        ++FC   SIRGMQKI +A   FL+ +W+G+V   T +L VT   L +++  Y TAWHTST  ++++ FPAI++CSHNPFS  AN +W+   + +P +F + L  ++       I+MV +      +L D  + +Y  +    ++NLSH +E  ++CV+       ++  C  DL+ Y++ R+  FS+  YFNC+T+E  P+K  + +   +S+     +I++  + P S + ++  +FVMD L RG G+K+VLHE GT P+I+  G N+QPGK+NEI++E I W   ++P + C ++Q  IIDL   + YT ++CV+A LQK  ++ C C++S WPR   P++  PYC N +  + +EI +   C+S  + +    K  +   KCF  C++FTY T +S+T W PS+ KL+R+ ++     +        +T++  K      L+ K Q+  +   N   +E RFTYI ++RKN +T  K E+L++D +I +SR+GGLCSL +GLT A F ELIEF YL
Sbjct:   76 KPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVS-------INMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQC--DLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTN-FSCSTDEILKRYECSS--IKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKK------LKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 587          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP3.956e-1121.58FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183THX68.512e-12037.96Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3UEW84.248e-11538.32Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4E0RFC37.608e-11340.73FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A183MQX46.905e-11237.99Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A0R3W9078.154e-11238.48Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029017.10.000e+099.57SMESG000029017.1[more]
SMESG000064696.11.538e-14643.99SMESG000064696.1[more]
SMESG000016707.16.508e-12540.49SMESG000016707.1[more]
SMESG000081715.12.900e-11436.69SMESG000081715.1[more]
SMESG000045131.14.042e-10937.17SMESG000045131.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000964 ID=SMED30000964|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1962bp
CTTAGCAAGTTCAGAATTGTGTTTATTTAGTAAAATATGGAAAATAAAAA
TTTATAATGTCTCACAAAAATAACAAAAGGTCATCGCGTATTACTCAATT
CAATTCTAAACCAATTATGACAGATTCTAATGATATATTTTCGATATTCT
GTGCTACTTCCTCAATAAGAGGAATGCAAAAGATCAACAAAGCTCAAACG
CCATTCTTAAAGGTTCTTTGGGTGGGCTTCGTTTTCACAACTACATTCAT
GCTTCTAGTAACTATAGTGTTGTTAGTGAAAGAGTATTTGGGATATTATA
CAGCCTGGCATACAAGTACGAAACTTGAAGATCAAAGCTTATTCCCAGCA
ATTACGATGTGTTCTCATAATCCGTTTTCTTTGAAAGCTAATAATCTTTG
GGAAAGCAAGAAAATTAAATCCCCGAACCAATTCACAAAACGGTTAATAT
ATTTGAACCTGATCCATTTATATGATAAAATCAGTATGGTATTTGATACG
ATGGTTCTGAGAGATGAGGTACAAAATTTCTACACTGGTTTAACAGTAAA
TGAAACAATAAATCTCAGCCATTTGAAAGAGTTCTTTCAATTCTGCGTCG
TTGACGTTCAGCATCAAAAGTTGGTTTCTAGGAACTGCACTGGTGACTTG
TCAGAATATCTCAGTGTCAGAATGTTTAGTCACCGGAACTATTTCAACTG
TTGGACAGTTGAACCAAAGAAAACAATGAGTGGCACATTTCATGATATCA
GTTCATTAATTGTCGTCGCTTCTTTGATACCTTCTAGTTTAATTCCAGAA
TTAAAAGATGCATTCGTTATGGATATTTTAGAGCGTGGAGAAGGATTAAA
AATCGTTTTGCATGAAACTGGTACTTATCCGGATATAGATAAAGATGGTT
TCAATATTCAACCAGGAAAATTAAATGAAATTGCATATGAACCAATAAAA
TGGAAGTTTTTATCAACTCCAGTAAAGATTTGCCGAGACGATCAAAAAGA
AATAATAGATCTTGATCGCGTTTTTAATTACACTTTTACTCAGTGCGTAG
ATGCAGCGTTGCAAAAGTTATTGCTGGAAGAATGCAATTGCCTCTCCTCC
TTGTGGCCCCGACACAAAACGCCAAATGAAAAGTTTCCTTATTGTTTCAA
CGTATGGAGAGAAACAGTTAATGAAATAAATGAGACAATAATTTGCACAT
CGAATTTCATGAATAACATGAAAGCCCGTAAATTATCTGTTCAAATGAAT
AAATGCTTTCCTAGATGCAATTTCTTCACCTACAGTACGACATTATCCAT
TACCAAATGGCTTCCATCCATTCAGAAACTCGACAGAATTCATCGAGTAC
AACAAGAAGTGGAAATGCTTGTTAGAAATCGAACTGACAAAACTTTCAAA
GACAATTTTAGTTCTTTTCTAGAGAATAAATACCAAAATTATAGAAACTC
ACTGGATAATGACAGTCTAAATGAAGACAGATTTACATATATTAAATTAA
TAAGAAAAAATAAAAATACAACAATAAAAATTGAAAAACTTATTTTGGAT
GTTGCAATCTTACTTTCGAGAATCGGAGGTCTATGTTCTCTTTTTATCGG
ACTGACGGTTGCGTTTTTCATTGAACTGATCGAGTTCATCTATTTGCTGG
TTCAAATGAAAGAATCTCAGACAAATTCTACAGAAAAAACTGACAGGAGT
GGCAAGTCATTGGGAGCTGATAAACAAAAGCTAAATGTTCACAATTCTAA
AAATTCAATTTTAACAAAAGGATATCCAAGTGAAAATGTGGAAATCTACA
TTGACAACTCAGTTTTTAACTTTGATTCGGATACAAAAATTGAAGAAACT
AGCGATAACGAAGTGTTAATTTGGCACCACGGGGACCCCAATAACAAATT
GCATGATGGAAAAGAAGGAAATTCATATCCGCAGACTTTTGTTTCTGAAC
TTTGATTTTGTG
back to top

protein sequence of SMED30000964-orf-1

>SMED30000964-orf-1 ID=SMED30000964-orf-1|Name=SMED30000964-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=633bp
MSHKNNKRSSRITQFNSKPIMTDSNDIFSIFCATSSIRGMQKINKAQTPF
LKVLWVGFVFTTTFMLLVTIVLLVKEYLGYYTAWHTSTKLEDQSLFPAIT
MCSHNPFSLKANNLWESKKIKSPNQFTKRLIYLNLIHLYDKISMVFDTMV
LRDEVQNFYTGLTVNETINLSHLKEFFQFCVVDVQHQKLVSRNCTGDLSE
YLSVRMFSHRNYFNCWTVEPKKTMSGTFHDISSLIVVASLIPSSLIPELK
DAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWK
FLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKLLLEECNCLSSLW
PRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKC
FPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEMLVRNRTDKTFKDN
FSSFLENKYQNYRNSLDNDSLNEDRFTYIKLIRKNKNTTIKIEKLILDVA
ILLSRIGGLCSLFIGLTVAFFIELIEFIYLLVQMKESQTNSTEKTDRSGK
SLGADKQKLNVHNSKNSILTKGYPSENVEIYIDNSVFNFDSDTKIEETSD
NEVLIWHHGDPNNKLHDGKEGNSYPQTFVSEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 203..219
score: 25.65
coord: 400..420
score: 28.38
coord: 336..353
score: 28.22
coord: 92..108
score: 43.76
coord: 263..281
score: 29.26
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 31..527
e-value: 5.7E-58
score: 196.9
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 32..543
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 105..263
e-value: 9.0E-33
score: 115.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 52..525
e-value: 9.0E-33
score: 115.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 301..404
e-value: 9.0E-33
score: 115.8
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 82..495
e-value: 9.0E-33
score: 115.8
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 32..543
NoneNo IPR availableTMHMMTMhelixcoord: 510..532
NoneNo IPR availableTMHMMTMhelixcoord: 50..72