Calponin

Overview
NameCalponin
Smed IDSMED30000960
Length (bp)314
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Calponin vs. Ensembl Human
Match: TAGLN3 (transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868])

HSP 1 Score: 101.293 bits (251), Expect = 9.791e-29
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:    4 KQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 105          
BLAST of Calponin vs. Ensembl Human
Match: TAGLN3 (transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868])

HSP 1 Score: 99.3673 bits (246), Expect = 5.945e-27
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. Ensembl Human
Match: TAGLN3 (transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868])

HSP 1 Score: 99.3673 bits (246), Expect = 5.945e-27
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. Ensembl Human
Match: TAGLN3 (transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868])

HSP 1 Score: 99.3673 bits (246), Expect = 5.945e-27
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. Ensembl Human
Match: TAGLN3 (transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868])

HSP 1 Score: 99.3673 bits (246), Expect = 5.945e-27
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. Ensembl Celegans
Match: cpn-1 (CPN-1; CalPoNin [Source:UniProtKB/TrEMBL;Acc:G5EFB5])

HSP 1 Score: 91.2781 bits (225), Expect = 2.352e-24
Identity = 48/104 (46.15%), Postives = 68/104 (65.38%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K+MENI  FL  +E Y V ++ LFQTVDLYE ++   V+  L  L  + ++N F     GPK    ++RE+T+EQL++G  +IGLQ GSNKGA+ SG+ +G  R
Sbjct:   89 KKMENISFFLKFAEEY-VQKSELFQTVDLYEGQDPNAVLICLASLARKSEKN-FGRSGLGPKEAQGDRREWTDEQLKAGHNVIGLQMGSNKGATASGLNMGNTR 190          
BLAST of Calponin vs. Ensembl Celegans
Match: cpn-1 (CPN-1; CalPoNin [Source:UniProtKB/TrEMBL;Acc:G5EFB5])

HSP 1 Score: 91.2781 bits (225), Expect = 2.352e-24
Identity = 48/104 (46.15%), Postives = 68/104 (65.38%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K+MENI  FL  +E Y V ++ LFQTVDLYE ++   V+  L  L  + ++N F     GPK    ++RE+T+EQL++G  +IGLQ GSNKGA+ SG+ +G  R
Sbjct:   89 KKMENISFFLKFAEEY-VQKSELFQTVDLYEGQDPNAVLICLASLARKSEKN-FGRSGLGPKEAQGDRREWTDEQLKAGHNVIGLQMGSNKGATASGLNMGNTR 190          
BLAST of Calponin vs. Ensembl Celegans
Match: cpn-1 (CPN-1; CalPoNin [Source:UniProtKB/TrEMBL;Acc:G5EFB5])

HSP 1 Score: 91.2781 bits (225), Expect = 2.352e-24
Identity = 48/104 (46.15%), Postives = 68/104 (65.38%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K+MENI  FL  +E Y V ++ LFQTVDLYE ++   V+  L  L  + ++N F     GPK    ++RE+T+EQL++G  +IGLQ GSNKGA+ SG+ +G  R
Sbjct:   89 KKMENISFFLKFAEEY-VQKSELFQTVDLYEGQDPNAVLICLASLARKSEKN-FGRSGLGPKEAQGDRREWTDEQLKAGHNVIGLQMGSNKGATASGLNMGNTR 190          
BLAST of Calponin vs. Ensembl Celegans
Match: cpn-2 (Transgelin [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU9])

HSP 1 Score: 70.8626 bits (172), Expect = 4.018e-17
Identity = 41/98 (41.84%), Postives = 55/98 (56.12%), Query Frame = 3
Query:    9 MENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQ--RNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            MENI  FL A++ +GV   S FQTVDLYE++   +VI  L  L    Q   +  + P    K    + R+F E  +R G+ +I LQ G+NK ASQ GM
Sbjct:    1 MENISNFLAAAKQFGVMEISCFQTVDLYENKQCYKVIECLRLLAAVAQSRSSHLEHPAWVVKLAQSSPRQFPEAVMRRGEMVIPLQYGTNKCASQKGM 98          
BLAST of Calponin vs. Ensembl Celegans
Match: cpn-2 (Transgelin [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU9])

HSP 1 Score: 70.8626 bits (172), Expect = 2.391e-16
Identity = 41/98 (41.84%), Postives = 55/98 (56.12%), Query Frame = 3
Query:    9 MENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQ--RNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            MENI  FL A++ +GV   S FQTVDLYE++   +VI  L  L    Q   +  + P    K    + R+F E  +R G+ +I LQ G+NK ASQ GM
Sbjct:   91 MENISNFLAAAKQFGVMEISCFQTVDLYENKQCYKVIECLRLLAAVAQSRSSHLEHPAWVVKLAQSSPRQFPEAVMRRGEMVIPLQYGTNKCASQKGM 188          
BLAST of Calponin vs. Ensembl Fly
Match: Mp20 (gene:FBgn0002789 transcript:FBtr0087745)

HSP 1 Score: 119.013 bits (297), Expect = 4.738e-35
Identity = 58/105 (55.24%), Postives = 74/105 (70.48%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRN-EFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  F  A + YGVP   +FQTVDLYE +++  V NT+  LG    ++ +FKGP  GPKP  E KR+FTEEQL++GQ I+GLQAGSNKGA+Q+G  +G  R
Sbjct:   74 KFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178          
BLAST of Calponin vs. Ensembl Fly
Match: Mp20 (gene:FBgn0002789 transcript:FBtr0345532)

HSP 1 Score: 119.013 bits (297), Expect = 5.027e-35
Identity = 58/105 (55.24%), Postives = 74/105 (70.48%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRN-EFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  F  A + YGVP   +FQTVDLYE +++  V NT+  LG    ++ +FKGP  GPKP  E KR+FTEEQL++GQ I+GLQAGSNKGA+Q+G  +G  R
Sbjct:   74 KFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178          
BLAST of Calponin vs. Ensembl Fly
Match: CG5023 (gene:FBgn0038774 transcript:FBtr0083866)

HSP 1 Score: 99.3673 bits (246), Expect = 1.203e-27
Identity = 52/96 (54.17%), Postives = 66/96 (68.75%), Query Frame = 3
Query:    9 MENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRN-EFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSG 293
            MENIQ F  A + YGVP   +FQT DL+E RN+ QV  +L  LG   Q++ E+ GPT GPK   +N+R FTEEQLR+ +G + LQ G NKGASQ+G
Sbjct:   64 MENIQRFQAAVKKYGVPEEEIFQTADLFERRNIPQVTLSLYALGRITQKHPEYTGPTLGPKMADKNERSFTEEQLRAHEGELNLQMGFNKGASQAG 159          
BLAST of Calponin vs. Ensembl Fly
Match: Chd64 (gene:FBgn0035499 transcript:FBtr0310531)

HSP 1 Score: 94.7449 bits (234), Expect = 9.478e-26
Identity = 48/104 (46.15%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  FL  ++ +GVP    FQ+VDL+E +N+  V+  L  LG +     F  P+ GPK   +N R F++EQLR+G  +I LQ GSNKGA+QSG+  G  R
Sbjct:   72 KCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKASN--FNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGINFGNTR 173          
BLAST of Calponin vs. Ensembl Fly
Match: Chd64 (gene:FBgn0035499 transcript:FBtr0073270)

HSP 1 Score: 95.1301 bits (235), Expect = 9.596e-26
Identity = 48/104 (46.15%), Postives = 65/104 (62.50%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  FL  ++ +GVP    FQ+VDL+E +N+  V+  L  LG +     F  P+ GPK   +N R F++EQLR+G  +I LQ GSNKGA+QSG+  G  R
Sbjct:   85 KCMENISAFLACAKNFGVPTQETFQSVDLWERQNLNSVVICLQSLGRKASN--FNKPSIGPKEADKNVRNFSDEQLRAGANVISLQYGSNKGATQSGINFGNTR 186          
BLAST of Calponin vs. Ensembl Zebrafish
Match: tagln2 (transgelin 2 [Source:ZFIN;Acc:ZDB-GENE-020802-2])

HSP 1 Score: 102.834 bits (255), Expect = 1.731e-28
Identity = 52/105 (49.52%), Postives = 71/105 (67.62%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-------ECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YG+ ++ +FQTVDL+E +++  V  TLL LG+        C R +   P   PK + EN+REF+EEQ++ GQ +IGLQ G+NKGASQ+GM
Sbjct:   87 KQMEQISQFLTAAERYGITKSDIFQTVDLWEGKDLAAVQMTLLSLGSLAVTKDDGCYRGD---PAWFPKKSQENRREFSEEQMKEGQSVIGLQMGTNKGASQAGM 188          
BLAST of Calponin vs. Ensembl Zebrafish
Match: tagln2 (transgelin 2 [Source:ZFIN;Acc:ZDB-GENE-020802-2])

HSP 1 Score: 102.834 bits (255), Expect = 1.731e-28
Identity = 52/105 (49.52%), Postives = 71/105 (67.62%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-------ECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YG+ ++ +FQTVDL+E +++  V  TLL LG+        C R +   P   PK + EN+REF+EEQ++ GQ +IGLQ G+NKGASQ+GM
Sbjct:   87 KQMEQISQFLTAAERYGITKSDIFQTVDLWEGKDLAAVQMTLLSLGSLAVTKDDGCYRGD---PAWFPKKSQENRREFSEEQMKEGQSVIGLQMGTNKGASQAGM 188          
BLAST of Calponin vs. Ensembl Zebrafish
Match: tagln2 (transgelin 2 [Source:ZFIN;Acc:ZDB-GENE-020802-2])

HSP 1 Score: 102.834 bits (255), Expect = 2.692e-28
Identity = 52/105 (49.52%), Postives = 71/105 (67.62%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-------ECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YG+ ++ +FQTVDL+E +++  V  TLL LG+        C R +   P   PK + EN+REF+EEQ++ GQ +IGLQ G+NKGASQ+GM
Sbjct:  102 KQMEQISQFLTAAERYGITKSDIFQTVDLWEGKDLAAVQMTLLSLGSLAVTKDDGCYRGD---PAWFPKKSQENRREFSEEQMKEGQSVIGLQMGTNKGASQAGM 203          
BLAST of Calponin vs. Ensembl Zebrafish
Match: tagln (transgelin [Source:ZFIN;Acc:ZDB-GENE-070912-1])

HSP 1 Score: 99.3673 bits (246), Expect = 3.583e-27
Identity = 49/102 (48.04%), Postives = 71/102 (69.61%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNE---FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FLNA+E YGV +T +FQTVDL+E +++  V  TL+ LG+     E   F+G P    K   EN+R+F+++Q++ G+ +IGLQ GSN+GASQ+GM
Sbjct:   86 KQMEQVSQFLNAAEQYGVAKTDIFQTVDLWEGKDLAAVQRTLMALGSIAVTKEDGAFRGDPNWFFKKAQENRRDFSDDQMKEGKNVIGLQMGSNRGASQAGM 187          
BLAST of Calponin vs. Ensembl Zebrafish
Match: tagln (transgelin [Source:ZFIN;Acc:ZDB-GENE-070912-1])

HSP 1 Score: 99.3673 bits (246), Expect = 3.583e-27
Identity = 49/102 (48.04%), Postives = 71/102 (69.61%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNE---FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FLNA+E YGV +T +FQTVDL+E +++  V  TL+ LG+     E   F+G P    K   EN+R+F+++Q++ G+ +IGLQ GSN+GASQ+GM
Sbjct:   86 KQMEQVSQFLNAAEQYGVAKTDIFQTVDLWEGKDLAAVQRTLMALGSIAVTKEDGAFRGDPNWFFKKAQENRRDFSDDQMKEGKNVIGLQMGSNRGASQAGM 187          
BLAST of Calponin vs. Ensembl Xenopus
Match: tagln2 (transgelin 2 [Source:NCBI gene;Acc:394981])

HSP 1 Score: 105.145 bits (261), Expect = 2.775e-29
Identity = 55/102 (53.92%), Postives = 71/102 (69.61%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLG-TECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A E YG+P + LFQTVDL+E ++M  V  TL+ LG     + +  F+G P   PK + ENKREF++++L+ GQ IIGLQ G+NKGASQSGM
Sbjct:   86 KQMEQISQFLKACERYGIPASDLFQTVDLWEGKDMASVQRTLMNLGGIAVTKGDGYFRGDPNWFPKKSQENKREFSQDKLKEGQNIIGLQMGTNKGASQSGM 187          
BLAST of Calponin vs. Ensembl Xenopus
Match: kcnb2 (potassium channel, voltage gated Shab related subfamily B, member 2 [Source:Xenbase;Acc:XB-GENE-989392])

HSP 1 Score: 98.5969 bits (244), Expect = 1.215e-26
Identity = 52/102 (50.98%), Postives = 73/102 (71.57%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FL ASE YGV +T +FQTVDLYE ++M  V  T++ LG+    +N+  +KG P+   K   E+KR+F++E+L+ G+ IIGLQ GSN+GA+QSGM
Sbjct:   95 KQMEQVAQFLRASEDYGVVKTDMFQTVDLYEGKDMAAVQRTIVALGSIAVTKNDGQYKGDPSWFMKKAQEHKRDFSDEKLKEGKNIIGLQMGSNQGATQSGM 196          
BLAST of Calponin vs. Ensembl Xenopus
Match: kcnb2 (potassium channel, voltage gated Shab related subfamily B, member 2 [Source:Xenbase;Acc:XB-GENE-989392])

HSP 1 Score: 98.5969 bits (244), Expect = 1.229e-26
Identity = 52/102 (50.98%), Postives = 73/102 (71.57%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FL ASE YGV +T +FQTVDLYE ++M  V  T++ LG+    +N+  +KG P+   K   E+KR+F++E+L+ G+ IIGLQ GSN+GA+QSGM
Sbjct:   89 KQMEQVAQFLRASEDYGVVKTDMFQTVDLYEGKDMAAVQRTIVALGSIAVTKNDGQYKGDPSWFMKKAQEHKRDFSDEKLKEGKNIIGLQMGSNQGATQSGM 190          
BLAST of Calponin vs. Ensembl Xenopus
Match: tfdp1 (transcription factor Dp-1 [Source:Xenbase;Acc:XB-GENE-1219073])

HSP 1 Score: 72.0182 bits (175), Expect = 9.777e-16
Identity = 42/105 (40.00%), Postives = 64/105 (60.95%), Query Frame = 3
Query:    6 QMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQL-GTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM-RIGTQR 314
            ++ENI  F+ A + YG+    +F+  DL+E+ NM QV  +L+ L G    R        G K   + KR+F +E++++GQ +IGLQ G+NK ASQ+GM   GT+R
Sbjct:   82 KLENIGNFIKAMQDYGMKPHDIFEANDLFENGNMTQVQTSLVSLAGLAKTRGFHTSVDIGVKYAEKQKRQFGDEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRR 186          
BLAST of Calponin vs. Ensembl Xenopus
Match: cnn1 (calponin 1, basic, smooth muscle [Source:NCBI gene;Acc:407907])

HSP 1 Score: 65.4698 bits (158), Expect = 1.778e-13
Identity = 42/105 (40.00%), Postives = 59/105 (56.19%), Query Frame = 3
Query:    6 QMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQL-GTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM-RIGTQR 314
            Q+EN+  F+ A   YG+    LF+  DL+E+ NM QV  +LL L G    R        G K + + +R F +   ++G  +IGLQ G+NK ASQSGM   GT+R
Sbjct:   84 QLENLSNFIKAMNLYGMKSVDLFEANDLFENGNMTQVQVSLLALAGLAKSRGMQSEVDIGVKYSEKQERNFDDNTKKAGHCVIGLQMGTNKCASQSGMTAYGTRR 188          
BLAST of Calponin vs. Ensembl Mouse
Match: Tagln3 (transgelin 3 [Source:MGI Symbol;Acc:MGI:1926784])

HSP 1 Score: 99.3673 bits (246), Expect = 3.586e-27
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. Ensembl Mouse
Match: Tagln (transgelin [Source:MGI Symbol;Acc:MGI:106012])

HSP 1 Score: 97.0561 bits (240), Expect = 2.951e-26
Identity = 51/102 (50.00%), Postives = 71/102 (69.61%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FL A+E YGV +T +FQTVDLYE ++M  V  TL+ LG+    +N+  ++G P    K   E+KR+FT+ QL+ G+ +IGLQ GSN+GASQ+GM
Sbjct:   89 KQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGM 190          
BLAST of Calponin vs. Ensembl Mouse
Match: Tagln2 (transgelin 2 [Source:MGI Symbol;Acc:MGI:1312985])

HSP 1 Score: 93.9745 bits (232), Expect = 5.115e-25
Identity = 51/102 (50.00%), Postives = 68/102 (66.67%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQL-GTECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YG+  T +FQTVDL+E +NM  V  TL+ L G    R++  F G P   PK + EN R F++ QL+ G+ +IGLQ G+N+GASQ+GM
Sbjct:   88 KQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGM 189          
BLAST of Calponin vs. Ensembl Mouse
Match: Tagln2 (transgelin 2 [Source:MGI Symbol;Acc:MGI:1312985])

HSP 1 Score: 93.9745 bits (232), Expect = 5.115e-25
Identity = 51/102 (50.00%), Postives = 68/102 (66.67%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQL-GTECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YG+  T +FQTVDL+E +NM  V  TL+ L G    R++  F G P   PK + EN R F++ QL+ G+ +IGLQ G+N+GASQ+GM
Sbjct:   88 KQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGM 189          
BLAST of Calponin vs. Ensembl Mouse
Match: Cnn3 (calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919244])

HSP 1 Score: 72.7886 bits (177), Expect = 4.102e-16
Identity = 44/105 (41.90%), Postives = 62/105 (59.05%), Query Frame = 3
Query:    6 QMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGP-TCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM-RIGTQR 314
            Q+ENI  F+ A +AYG+    +F+  DL+E+ NM QV  TL+ L    +   F      G K   +  R F E +L++GQ +IGLQ G+NK ASQ+GM   GT+R
Sbjct:   82 QLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRR 186          
BLAST of Calponin vs. UniProt/SwissProt
Match: sp|Q24799|MYPH_ECHGR (Myophilin OS=Echinococcus granulosus OX=6210 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.253e-36
Identity = 61/105 (58.10%), Postives = 74/105 (70.48%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRN-EFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  FL A + YGVP   LFQTVDL+E +++ QV  TL  LG  CQ + E+ GP  GPK   ENKREFTE+QLR GQ ++ LQ GSNKGASQ+G+ +G QR
Sbjct:   82 KIMENISAFLEAMKGYGVPVADLFQTVDLFEKKDIAQVTRTLFALGRTCQTHPEYSGPVLGPKLATENKREFTEQQLREGQNVVSLQYGSNKGASQAGINMGKQR 186          
BLAST of Calponin vs. UniProt/SwissProt
Match: sp|P14318|MP20_DROME (Muscle-specific protein 20 OS=Drosophila melanogaster OX=7227 GN=Mp20 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 4.749e-34
Identity = 58/105 (55.24%), Postives = 74/105 (70.48%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRN-EFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  F  A + YGVP   +FQTVDLYE +++  V NT+  LG    ++ +FKGP  GPKP  E KR+FTEEQL++GQ I+GLQAGSNKGA+Q+G  +G  R
Sbjct:   74 KFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178          
BLAST of Calponin vs. UniProt/SwissProt
Match: sp|P19966|TAGL_CHICK (Transgelin OS=Gallus gallus OX=9031 GN=TAGLN PE=1 SV=3)

HSP 1 Score: 101.679 bits (252), Expect = 3.882e-27
Identity = 55/108 (50.93%), Postives = 73/108 (67.59%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQME I  FL A+E YGV +T +FQTVDL+E+++M  V  TL+ LG+    +N+  + G P    K   E+KREF+E QL+ G+ IIGLQ G+NKGASQ+GM  G  R
Sbjct:   89 KQMEQIAQFLKAAEDYGVVKTDMFQTVDLFEAKDMAAVQRTLVALGSLAVTKNDGHYHGDPNWFMKKAQEHKREFSESQLKEGKNIIGLQMGTNKGASQAGMSYGRPR 196          
BLAST of Calponin vs. UniProt/SwissProt
Match: sp|Q9R1Q8|TAGL3_MOUSE (Transgelin-3 OS=Mus musculus OX=10090 GN=Tagln3 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.508e-26
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. UniProt/SwissProt
Match: sp|P37805|TAGL3_RAT (Transgelin-3 OS=Rattus norvegicus OX=10116 GN=Tagln3 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.705e-26
Identity = 54/105 (51.43%), Postives = 68/105 (64.76%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTE-------CQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV  T +FQTVDL+E ++M  V  TL+ LG+        C R E   P+   +   +N+R F+EEQLR GQ +IGLQ GSNKGASQ+GM
Sbjct:   88 KQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGE---PSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGM 189          
BLAST of Calponin vs. TrEMBL
Match: A0A419Q3F7 (Calponin (Fragment) OS=Clonorchis sinensis OX=79923 GN=Cnn3 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.198e-54
Identity = 85/104 (81.73%), Postives = 93/104 (89.42%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQ+FLNA+ AYGVPRTSLFQTVDLYE+RNM QV+NTLLQLGTECQRN F G TCGPKPTYENKREFTEEQLR+ +GIIGLQAG+NK ASQ+GM  G  R
Sbjct:   77 KQMENIQMFLNAAAAYGVPRTSLFQTVDLYEARNMAQVLNTLLQLGTECQRNNFNGETCGPKPTYENKREFTEEQLRASEGIIGLQAGTNKLASQAGMSHGGPR 180          
BLAST of Calponin vs. TrEMBL
Match: A0A1S8X8B2 (Transgelin (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01165 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.659e-54
Identity = 85/104 (81.73%), Postives = 93/104 (89.42%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQ+FLNA+ AYGVPRTSLFQTVDLYE+RNM QV+NTLLQLGTECQRN F G TCGPKPTYENKREFTEEQLR+ +GIIGLQAG+NK ASQ+GM  G  R
Sbjct:   88 KQMENIQMFLNAAAAYGVPRTSLFQTVDLYEARNMAQVLNTLLQLGTECQRNNFNGETCGPKPTYENKREFTEEQLRASEGIIGLQAGTNKLASQAGMSHGGPR 191          
BLAST of Calponin vs. TrEMBL
Match: A0A074ZHZ2 (Calponin OS=Opisthorchis viverrini OX=6198 GN=T265_07140 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.790e-54
Identity = 85/104 (81.73%), Postives = 93/104 (89.42%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQ+FLNA+ AYGVPRTSLFQTVDLYE+RNM QV+NTLLQLGTECQRN F G TCGPKPTYENKREFTEEQLR+ +GIIGLQAG+NK ASQ+GM  G  R
Sbjct:   94 KQMENIQMFLNAAAAYGVPRTSLFQTVDLYEARNMAQVLNTLLQLGTECQRNNFNGETCGPKPTYENKREFTEEQLRASEGIIGLQAGTNKLASQAGMSHGGPR 197          
BLAST of Calponin vs. TrEMBL
Match: A0A4S2M106 (Calponin OS=Opisthorchis felineus OX=147828 GN=CRM22_003609 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.829e-54
Identity = 85/104 (81.73%), Postives = 93/104 (89.42%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQ+FLNA+ AYGVPRTSLFQTVDLYE+RNM QV+NTLLQLGTECQRN F G TCGPKPTYENKREFTEEQLR+ +GIIGLQAG+NK ASQ+GM  G  R
Sbjct:   94 KQMENIQMFLNAAAAYGVPRTSLFQTVDLYEARNMAQVLNTLLQLGTECQRNNFNGETCGPKPTYENKREFTEEQLRASEGIIGLQAGTNKLASQAGMSHGGPR 197          
BLAST of Calponin vs. TrEMBL
Match: H2KRE5 (Calponin OS=Clonorchis sinensis OX=79923 GN=CLF_106102 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.849e-54
Identity = 85/104 (81.73%), Postives = 93/104 (89.42%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQ+FLNA+ AYGVPRTSLFQTVDLYE+RNM QV+NTLLQLGTECQRN F G TCGPKPTYENKREFTEEQLR+ +GIIGLQAG+NK ASQ+GM  G  R
Sbjct:   94 KQMENIQMFLNAAAAYGVPRTSLFQTVDLYEARNMAQVLNTLLQLGTECQRNNFNGETCGPKPTYENKREFTEEQLRASEGIIGLQAGTNKLASQAGMSHGGPR 197          
BLAST of Calponin vs. Ensembl Cavefish
Match: tagln (transgelin-like [Source:NCBI gene;Acc:103045968])

HSP 1 Score: 105.145 bits (261), Expect = 1.939e-29
Identity = 52/102 (50.98%), Postives = 72/102 (70.59%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTEC---QRNEFKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FLNA+EAYGV +T +FQTVDL+E +++  V  TL+ LG+         F+G P    K   EN+R+F+++QL+SG+ +IGLQ GSNKGASQ+GM
Sbjct:   95 KQMEQVSQFLNAAEAYGVTKTDMFQTVDLWEGKDLAAVQRTLMALGSIAVTKDDGHFRGNPDWFFKKAQENRRDFSDDQLKSGKHVIGLQMGSNKGASQAGM 196          
BLAST of Calponin vs. Ensembl Cavefish
Match: tagln (transgelin-like [Source:NCBI gene;Acc:103045968])

HSP 1 Score: 104.375 bits (259), Expect = 2.635e-29
Identity = 52/102 (50.98%), Postives = 72/102 (70.59%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTEC---QRNEFKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME +  FLNA+EAYGV +T +FQTVDL+E +++  V  TL+ LG+         F+G P    K   EN+R+F+++QL+SG+ +IGLQ GSNKGASQ+GM
Sbjct:   75 KQMEQVSQFLNAAEAYGVTKTDMFQTVDLWEGKDLAAVQRTLMALGSIAVTKDDGHFRGNPDWFFKKAQENRRDFSDDQLKSGKHVIGLQMGSNKGASQAGM 176          
BLAST of Calponin vs. Ensembl Cavefish
Match: TAGLN3 (transgelin 3 [Source:NCBI gene;Acc:103030448])

HSP 1 Score: 97.8265 bits (242), Expect = 1.468e-26
Identity = 53/103 (51.46%), Postives = 68/103 (66.02%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYE-----NKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+EAYGV  T +FQTVDL+E ++M  V  TL+ LG+     +  G   G +  +      N+REF+EEQLR GQ +IGLQ GSN+GASQ+GM
Sbjct:   88 KQMEKISQFLVAAEAYGVITTDIFQTVDLWEGKDMAAVQRTLMALGSVALTKD-DGHYRGNRDWFHRTAQSNRREFSEEQLRQGQNLIGLQMGSNRGASQAGM 189          
BLAST of Calponin vs. Ensembl Cavefish
Match: tagln3a (transgelin-3-like [Source:NCBI gene;Acc:103024278])

HSP 1 Score: 97.4413 bits (241), Expect = 2.928e-26
Identity = 53/103 (51.46%), Postives = 67/103 (65.05%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENK-----REFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+E YGV R  +FQTVDL+E +++  V  TL+ LG+E    +  G   G K  +  K     REF+EEQLR G+ +IGLQ GSN+GASQSGM
Sbjct:   88 KQMEKISQFLEAAEVYGVVRGDIFQTVDLWEGKDLAAVQRTLMALGSEALTKD-DGHYHGNKDWFRRKAKGHRREFSEEQLRQGRALIGLQMGSNRGASQSGM 189          
BLAST of Calponin vs. Ensembl Cavefish
Match: cnn3a (calponin 3 [Source:NCBI gene;Acc:103024651])

HSP 1 Score: 69.707 bits (169), Expect = 3.790e-15
Identity = 40/105 (38.10%), Postives = 62/105 (59.05%), Query Frame = 3
Query:    6 QMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPT-CGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM-RIGTQR 314
            ++EN+  F+ A   YG+    +F+  DL+E+ NM QV  TLL L +  +          G K   + +R F +E++++GQ +IGLQ G+NK ASQ+GM   GT+R
Sbjct:   83 KLENLGNFIKAILTYGLKPNDIFEANDLFENGNMTQVQTTLLALASMAKTKGMDSKVDIGVKYADKQERHFDDEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRR 187          
BLAST of Calponin vs. Ensembl Yeast
Match: SCP1 (Component of yeast cortical actin cytoskeleton; binds and cross links actin filaments; originally identified by its homology to calponin (contains a calponin-like repeat) but the Scp1p domain structure is more similar to transgelin [Source:SGD;Acc:S000005894])

HSP 1 Score: 58.151 bits (139), Expect = 3.171e-12
Identity = 37/109 (33.94%), Postives = 58/109 (53.21%), Query Frame = 3
Query:    6 QMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTEC-QRNEFKGPTCGPKPTYENKREFTE---EQLRSGQGIIGLQAGSNKGASQS--GMRIGTQR 314
            QM+ I  FL+ S  YGVP   LFQT+DL+E ++   V  TL  L     +++  + P  GP+ + +  R   +   + L+ G G    + G  KGASQ+  G+ +G +R
Sbjct:   89 QMDQISQFLSFSRKYGVPEDELFQTIDLFEKKDPAIVFQTLKSLSRYANKKHTDRFPVLGPQLSTKKPRPPVKSKPKHLQDGTGWSTFEYGYMKGASQATEGVVLGQRR 197          
BLAST of Calponin vs. Ensembl Nematostella
Match: EDO30654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T056])

HSP 1 Score: 108.227 bits (269), Expect = 4.721e-32
Identity = 54/104 (51.92%), Postives = 69/104 (66.35%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  FL+    +GV ++ LFQTVDLYE +N+ QVIN++  L  +        P  GPK + +N REFTEEQ R+G+G+IGLQ GSNKGASQ+G   G  R
Sbjct:    4 KMMENIAKFLDFCGTFGVAKSDLFQTVDLYEKQNIQQVINSIYALARKANSKGLSVPILGPKESQKNPREFTEEQKRAGEGVIGLQMGSNKGASQAGDTFGRPR 107          
BLAST of Calponin vs. Ensembl Nematostella
Match: EDO30656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T059])

HSP 1 Score: 108.227 bits (269), Expect = 2.749e-31
Identity = 54/104 (51.92%), Postives = 69/104 (66.35%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MENI  FL+    +GV ++ LFQTVDLYE +N+ QVIN++  L  +        P  GPK + +N REFTEEQ R+G+G+IGLQ GSNKGASQ+G   G  R
Sbjct:   64 KMMENIAKFLDFCGTFGVAKSDLFQTVDLYEKQNIQQVINSIHALARKANSKGLSVPILGPKESQKNPREFTEEQKRAGEGVIGLQMGSNKGASQAGDTFGRPR 167          
BLAST of Calponin vs. Ensembl Nematostella
Match: EDO46712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC0])

HSP 1 Score: 106.686 bits (265), Expect = 1.762e-30
Identity = 58/107 (54.21%), Postives = 67/107 (62.62%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTC---GPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            K MEN   FL   +  GVP+T +FQTVDLYE +NM  VIN +  LG +       G TC   GPK    N REFTEEQ R+GQG+IGLQ GSNKGASQ+G   G  R
Sbjct:   83 KMMENTGKFLEFCDTIGVPKTDMFQTVDLYEKQNMPGVINGIHALGRKAHST---GKTCLALGPKEASANPREFTEEQRRAGQGVIGLQMGSNKGASQAGDHFGRPR 186          
BLAST of Calponin vs. Ensembl Nematostella
Match: EDO44075 (Myophilin-like protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWR1])

HSP 1 Score: 88.9669 bits (219), Expect = 1.155e-23
Identity = 51/107 (47.66%), Postives = 65/107 (60.75%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQR-NEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAG--SNKGASQSGMRIGTQR 314
            KQMENI  FL+     GV     FQT DLY++ NM  VI+ +  +G +CQ   +   PT GPK    N REFTEEQLR+G+ I+G+QAG   ++ ASQSG   G  R
Sbjct:   83 KQMENIGNFLSHCGHLGVASGDQFQTADLYDNANMTSVISCIHAVGRKCQLIKDLDIPTLGPKEAEANVREFTEEQLRAGESILGMQAGPTQDQVASQSGDHYGRGR 189          
BLAST of Calponin vs. Ensembl Nematostella
Match: EDO46658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB8])

HSP 1 Score: 77.411 bits (189), Expect = 2.509e-19
Identity = 43/89 (48.31%), Postives = 52/89 (58.43%), Query Frame = 3
Query:    3 KQMENIQLFLNASEA-YGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAG 266
            KQMENI  FL+  E   GV +  LFQTVDLYE  NM  VI  +  +G          P  GPK    N R+F+EEQLR+G+GI+  QAG
Sbjct:   83 KQMENIGNFLSFIENNLGVAKNDLFQTVDLYEKSNMWNVICCIHAVGRRAAAKGLDVPVLGPKEADANPRQFSEEQLRAGEGILTKQAG 171          
BLAST of Calponin vs. Ensembl Medaka
Match: ENSORLT00000011293.2 (transgelin [Source:NCBI gene;Acc:101159525])

HSP 1 Score: 100.523 bits (249), Expect = 1.303e-27
Identity = 52/102 (50.98%), Postives = 73/102 (71.57%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I LFL  +EAYGV +T +FQTVDL+ES+++  V  TL+ LG+    +N+  ++G P    +   EN+R+F+EEQL  G+ +IGLQ G+NKGASQ+GM
Sbjct:   87 KQMEQISLFLKYAEAYGVIKTDMFQTVDLFESKDLAAVQRTLMALGSLAVTKNDGNYRGDPNWFHRKAQENRRDFSEEQLSGGKSVIGLQMGTNKGASQAGM 188          
BLAST of Calponin vs. Ensembl Medaka
Match: ENSORLT00000028673.1 (transgelin [Source:NCBI gene;Acc:101159525])

HSP 1 Score: 100.523 bits (249), Expect = 1.337e-27
Identity = 52/102 (50.98%), Postives = 73/102 (71.57%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I LFL  +EAYGV +T +FQTVDL+ES+++  V  TL+ LG+    +N+  ++G P    +   EN+R+F+EEQL  G+ +IGLQ G+NKGASQ+GM
Sbjct:   87 KQMEQISLFLKYAEAYGVIKTDMFQTVDLFESKDLAAVQRTLMALGSLAVTKNDGNYRGDPNWFHRKAQENRRDFSEEQLSGGKSVIGLQMGTNKGASQAGM 188          
BLAST of Calponin vs. Ensembl Medaka
Match: tagln (transgelin [Source:NCBI gene;Acc:101169057])

HSP 1 Score: 100.138 bits (248), Expect = 1.809e-27
Identity = 54/108 (50.00%), Postives = 73/108 (67.59%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQME I  FLNA+E YGV +T +FQTVDL+E +++  V  TL  LG+    ++E  + G P    K   ENKR+F+++QL++G+ +IGLQ GSNKGASQ GM  G  R
Sbjct:   87 KQMEQISQFLNAAEKYGVTKTDMFQTVDLWEGKDLAAVQRTLSALGSLAVTKDEGTYNGDPNWFFKKAQENKRDFSDDQLKAGKNVIGLQMGSNKGASQEGMSYGRPR 194          
BLAST of Calponin vs. Ensembl Medaka
Match: tagln (transgelin [Source:NCBI gene;Acc:101169057])

HSP 1 Score: 100.138 bits (248), Expect = 1.917e-27
Identity = 54/108 (50.00%), Postives = 73/108 (67.59%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGT-ECQRNE--FKG-PTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQME I  FLNA+E YGV +T +FQTVDL+E +++  V  TL  LG+    ++E  + G P    K   ENKR+F+++QL++G+ +IGLQ GSNKGASQ GM  G  R
Sbjct:   94 KQMEQISQFLNAAEKYGVTKTDMFQTVDLWEGKDLAAVQRTLSALGSLAVTKDEGTYNGDPNWFFKKAQENKRDFSDDQLKAGKNVIGLQMGSNKGASQEGMSYGRPR 201          
BLAST of Calponin vs. Ensembl Medaka
Match: tagln3a (transgelin 3 [Source:NCBI gene;Acc:101158980])

HSP 1 Score: 100.138 bits (248), Expect = 2.411e-27
Identity = 55/103 (53.40%), Postives = 67/103 (65.05%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENK-----REFTEEQLRSGQGIIGLQAGSNKGASQSGM 296
            KQME I  FL A+EAYGV  T +FQTVDL+E ++M  V  TL+ LG+     +  G   G +  +  K     REFTEEQLR GQ +IGLQ GSN+GASQSGM
Sbjct:  101 KQMEKISQFLQAAEAYGVTTTDIFQTVDLWEGKDMAAVQRTLMALGSLAVTKD-DGHYKGDRDWFHRKAQGYRREFTEEQLRQGQSLIGLQMGSNRGASQSGM 202          
BLAST of Calponin vs. Planmine SMEST
Match: SMESG000057600.1 (SMESG000057600.1)

HSP 1 Score: 219.935 bits (559), Expect = 7.301e-70
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR
Sbjct:   87 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 190          

HSP 2 Score: 48.521 bits (114), Expect = 9.678e-8
Identity = 22/32 (68.75%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E     +G+IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  357 DEMCDDAKGVIGLQAGSNKGATQAGMRIGTQR 388          

HSP 3 Score: 48.521 bits (114), Expect = 9.678e-8
Identity = 22/32 (68.75%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E     +G+IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  476 DEMCDDAKGVIGLQAGSNKGATQAGMRIGTQR 507          

HSP 4 Score: 47.7506 bits (112), Expect = 1.752e-7
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 3
Query:  234 SGQGIIGLQAGSNKGASQSGMRIGTQR 314
            SG+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  283 SGKNVIGLQAGSNKGATQAGMRIGTQR 309          

HSP 5 Score: 47.7506 bits (112), Expect = 1.752e-7
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 3
Query:  234 SGQGIIGLQAGSNKGASQSGMRIGTQR 314
            SG+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  402 SGKNVIGLQAGSNKGATQAGMRIGTQR 428          

HSP 6 Score: 47.3654 bits (111), Expect = 2.637e-7
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 3
Query:  234 SGQGIIGLQAGSNKGASQSGMRIGTQR 314
            SG+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  521 SGKTVIGLQAGSNKGATQAGMRIGTQR 547          

HSP 7 Score: 47.3654 bits (111), Expect = 2.768e-7
Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E   S +G+IGLQAGSNK ASQ+GMRIGTQR
Sbjct:  238 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQR 269          

HSP 8 Score: 46.595 bits (109), Expect = 4.547e-7
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 3
Query:  201 NKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            N  E ++E    G+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  554 NGIEISDE----GKNVIGLQAGSNKGATQAGMRIGTQR 587          
BLAST of Calponin vs. Planmine SMEST
Match: SMESG000057600.1 (SMESG000057600.1)

HSP 1 Score: 219.55 bits (558), Expect = 9.493e-70
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR
Sbjct:   94 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 197          

HSP 2 Score: 48.521 bits (114), Expect = 9.877e-8
Identity = 22/32 (68.75%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E     +G+IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  364 DEMCDDAKGVIGLQAGSNKGATQAGMRIGTQR 395          

HSP 3 Score: 48.521 bits (114), Expect = 9.877e-8
Identity = 22/32 (68.75%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E     +G+IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  483 DEMCDDAKGVIGLQAGSNKGATQAGMRIGTQR 514          

HSP 4 Score: 47.7506 bits (112), Expect = 1.788e-7
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 3
Query:  234 SGQGIIGLQAGSNKGASQSGMRIGTQR 314
            SG+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  290 SGKNVIGLQAGSNKGATQAGMRIGTQR 316          

HSP 5 Score: 47.7506 bits (112), Expect = 1.788e-7
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 3
Query:  234 SGQGIIGLQAGSNKGASQSGMRIGTQR 314
            SG+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  409 SGKNVIGLQAGSNKGATQAGMRIGTQR 435          

HSP 6 Score: 47.3654 bits (111), Expect = 2.691e-7
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 3
Query:  234 SGQGIIGLQAGSNKGASQSGMRIGTQR 314
            SG+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  528 SGKTVIGLQAGSNKGATQAGMRIGTQR 554          

HSP 7 Score: 47.3654 bits (111), Expect = 2.853e-7
Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E   S +G+IGLQAGSNK ASQ+GMRIGTQR
Sbjct:  245 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQR 276          

HSP 8 Score: 46.595 bits (109), Expect = 4.778e-7
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 3
Query:  201 NKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            N  E ++E    G+ +IGLQAGSNKGA+Q+GMRIGTQR
Sbjct:  561 NGIEISDE----GKNVIGLQAGSNKGATQAGMRIGTQR 594          
BLAST of Calponin vs. Planmine SMEST
Match: SMESG000057599.1 (SMESG000057599.1)

HSP 1 Score: 203.756 bits (517), Expect = 1.027e-66
Identity = 96/104 (92.31%), Postives = 99/104 (95.19%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQLFL ASEAYGVPR SLFQTVDLYESRNM QV+NTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRS QGIIGLQAGSNKGA+Q+GMRIG QR
Sbjct:   94 KQMENIQLFLKASEAYGVPRASLFQTVDLYESRNMAQVLNTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSSQGIIGLQAGSNKGATQAGMRIGGQR 197          

HSP 2 Score: 49.2914 bits (116), Expect = 4.723e-8
Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E     +G+IGLQAGSNKGASQ+GMRIGTQR
Sbjct:  245 DEMSDEAKGVIGLQAGSNKGASQAGMRIGTQR 276          
BLAST of Calponin vs. Planmine SMEST
Match: SMESG000057599.1 (SMESG000057599.1)

HSP 1 Score: 200.675 bits (509), Expect = 4.188e-65
Identity = 95/104 (91.35%), Postives = 97/104 (93.27%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQLFL ASEAYGVPR SLFQTVDLYESRNM QV+NTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRS QGIIGLQAGSNKGASQSGM +G  R
Sbjct:   94 KQMENIQLFLKASEAYGVPRASLFQTVDLYESRNMAQVLNTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSSQGIIGLQAGSNKGASQSGMSMGAVR 197          

HSP 2 Score: 49.2914 bits (116), Expect = 5.348e-8
Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 3
Query:  219 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            +E     +G+IGLQAGSNKGASQ+GMRIGTQR
Sbjct:  284 DEMSDEAKGVIGLQAGSNKGASQAGMRIGTQR 315          
BLAST of Calponin vs. Planmine SMEST
Match: SMESG000067773.1 (SMESG000067773.1)

HSP 1 Score: 156.762 bits (395), Expect = 5.285e-48
Identity = 73/104 (70.19%), Postives = 87/104 (83.65%), Query Frame = 3
Query:    3 KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQRNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRIGTQR 314
            KQMENIQ+FL A+E+YGVPR SLFQTVDL+ESRNM QV+N++LQLGTECQR+ F GP CG KPT  N R+F++EQLR G+GII LQ+G+NK ASQSGM  G  R
Sbjct:   94 KQMENIQIFLRAAESYGVPRQSLFQTVDLFESRNMAQVLNSILQLGTECQRSGFSGPVCGAKPTSTNYRQFSDEQLRMGEGIINLQSGTNKFASQSGMSFGGVR 197          
The following BLAST results are available for this feature:
BLAST of Calponin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAGLN39.791e-2951.43transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868][more]
TAGLN35.945e-2751.43transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868][more]
TAGLN35.945e-2751.43transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868][more]
TAGLN35.945e-2751.43transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868][more]
TAGLN35.945e-2751.43transgelin 3 [Source:HGNC Symbol;Acc:HGNC:29868][more]
back to top
BLAST of Calponin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpn-12.352e-2446.15CPN-1; CalPoNin [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
cpn-12.352e-2446.15CPN-1; CalPoNin [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
cpn-12.352e-2446.15CPN-1; CalPoNin [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
cpn-24.018e-1741.84Transgelin [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU... [more]
cpn-22.391e-1641.84Transgelin [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU... [more]
back to top
BLAST of Calponin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mp204.738e-3555.24gene:FBgn0002789 transcript:FBtr0087745[more]
Mp205.027e-3555.24gene:FBgn0002789 transcript:FBtr0345532[more]
CG50231.203e-2754.17gene:FBgn0038774 transcript:FBtr0083866[more]
Chd649.478e-2646.15gene:FBgn0035499 transcript:FBtr0310531[more]
Chd649.596e-2646.15gene:FBgn0035499 transcript:FBtr0073270[more]
back to top
BLAST of Calponin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tagln21.731e-2849.52transgelin 2 [Source:ZFIN;Acc:ZDB-GENE-020802-2][more]
tagln21.731e-2849.52transgelin 2 [Source:ZFIN;Acc:ZDB-GENE-020802-2][more]
tagln22.692e-2849.52transgelin 2 [Source:ZFIN;Acc:ZDB-GENE-020802-2][more]
tagln3.583e-2748.04transgelin [Source:ZFIN;Acc:ZDB-GENE-070912-1][more]
tagln3.583e-2748.04transgelin [Source:ZFIN;Acc:ZDB-GENE-070912-1][more]
back to top
BLAST of Calponin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tagln22.775e-2953.92transgelin 2 [Source:NCBI gene;Acc:394981][more]
kcnb21.215e-2650.98potassium channel, voltage gated Shab related subf... [more]
kcnb21.229e-2650.98potassium channel, voltage gated Shab related subf... [more]
tfdp19.777e-1640.00transcription factor Dp-1 [Source:Xenbase;Acc:XB-G... [more]
cnn11.778e-1340.00calponin 1, basic, smooth muscle [Source:NCBI gene... [more]
back to top
BLAST of Calponin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tagln33.586e-2751.43transgelin 3 [Source:MGI Symbol;Acc:MGI:1926784][more]
Tagln2.951e-2650.00transgelin [Source:MGI Symbol;Acc:MGI:106012][more]
Tagln25.115e-2550.00transgelin 2 [Source:MGI Symbol;Acc:MGI:1312985][more]
Tagln25.115e-2550.00transgelin 2 [Source:MGI Symbol;Acc:MGI:1312985][more]
Cnn34.102e-1641.90calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919... [more]
back to top
BLAST of Calponin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24799|MYPH_ECHGR2.253e-3658.10Myophilin OS=Echinococcus granulosus OX=6210 PE=2 ... [more]
sp|P14318|MP20_DROME4.749e-3455.24Muscle-specific protein 20 OS=Drosophila melanogas... [more]
sp|P19966|TAGL_CHICK3.882e-2750.93Transgelin OS=Gallus gallus OX=9031 GN=TAGLN PE=1 ... [more]
sp|Q9R1Q8|TAGL3_MOUSE2.508e-2651.43Transgelin-3 OS=Mus musculus OX=10090 GN=Tagln3 PE... [more]
sp|P37805|TAGL3_RAT2.705e-2651.43Transgelin-3 OS=Rattus norvegicus OX=10116 GN=Tagl... [more]
back to top
BLAST of Calponin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419Q3F71.198e-5481.73Calponin (Fragment) OS=Clonorchis sinensis OX=7992... [more]
A0A1S8X8B21.659e-5481.73Transgelin (Fragment) OS=Opisthorchis viverrini OX... [more]
A0A074ZHZ21.790e-5481.73Calponin OS=Opisthorchis viverrini OX=6198 GN=T265... [more]
A0A4S2M1061.829e-5481.73Calponin OS=Opisthorchis felineus OX=147828 GN=CRM... [more]
H2KRE51.849e-5481.73Calponin OS=Clonorchis sinensis OX=79923 GN=CLF_10... [more]
back to top
BLAST of Calponin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tagln1.939e-2950.98transgelin-like [Source:NCBI gene;Acc:103045968][more]
tagln2.635e-2950.98transgelin-like [Source:NCBI gene;Acc:103045968][more]
TAGLN31.468e-2651.46transgelin 3 [Source:NCBI gene;Acc:103030448][more]
tagln3a2.928e-2651.46transgelin-3-like [Source:NCBI gene;Acc:103024278][more]
cnn3a3.790e-1538.10calponin 3 [Source:NCBI gene;Acc:103024651][more]
back to top
BLAST of Calponin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCP13.171e-1233.94Component of yeast cortical actin cytoskeleton; bi... [more]
back to top
BLAST of Calponin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO306544.721e-3251.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306562.749e-3151.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467121.762e-3054.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440751.155e-2347.66Myophilin-like protein; Predicted protein [Source... [more]
EDO466582.509e-1948.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calponin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011293.21.303e-2750.98transgelin [Source:NCBI gene;Acc:101159525][more]
ENSORLT00000028673.11.337e-2750.98transgelin [Source:NCBI gene;Acc:101159525][more]
tagln1.809e-2750.00transgelin [Source:NCBI gene;Acc:101169057][more]
tagln1.917e-2750.00transgelin [Source:NCBI gene;Acc:101169057][more]
tagln3a2.411e-2753.40transgelin 3 [Source:NCBI gene;Acc:101158980][more]
back to top
BLAST of Calponin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057600.17.301e-70100.00SMESG000057600.1[more]
SMESG000057600.19.493e-70100.00SMESG000057600.1[more]
SMESG000057599.11.027e-6692.31SMESG000057599.1[more]
SMESG000057599.14.188e-6591.35SMESG000057599.1[more]
SMESG000067773.15.285e-4870.19SMESG000067773.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000960 ID=SMED30000960|Name=Calponin|organism=Schmidtea mediterranea sexual|type=transcript|length=314bp
TTAAACAAATGGAAAATATTCAACTCTTTTTGAATGCTTCGGAAGCGTAT
GGAGTTCCAAGAACGAGCTTATTCCAAACGGTTGATTTGTATGAAAGTAG
AAATATGGTTCAAGTAATAAATACATTATTACAGCTAGGTACAGAGTGTC
AAAGAAATGAATTCAAAGGTCCAACTTGTGGTCCAAAACCGACATATGAA
AACAAGAGAGAATTTACTGAAGAACAACTAAGATCAGGTCAAGGGATAAT
TGGTTTGCAAGCTGGATCAAATAAGGGTGCAAGTCAAAGTGGAATGAGAA
TTGGAACTCAGAGA
back to top

protein sequence of SMED30000960-orf-1

>SMED30000960-orf-1 ID=SMED30000960-orf-1|Name=SMED30000960-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
KQMENIQLFLNASEAYGVPRTSLFQTVDLYESRNMVQVINTLLQLGTECQ
RNEFKGPTCGPKPTYENKREFTEEQLRSGQGIIGLQAGSNKGASQSGMRI
GTQR
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR003096SM22_calponin
IPR001715CH-domain
IPR000557Calponin_repeat
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0005516calmodulin binding
GO:0051015actin filament binding
Vocabulary: biological process
TermDefinition
GO:0031032actomyosin structure organization