Acetylcholine receptor subunit alpha-like

Overview
NameAcetylcholine receptor subunit alpha-like
Smed IDSMED30000957
Length (bp)1827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetylcholine receptor subunit alpha-like (SMED30000957) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30000957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetylcholine receptor subunit alpha-like (SMED30000957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30000957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000957SMESG000011827.1 SmedASXL_015252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000957SMESG000011827.1 SmedASXL_015253SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000957SMESG000011827.1 dd_Smed_v6_18184_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000957SMESG000011827.1 OX_Smed_1.0.08133ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000957SMESG000011827.1 OX_Smed_1.0.01525ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 374.4 bits (960), Expect = 5.003e-123
Identity = 190/487 (39.01%), Postives = 294/487 (60.37%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+DEKNQV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPNGEWDLVGIPGKRSERFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 374.4 bits (960), Expect = 5.003e-123
Identity = 190/487 (39.01%), Postives = 294/487 (60.37%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+DEKNQV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPNGEWDLVGIPGKRSERFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 374.015 bits (959), Expect = 1.765e-122
Identity = 190/487 (39.01%), Postives = 294/487 (60.37%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+DEKNQV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   66 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPNGEWDLVGIPGKRSERFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 521          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 371.318 bits (952), Expect = 8.055e-122
Identity = 188/487 (38.60%), Postives = 293/487 (60.16%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+D+K QV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPNGEWDLVGIPGKRSERFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 371.318 bits (952), Expect = 8.055e-122
Identity = 188/487 (38.60%), Postives = 293/487 (60.16%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+D+K QV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPNGEWDLVGIPGKRSERFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 370.163 bits (949), Expect = 7.884e-122
Identity = 199/487 (40.86%), Postives = 292/487 (59.96%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLS-HIYTQNNS-GKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            +N+LERPV + ++ + V  KV L QI+D+DEKNQV+  N WLD TW DYN  W+  E+GNIT +  P+ K+WKPD+L+YNS D  FD TY  N++V + GL+H VPPG+FK +CKI+I WFPFD+Q C  KFG+WTY G K+D +             G  D   ++ NGEW +     E++ + Y CCPE P+ D+ F++ MRR+ LYY FNL+ PCI+ + M+LL FTLPP AGEKIT+ +T++LS+  FL +V++  P TS +VPL+G++F+C MI+ + S VFTV VLN H+++ E  +M  W + L+  W+   L M      +T +      +    S  PN  HS    E+L      N  +     S +  C  RL+ +I TQ+ S G  ++G+     ++ I         ++ +    L  + HELK +T ++ E   + +  N WKFAA V+DR CL  F +F ++S++ I  SAP
Sbjct:   34 YNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQ----------PATGGFDISEYISNGEWALPLTTVERNEKFYDCCPE-PYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYA-----SLPSLFSTKPN-RHS----ESLIRNIKDNEHSLSRANSFDADC--RLNQYIMTQSVSNGLTSLGS---IPSTMISSNGTTTDVSQQATLLILHRIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTIFIIVSTIGIFWSAP 494          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 328.561 bits (841), Expect = 5.797e-105
Identity = 199/561 (35.47%), Postives = 306/561 (54.55%), Query Frame = 3
Query:  144 CLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGED-EEMPYWLKVLVNRWLANFLLMSPRNPQV-------------TNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKR-------LSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSAT------------------KCS--IFTELQD-----VIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            C  V   G H +RL + L  +     +N L RPV +E++++ V   +   QILD+DEK+Q+MN+N+WL ++WTD+   W+P EFGNI  + LP   +WKPD+L+YNS D++FD T+P N VV   G +  +PP + +S+C I+I +FPFD Q C MKFG+WTY+G   D         N T         ++  NGEWE++ + +++    Y CCPE P+ D+ F V +RR+ LYY FNL+ PC++IS+++LL FTLP   GEK+ +GVTI +SL +F+ MVA+ +PQTS ++PLI +YFSCIM     SVV TV+ LN HH+S E  + M  +LK L+  WL   L M    P V                  R+  I+  R IL   N +  +  + A     +  N  SD   +    KR       ++ + T   +G  +  + N Y  + +   + N SAT                  KC+    T+ +D     +++EL+ I+ ++++E        +W FA+RV+DR C + F+ F  + + +I  +AP + +
Sbjct:   21 CSKVIWTGDHERRLYAKLAEN-----YNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDL-------INTT-----ISPATYKPNGEWELLGLTSQRSIFFYECCPE-PYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPMNKFLKTLLLGWLPTLLGM--ERPDVLELSVHGAHYASDNKKKQRQYLIEVERHILTRPNGNGHSAVDKAVHLDLSTGNPHSDAKKSSPSPKRTSASIMGMTGLPTTQMNGALD-SSINKYTCTKVTRPLENGSATINHKSSPQINPINNNNIYKCANNQKTQFEDRHFHHILNELRVISARVRKEEAMHALQADWMFASRVVDRVCFLAFSAFLFMCTAIISYNAPHLFV 560          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 327.791 bits (839), Expect = 9.191e-105
Identity = 201/570 (35.26%), Postives = 309/570 (54.21%), Query Frame = 3
Query:  117 MKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGED-EEMPYWLKVLVNRWLANFLLMSPRNPQV-------------TNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKR-------LSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSAT------------------KCS--IFTELQD-----VIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            + F F L     V   G H +RL + L  +     +N L RPV +E++++ V   +   QILD+DEK+Q+MN+N+WL ++WTD+   W+P EFGNI  + LP   +WKPD+L+YNS D++FD T+P N VV   G +  +PP + +S+C I+I +FPFD Q C MKFG+WTY+G   D         N T         ++  NGEWE++ + +++    Y CCPE P+ D+ F V +RR+ LYY FNL+ PC++IS+++LL FTLP   GEK+ +GVTI +SL +F+ MVA+ +PQTS ++PLI +YFSCIM     SVV TV+ LN HH+S E  + M  +LK L+  WL   L M    P V                  R+  I+  R IL   N +  +  + A     +  N  SD   +    KR       ++ + T   +G  +  + N Y  + +   + N SAT                  KC+    T+ +D     +++EL+ I+ ++++E        +W FA+RV+DR C + F+ F  + + +I  +AP + +
Sbjct:    9 IAFFFALF---RVIWTGDHERRLYAKLAEN-----YNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDL-------INTT-----ISPATYKPNGEWELLGLTSQRSIFFYECCPE-PYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPMNKFLKTLLLGWLPTLLGM--ERPDVLELSVHGAHYASDNKKKQRQYLIEVERHILTRPNGNGHSAVDKAVHLDLSTGNPHSDAKKSSPSPKRTSASIMGMTGLPTTQMNGALD-SSINKYTCTKVTRPLENGSATINHKSSPQINPINNNNIYKCANNQKTQFEDRHFHHILNELRVISARVRKEEAMHALQADWMFASRVVDRVCFLAFSAFLFMCTAIISYNAPHLFV 554          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-9 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q18556])

HSP 1 Score: 315.849 bits (808), Expect = 2.139e-100
Identity = 158/341 (46.33%), Postives = 223/341 (65.40%), Query Frame = 3
Query:  132 VLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILP--SEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLK 1148
            VL   L   H      RLL+ L ++     ++  ERPV + ++ L V  K+ L QILD+DEKNQV+    W++  WTDY  KW+P E+G I  + +P  +  +WKPD+L+YNSADE FD TYP N VV+  G +  VPPG+ K +CKI+IT+FPFD Q C +KFG+WTY+G+ +D R+   EG N + +    D + +++NGEW ++ VPA   T  +    E P+  + F++ ++R+ LYY  NL+ P  +IS M++L FTLPP AGEKIT+ +TI+LS+  FL MVAD  P TS +VPLIG +FSC M++ S SVVFTVLVLN H++  E  EM  +L+
Sbjct:   14 VLFHLLTEVHSSADEYRLLADLRHN-----YDPYERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWIEYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSYTGDVLQVPPGILKLSCKIDITYFPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDE--GIDVQYYVQNGEWNLLAVPARHETNIFD---EQPYPSLFFYLIIQRRTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASVVFTVLVLNLHNRKPETHEMSPFLR 344          

HSP 2 Score: 56.225 bits (134), Expect = 4.601e-8
Identity = 23/62 (37.10%), Postives = 44/62 (70.97%), Query Frame = 3
Query: 1497 ELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDM 1682
            EL+++  + + +  K++E+  D + +N+WKFAA V+DR CLI F++F ++S+  I+ S+P +
Sbjct:  471 ELKNISSQTRAMRKKMEEDERDEQAANDWKFAAMVVDRCCLITFSVFIVVSTCGIMFSSPHL 532          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 311.227 bits (796), Expect = 1.606e-99
Identity = 153/346 (44.22%), Postives = 226/346 (65.32%), Query Frame = 3
Query:  150 NVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILP--SEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFL 1181
            N+C       +L + L       G+N LERPV + +Q LEV+ K+ L QILD+DEKNQ+++ N WL  TW D+  +W P ++G I  +  P  S+ +WKPD+L+YNSA E FD T+ +N++  + G +  +PPG+ K  C++++TWFPFD Q C MKFG+WT+ G  +D  L+ D+ +N T    S D  ++L NGEW+++   A++    Y CCPE P+  + +++ +RR+ LYY FNL+ P ++IS M++L F  PP AGEKIT+ VTI+L++  FL MV++  P TS +VPLIG++FSC M++ S SVVFT++VLN H +S +  EM      LV R L  FL
Sbjct:   18 NLCDGSVAETKLFTDLLK-----GYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAID--LQIDDDTNGTQ---SMDLSTYLVNGEWQVISTNAKRVVSYYKCCPE-PYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEM----NPLVRRVLLEFL 348          

HSP 2 Score: 52.7582 bits (125), Expect = 5.555e-7
Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 3
Query: 1464 NHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDM 1682
            NH+  +  I   L  V  EL+++     +E  D +   +W+FAA V+DR CL+ F +F +IS + I+ SAP +
Sbjct:  388 NHAGYEAQILL-LHSVHTELRRVVAFYNKEEHDERIQTDWRFAAMVVDRACLLLFTVFIVISILAIMMSAPHI 459          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0300594)

HSP 1 Score: 443.351 bits (1139), Expect = 2.927e-146
Identity = 228/545 (41.83%), Postives = 346/545 (63.49%), Query Frame = 3
Query:   81 QILNR*NYQNSSMKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPT---RKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTN---VTCTKRLSH--IYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            QILN  N  +     +++ L    VC  GYH KRLL  L +      +N+LERPV++E+  L++ F +TL+QI+D+DEKNQ++ TN+WL + W D N +WN  ++G +  L +P  ++WKPD+LMYNSADE FDGTY  NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  S++ NGEWE++ VP +++   Y CCPE P+IDI F + +RR+ LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++++   WL   L MS P  P +   PT        +++  IL ++     + ++L      N+ +   D   N   +T    L H   + +   G+ + G+     ++ +   + +H+  K S   EL  ++ E++ ITD+++++      +N+WKFAA V+DR CLI F +FT+++++ +L SAP + +
Sbjct:  283 QILNGLNKHSWIFLLIYLNLSA-KVCLAGYHEKRLLHDLLD-----PYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETG---------GDISSYVLNGEWELLGVPGKRNEIYYNCCPE-PYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSRPGRPLILEFPTTPCSDTSSERKHQILSDVELKERSSKSL----LANVLDIDDDFRHNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAPHIIV 807          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0080594)

HSP 1 Score: 443.351 bits (1139), Expect = 2.927e-146
Identity = 228/545 (41.83%), Postives = 346/545 (63.49%), Query Frame = 3
Query:   81 QILNR*NYQNSSMKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPT---RKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTN---VTCTKRLSH--IYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            QILN  N  +     +++ L    VC  GYH KRLL  L +      +N+LERPV++E+  L++ F +TL+QI+D+DEKNQ++ TN+WL + W D N +WN  ++G +  L +P  ++WKPD+LMYNSADE FDGTY  NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  S++ NGEWE++ VP +++   Y CCPE P+IDI F + +RR+ LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++++   WL   L MS P  P +   PT        +++  IL ++     + ++L      N+ +   D   N   +T    L H   + +   G+ + G+     ++ +   + +H+  K S   EL  ++ E++ ITD+++++      +N+WKFAA V+DR CLI F +FT+++++ +L SAP + +
Sbjct:  283 QILNGLNKHSWIFLLIYLNLSA-KVCLAGYHEKRLLHDLLD-----PYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETG---------GDISSYVLNGEWELLGVPGKRNEIYYNCCPE-PYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSRPGRPLILEFPTTPCSDTSSERKHQILSDVELKERSSKSL----LANVLDIDDDFRHNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAPHIIV 807          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0309867)

HSP 1 Score: 443.351 bits (1139), Expect = 2.927e-146
Identity = 228/545 (41.83%), Postives = 346/545 (63.49%), Query Frame = 3
Query:   81 QILNR*NYQNSSMKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPT---RKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTN---VTCTKRLSH--IYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            QILN  N  +     +++ L    VC  GYH KRLL  L +      +N+LERPV++E+  L++ F +TL+QI+D+DEKNQ++ TN+WL + W D N +WN  ++G +  L +P  ++WKPD+LMYNSADE FDGTY  NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  S++ NGEWE++ VP +++   Y CCPE P+IDI F + +RR+ LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++++   WL   L MS P  P +   PT        +++  IL ++     + ++L      N+ +   D   N   +T    L H   + +   G+ + G+     ++ +   + +H+  K S   EL  ++ E++ ITD+++++      +N+WKFAA V+DR CLI F +FT+++++ +L SAP + +
Sbjct:  283 QILNGLNKHSWIFLLIYLNLSA-KVCLAGYHEKRLLHDLLD-----PYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETG---------GDISSYVLNGEWELLGVPGKRNEIYYNCCPE-PYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSRPGRPLILEFPTTPCSDTSSERKHQILSDVELKERSSKSL----LANVLDIDDDFRHNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAPHIIV 807          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0301834)

HSP 1 Score: 434.491 bits (1116), Expect = 6.847e-146
Identity = 231/529 (43.67%), Postives = 331/529 (62.57%), Query Frame = 3
Query:  135 LLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQV------TNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTC-TKRLSH-------IYTQNNSGKAN-IGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            LL  +  C  G H KRLL  L ++     +NSLERPVV+E+  L++ F +TL+QI+D+DEKNQ++ TNIWL + W D N +WN  EFG +  L +P  ++WKPD+LMYNSADE FDGTY  NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  SF+ NGEW+++ VP +++   Y CCPE P+IDI F + +RRK LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++V+   WL   L M  R  QV        S +      +++  + N+     + ++L      N+ +   D   N  C +  L H       +Y Q + G    +G      +  +   I +H+    S   EL  ++ EL+ IT+++++E      + +WKFAA V+DR CLI F LFT+I+++ +L SAP
Sbjct:   48 LLIMIPACAAGPHEKRLLHALLDN-----YNSLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDEAG---------GDISSFITNGEWDLLGVPGKRNEIYYNCCPE-PYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIRVIFLYWLPCILRMQ-RPGQVGYECPPPPSSSSSSASGEKKQQIQNVELKERSSKSL----LANVLDIDDDFRCNHRCASATLPHQPTYYRTMYRQGDDGSVGPVGPAGPVVDGRLHEAI-SHTCLTSSAEYELALILKELRWITEQLKKEDETSDITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 555          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0343798)

HSP 1 Score: 434.491 bits (1116), Expect = 6.847e-146
Identity = 231/529 (43.67%), Postives = 331/529 (62.57%), Query Frame = 3
Query:  135 LLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQV------TNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTC-TKRLSH-------IYTQNNSGKAN-IGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            LL  +  C  G H KRLL  L ++     +NSLERPVV+E+  L++ F +TL+QI+D+DEKNQ++ TNIWL + W D N +WN  EFG +  L +P  ++WKPD+LMYNSADE FDGTY  NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  SF+ NGEW+++ VP +++   Y CCPE P+IDI F + +RRK LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++V+   WL   L M  R  QV        S +      +++  + N+     + ++L      N+ +   D   N  C +  L H       +Y Q + G    +G      +  +   I +H+    S   EL  ++ EL+ IT+++++E      + +WKFAA V+DR CLI F LFT+I+++ +L SAP
Sbjct:   48 LLIMIPACAAGPHEKRLLHALLDN-----YNSLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDEAG---------GDISSFITNGEWDLLGVPGKRNEIYYNCCPE-PYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIRVIFLYWLPCILRMQ-RPGQVGYECPPPPSSSSSSASGEKKQQIQNVELKERSSKSL----LANVLDIDDDFRCNHRCASATLPHQPTYYRTMYRQGDDGSVGPVGPAGPVVDGRLHEAI-SHTCLTSSAEYELALILKELRWITEQLKKEDETSDITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 555          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 382.104 bits (980), Expect = 3.875e-126
Identity = 204/507 (40.24%), Postives = 298/507 (58.78%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIF-TELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            G H +RL   L  D     +N LERPV ++  SL V F ++L+QI+D+DEKNQV+ TNIWL + W DY  +WN  E+  +T +  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D             Q   AD   ++ NGEW++V+VP  ++   Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TV VL  H+   E  +MP W +V++  W A FL M  P   +V  +   K    Q RS L +++ +      +A    GN+      G   +       H  T  +SG          +   + P     S +      TEL  ++ E++ I+ + +++  +    NEWKFAA VIDR CL+ F+LFT++ ++ IL SAP+
Sbjct:   23 GEHQRRLYRDLMKD-----YNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDL------------QMIDADITGYIANGEWDLVEVPGRRNERFYDCCKE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACHNK----QPRSSLSSVDLNI--SPGVAQSTNGNLLYIGFRGMDTI-------HYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSGPGETELSKILDEVRYISKRFRDQDEEDTVCNEWKFAASVIDRLCLMAFSLFTILCTIGILMSAPN 498          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 381.719 bits (979), Expect = 5.525e-126
Identity = 204/507 (40.24%), Postives = 298/507 (58.78%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIF-TELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            G H +RL   L  D     +N LERPV ++  SL V F ++L+QI+D+DEKNQV+ TNIWL + W DY  +WN  E+  +T +  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D             Q   AD   ++ NGEW++V+VP  ++   Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TV VL  H+   E  +MP W +V++  W A FL M  P   +V  +   K    Q RS L +++ +      +A    GN+      G   +       H  T  +SG          +   + P     S +      TEL  ++ E++ I+ + +++  +    NEWKFAA VIDR CL+ F+LFT++ ++ IL SAP+
Sbjct:   24 GEHQRRLYRDLMKD-----YNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDL------------QMIDADITGYIANGEWDLVEVPGRRNERFYDCCKE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACHNK----QPRSSLSSVDLNI--SPGVAQSTNGNLLYIGFRGMDTI-------HYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSGPGETELSKILDEVRYISKRFRDQDEEDTVCNEWKFAASVIDRLCLMAFSLFTILCTIGILMSAPN 499          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: FO907089.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101882451])

HSP 1 Score: 381.333 bits (978), Expect = 2.107e-125
Identity = 199/510 (39.02%), Postives = 297/510 (58.24%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLM-SPRNPQVT----NSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            G H +RL   L  +     +N LERPV +++ SL V F  +L+QI+D+DEKNQV+ TNIWL + WTDY  +WN  ++  + T+  P   +W+PDIL+YNSADE+FD T+  NV+V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D             Q  +AD   ++ NGEW++V+VP  ++ + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TVLVL  H+   +  +MP W +VL+  W A FL M  P   ++     N P R+  +                 +       GN+      G   V  T   SH    +    AN     +   + I+  + +      ++  EL  ++ E++ I  + +++  D    NEWKFAA VIDR CL+ F++FT++ ++ IL SAP+
Sbjct:   54 GEHQRRLYRDLMKN-----YNPLERPVYNDSHSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWTDYYLRWNMSDYPGVNTVRFPDSLIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWALDL------------QMINADITGYIANGEWDLVEVPGRRNEKFYDCCKE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHYHDPDGAKMPKWTRVLLLNWCAWFLRMRRPGEDRIRLACHNKPARRSSVSS---------VELSVSQGALQAAGGNMLYFGFRGMEGVHYTAHESHSVLCSRL-MANSEDDVLLPGAQIRGGVTS-GIVGGTLELELAKILEEVRYIAKRFRDQDADESVCNEWKFAAAVIDRLCLMAFSIFTILCTIGILMSAPN 534          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 347.436 bits (890), Expect = 9.876e-113
Identity = 188/495 (37.98%), Postives = 290/495 (58.59%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNV---------TCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV++++  + V+  +TLLQI+D+DEKNQV+ TN WL + WTD    WNP  +  + TL  PS ++W PDIL+YNSADE+FD T+  NV+V   G    +PPG+ KSTC I++ WFPFD Q C +KFG+WT+ G  +D +++            + D  +++ NGEW++V VP +++   Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SVV TVLVL  HH   +  +MP W++V++  W A FL M     +      RK   +  +S   + + S +    +  +P  + TN  ++G  N+          C    S      + G+   G+ N  +   ++ M             E+  ++ E+  I  + +++       +EWKFAA V+DR CL+ F+LF++I +  IL SAP+
Sbjct:   34 YNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQ------------AVDISTYIPNGEWDLVGVPGKRNELYYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVRVILLNWCAWFLRMKKPGEE------RKANFKYDQSPAHHASASSIQMGVMPGQP--SSTNSTTNGHMNLYFGYHSIDSACCPPSSDSGVSCSGGRVG-GSPNEEQREGVR-MFAGEP--------EIHRILAEVMYIAQRFRDQDEAEAICSEWKFAAAVVDRLCLVAFSLFSIICTFTILMSAPN 497          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 347.436 bits (890), Expect = 1.206e-112
Identity = 195/534 (36.52%), Postives = 305/534 (57.12%), Query Frame = 3
Query:  105 QNSSMKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNV---------TCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            QN  + F+ + L  +     G + ++L   L  +     +N LERPV++++  + V+  +TLLQI+D+DEKNQV+ TN WL + WTD    WNP  +  + TL  PS ++W PDIL+YNSADE+FD T+  NV+V   G    +PPG+ KSTC I++ WFPFD Q C +KFG+WT+ G  +D +++            + D  +++ NGEW++V VP +++   Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SVV TVLVL  HH   +  +MP W++V++  W A FL M     +      RK   +  +S   + + S +    +  +P  + TN  ++G  N+          C    S      + G+   G+ N  +   ++ M             E+  ++ E+  I  + +++       +EWKFAA V+DR CL+ F+LF++I +  IL SAP+
Sbjct:    3 QNCIVYFLSIFLSHIGSLQ-GEYQRKLYKELMEN-----YNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQ------------AVDISTYIPNGEWDLVGVPGKRNELYYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVRVILLNWCAWFLRMKKPGEE------RKANFKYDQSPAHHASASSIQMGVMPGQP--SSTNSTTNGHMNLYFGYHSIDSACCPPSSDSGVSCSGGRVG-GSPNEEQREGVR-MFAGEP--------EIHRILAEVMYIAQRFRDQDEAEAICSEWKFAAAVVDRLCLVAFSLFSIICTFTILMSAPN 499          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ENSXETT00000021532.1 (cholinergic receptor, nicotinic alpha 7 [Source:NCBI gene;Acc:100493611])

HSP 1 Score: 369.007 bits (946), Expect = 6.207e-121
Identity = 192/512 (37.50%), Postives = 299/512 (58.40%), Query Frame = 3
Query:  147 LNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +NV   G + ++L   L  +     +N LERPV++++  L V F ++L+QI+D+DEKNQV+ TNIWL + W DY  +WN  E+  +  +  P  ++WKPDIL+YNSADE+FD ++  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+WTY G  +D ++              +D   ++ NGEW++V VP ++    Y CC E P++D+ F + MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH       MP W ++++  W A FL M  P   +V      K    +RR  + +++ + ++ +       GN+      G   + CT              +    +N+  N +       HS        +L  ++ EL+ I ++ +++  D    NEWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   19 MNVSLQGEYQRKLYKELMKN-----YNPLERPVLNDSHPLTVYFGMSLMQIMDVDEKNQVLTTNIWLQMQWIDYYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDASFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDIQKCNLKFGSWTYGGWSLDLQML------------ESDISEYISNGEWDLVGVPGKRSENYYECCKE-PYLDVTFTIIMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPHGGNMPKWTRIILLNWCAWFLRMKRPGEDKVRPVCQHK----ERRCSMTSVDVNTVSGQQ---SSNGNMLYIGFRGLEGIHCTPTPDSGVICGRMTCSPTDDENLLHNVH-------HSEGD----PDLSKILEELRYIANRFRDQDDDESICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSAPN 494          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: clca2 (chloride channel accessory 2 [Source:Xenbase;Acc:XB-GENE-980364])

HSP 1 Score: 346.665 bits (888), Expect = 1.881e-112
Identity = 202/510 (39.61%), Postives = 302/510 (59.22%), Query Frame = 3
Query:  159 HCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYE-NLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMT 1685
            H G + ++L   L  +     +N LERPVV+++Q L V+ ++TLLQI+D+DEKNQV+ TN WL ITW D+   W+  E+  + TL  P++ +W PDIL+YNSADE+FD T+  NV+V + G    +PPG+ KSTC I++ WFPFD Q C +KFG+WT+ G  +D             Q   AD  S++ NGEW++V VP +++   Y CC E P+ D+ + V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+ IM++   SVV TVLVL  HH   +  +MP  ++V++  W A FL M  R P     P         + I PN + S  + E N+AP       ++ ++G+        L       NS    + A+    +     +I   S  +     E+  ++ E++ I  + +E+    +  +EWKFAA VIDR CL+ F+LF +I++  IL SAP+ T
Sbjct:   13 HQGQYQRKLYRELLRN-----YNRLERPVVNDSQPLLVELQLTLLQIIDVDEKNQVLITNAWLQITWNDFYLTWDQAEYPGVQTLRFPADHIWVPDILLYNSADERFDATFHTNVLVNSTGACQYIPPGILKSTCYIDVRWFPFDVQKCKLKFGSWTHNGWLLDL------------QMMEADISSYIPNGEWDLVGVPGKRNELYYECCKE-PYPDVTYTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASIMVIVGLSVVVTVLVLQFHHHDPQAGKMPKMVRVILLNWCAWFLRM--RKPGENKRPI------PCKYIYPNHHSSISSIEMNIAPG------HQSTNGNIVYCGYHTLESPCCPPNSDSGVMCARVNCPSLEDSDLIQKKSLKES--MPEIVKILEEVQYIARRFREQDAGEEICSEWKFAAAVIDRLCLVAFSLFAIIATFTILMSAPNFT 488          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: prepl (prolyl endopeptidase-like [Source:Xenbase;Acc:XB-GENE-981635])

HSP 1 Score: 285.804 bits (730), Expect = 7.334e-89
Identity = 156/515 (30.29%), Postives = 281/515 (54.56%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLM-----SPRNPQVTNSPTRK-------IEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSA 1673
            G  G+   +Y   +  F  +++  RPV D ++++ V  +VTL QI+D+DE+NQ++   +W+   W D   +WN  ++  + T+ +PS  VW+PDI++YN+AD++F G+   NVV+   G +    P + KS+CK+++++FPFD Q C + FG+WTY G+++D     D G          D   F++N EWEI+ +PA+K   TY CC E P+ D+ + + ++R+A +YIFNL+ PC++IS ++ L F LP  +GEK+++GVT++L+LT+F  +VA+ +P  S +VPLIG Y+   M M + S   T+ ++N HH   E + +P W K  + ++++    +     S R P+    P  +       I+ Q +R  + ++       E L+PK   +   ++    +    ++     Y     G   +G    Y+       +C++           + ++  ++ I +  +++    K++ EWK  A+V+DRF +  F +   + SV+I+  A
Sbjct:   19 GAQGR--FAYKLMNDLFANYSNALRPVEDMDKAMNVTLQVTLSQIIDMDERNQILMAYLWIRQVWFDAYLRWNKEDYDGLDTIRIPSSYVWRPDIVLYNNADDQFTGSMETNVVIRYDGQIMWDSPAITKSSCKVDVSFFPFDGQQCRLTFGSWTYNGNQIDILNHLDTG----------DLTDFVENVEWEILGMPAKKSVITYGCCSE-PYPDVTYTLILKRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMP-PSENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPEAKPVPQWAKKFILQYMSRIFFVYEVGESCRRPRTEPEPNSERTSKVPGIDGQAKREDIADVVKD--CPEKLSPK---DKEAKEELEHSKYAHSQESGKYYVSEQGG---VGKGFGYEECPKIHCLCHN-----------ERLLKNIEYIANCFRDQRATQKRTGEWKKVAKVMDRFFMWVFFIMVFLMSVLIMGKA 500          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 279.641 bits (714), Expect = 9.914e-87
Identity = 161/503 (32.01%), Postives = 272/503 (54.08%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSA 1673
            G + + L   LF D     +++  RPV D +++L V  ++TL QI D+DE+NQ++   +W+ ++W D   KW+  E+  + ++ +PS  VW+PDI++YN AD++F      NVV+   G +    P + KS+C +++++FPFD Q C + FG+WTY G++VD     D G          D   F++N EWE+  +PA K+  TY CC E P+ DI F + ++R++ +YIFNL+ PC++IS ++ L F LP  +GEK+++GVT++L+LT+F  MVA+ +P  S SVPLIG Y+   M M + S   T++++N H    E + +P W ++++  +++    +       T SP    + +   S+      S+  YE    +PY ++    S GS N +C          N     ++G     +    +   C H    C+ +  L    + ++ IT+  +E+     K  EWK  A+V+DRF +  F       S++I+  A
Sbjct:   12 GKYAQMLFRDLFED-----YSNALRPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDIINTMDSG----------DLSDFVENVEWEMQGMPAVKNVITYGCCSE-PYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYDVGENCT-SPQSDSDTKSNGSV-----PSYEDYEK-EQEPYSSLGCPLS-GSGNFSCD------IDTNKKLNGHLGGHYALQKEISETHCCAH----CNRYRVLT---NNIEYITNWYREQKAISAKGIEWKKVAKVMDRFFMWVFFSMVFFMSILIIAQA 476          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 279.641 bits (714), Expect = 1.466e-86
Identity = 161/503 (32.01%), Postives = 272/503 (54.08%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSA 1673
            G + + L   LF D     +++  RPV D +++L V  ++TL QI D+DE+NQ++   +W+ ++W D   KW+  E+  + ++ +PS  VW+PDI++YN AD++F      NVV+   G +    P + KS+C +++++FPFD Q C + FG+WTY G++VD     D G          D   F++N EWE+  +PA K+  TY CC E P+ DI F + ++R++ +YIFNL+ PC++IS ++ L F LP  +GEK+++GVT++L+LT+F  MVA+ +P  S SVPLIG Y+   M M + S   T++++N H    E + +P W ++++  +++    +       T SP    + +   S+      S+  YE    +PY ++    S GS N +C          N     ++G     +    +   C H    C+ +  L    + ++ IT+  +E+     K  EWK  A+V+DRF +  F       S++I+  A
Sbjct:   35 GKYAQMLFRDLFED-----YSNALRPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDIINTMDSG----------DLSDFVENVEWEMQGMPAVKNVITYGCCSE-PYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYDVGENCT-SPQSDSDTKSNGSV-----PSYEDYEK-EQEPYSSLGCPLS-GSGNFSCD------IDTNKKLNGHLGGHYALQKEISETHCCAH----CNRYRVLT---NNIEYITNWYREQKAISAKGIEWKKVAKVMDRFFMWVFFSMVFFMSILIIAQA 499          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 363.999 bits (933), Expect = 3.310e-119
Identity = 187/487 (38.40%), Postives = 291/487 (59.75%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+DEKNQV+ TNIWL ++WTD+  +WN  E+  +  +  P  ++WKPDIL+YNSADE+FD T+  NV+V   G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD  S++ NGEW+++ +P +++ + Y CC E P+ D+ + V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W ++++  W A FL M  P   +V  +   K     RR  L ++    L+     P   GN+      G   + C        T ++       A +   + ++      H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ------------EADISSYIPNGEWDLMGIPGKRNEKFYECCKE-PYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK----PRRCSLASVE---LSAGAGPPTSNGNLLYIGFRGLEGMHCAP------TPDSGVVCGRLACSPTHDEHLM-----HGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 286.189 bits (731), Expect = 3.157e-89
Identity = 162/491 (32.99%), Postives = 273/491 (55.60%), Query Frame = 3
Query:  180 RLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISS 1652
            RL  YLF D     +N + RPV + +  + +QF+V++ Q++ +DE NQ+M TN+WL   W DY  KW P ++  +  + +P+EK+WKPDI++YN+AD  F        ++   G +  +PP +FKS+CKI++T+FPFD Q+C MKFG+W+Y   K+D  L    GS       S + + + ++GEW I+  P  KH   Y CC E  + DI + + +RR  L+Y  NL+ PC++IS +++LVF LP   GEK+T+ ++++LSLT+FL ++ + +P TS  +PLIG Y    MI  + S+V TV VLN H+++     MP W+K       A FL + PR   +T   + + +  + R    N   + L+  N   +   + + ++     + TC       Y  +   K +  + N+ ++S  + +    S +  S   E+++ I  +K I + ++ ++   +  ++WK+ A VIDR  L  F L  ++ +
Sbjct:   31 RLFQYLFED-----YNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLI---GS-------SMNLKDYWESGEWAIIKAPGYKHEIKYNCC-EEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVK-------AVFLNLLPRVMFMTRPTSTEEDAPKTR----NFYGAELSNLNCFSRA-DSKSCKEGYPCQDGTCG------YCHHRRVKISNFSANLTRSSSSESVDAVLSLSALS--PEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGT 485          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 286.189 bits (731), Expect = 4.161e-89
Identity = 162/491 (32.99%), Postives = 273/491 (55.60%), Query Frame = 3
Query:  180 RLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISS 1652
            RL  YLF D     +N + RPV + +  + +QF+V++ Q++ +DE NQ+M TN+WL   W DY  KW P ++  +  + +P+EK+WKPDI++YN+AD  F        ++   G +  +PP +FKS+CKI++T+FPFD Q+C MKFG+W+Y   K+D  L    GS       S + + + ++GEW I+  P  KH   Y CC E  + DI + + +RR  L+Y  NL+ PC++IS +++LVF LP   GEK+T+ ++++LSLT+FL ++ + +P TS  +PLIG Y    MI  + S+V TV VLN H+++     MP W+K       A FL + PR   +T   + + +  + R    N   + L+  N   +   + + ++     + TC       Y  +   K +  + N+ ++S  + +    S +  S   E+++ I  +K I + ++ ++   +  ++WK+ A VIDR  L  F L  ++ +
Sbjct:   36 RLFQYLFED-----YNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLI---GS-------SMNLKDYWESGEWAIIKAPGYKHEIKYNCC-EEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVK-------AVFLNLLPRVMFMTRPTSTEEDAPKTR----NFYGAELSNLNCFSRA-DSKSCKEGYPCQDGTCG------YCHHRRVKISNFSANLTRSSSSESVDAVLSLSALS--PEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGT 490          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 281.952 bits (720), Expect = 2.432e-87
Identity = 159/492 (32.32%), Postives = 268/492 (54.47%), Query Frame = 3
Query:  180 RLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSV 1655
            RL  +LF      G+N   RPV + +  + V+F +++ Q++D+DEKNQ+M TN+WL   W DY  +W+P EFGNIT+L +PSE +W PDI++YN+AD +F  T+     +   G +H VPP ++KS+C I++T+FPFDQQ+C MKFG+WTY   K+D                + D + + ++GEW I++     +++ Y CC E  + D+ ++  +RR  L+Y  NL+ PC++IS +++LVF LP   GEKIT+ ++++LSLT+FL ++ + +P TS  +PLIG Y    MI  + S+V TV VLN HH+S     MP W++V +   +  +L+M        N P   +E+     +  +  + +L     A +        + +   N+     L      ++S     G  +++  +          A++  +  ++Q  +  +  I D ++ E  D     +WK+ A V+DR  L  F +   + ++
Sbjct:   38 RLFKHLFG-----GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE----------QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEI-YPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMM--------NRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLP-----DSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTI 500          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 281.952 bits (720), Expect = 2.432e-87
Identity = 159/492 (32.32%), Postives = 268/492 (54.47%), Query Frame = 3
Query:  180 RLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSV 1655
            RL  +LF      G+N   RPV + +  + V+F +++ Q++D+DEKNQ+M TN+WL   W DY  +W+P EFGNIT+L +PSE +W PDI++YN+AD +F  T+     +   G +H VPP ++KS+C I++T+FPFDQQ+C MKFG+WTY   K+D                + D + + ++GEW I++     +++ Y CC E  + D+ ++  +RR  L+Y  NL+ PC++IS +++LVF LP   GEKIT+ ++++LSLT+FL ++ + +P TS  +PLIG Y    MI  + S+V TV VLN HH+S     MP W++V +   +  +L+M        N P   +E+     +  +  + +L     A +        + +   N+     L      ++S     G  +++  +          A++  +  ++Q  +  +  I D ++ E  D     +WK+ A V+DR  L  F +   + ++
Sbjct:   38 RLFKHLFG-----GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE----------QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEI-YPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMM--------NRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLP-----DSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTI 500          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P22770|ACHA7_CHICK (Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 2.582e-123
Identity = 193/487 (39.63%), Postives = 290/487 (59.55%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++L+QI+D+DEKNQV+ TNIWL + WTD+  +WN  E+  +  +  P   +WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+WTY G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ DI F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L +M  + ++ +  +    GN+      G   V CT              +    +N+            HS        +L  ++ E++ I ++ +++  +    NEWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFTLSLMQIMDVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKNVRFPDGLIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQKCNLKFGSWTYGGWSLDLQMQ------------EADISGYISNGEWDLVGIPGKRTESFYECCKE-PYPDITFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLSSMEMNTVSGQQCS---NGNMLYIGFRGLDGVHCTPTTDSGVICGRMTCSPTEEENLL-----------HSGHPSEGDPDLAKILEEVRYIANRFRDQDEEEAICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P36544|ACHA7_HUMAN (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5)

HSP 1 Score: 374.4 bits (960), Expect = 2.402e-122
Identity = 190/487 (39.01%), Postives = 294/487 (60.37%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+DEKNQV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ NGEW++V +P ++    Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPNGEWDLVGIPGKRSERFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|Q866A2|ACHA7_MACMU (Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 8.657e-122
Identity = 189/487 (38.81%), Postives = 295/487 (60.57%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++Q L V F ++LLQI+D+DEKNQV+ TNIWL ++WTD+  +WN  E+  + T+  P  ++WKPDIL+YNSADE+FD T+  NV+V + G    +PPG+FKS+C I++ WFPFD Q C +KFG+W+Y G  +D +++             AD   ++ +GEW++V +P ++  + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  MI+   SVV TV+VL  HH   +  +MP W +V++  W A FL M  P   +V  +   K    QRR  L ++  S      +AP P        S+G+      + L  ++         +  +     ++ + ++  H         +L  ++ E++ I ++ + +       +EWKFAA V+DR CL+ F++FT+I ++ IL SAP+
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ------------EADISGYIPSGEWDLVGIPGKRSEKFYECCKE-PYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK----QRRCSLASVEMS-----AVAPPP-------ASNGNLLYIGFRGLDGMHCAPTPDSGVVCGRMACSPTHDEHLL--HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPN 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|A8WQK3|ACH1_CAEBR (Acetylcholine receptor subunit alpha-type acr-16 OS=Caenorhabditis briggsae OX=6238 GN=acr-16 PE=3 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 3.198e-121
Identity = 209/519 (40.27%), Postives = 302/519 (58.19%), Query Frame = 3
Query:  132 VLLGC--LNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLS-HIYTQNNS-GKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            +LL C    V H     +RL   L  +     +N+LERPV + ++ + V  KV L QI+D+DEKNQV+  N WLD TW DYN  W+  E+GNIT +  P+ K+WKPD+L+YNS D  FD TY  N++V + GL+H VPPG+FK +CKI+I WFPFD+Q C  KFG+WTY G K+D +             G  D   +L NGEW +     E++ + Y CCPE P+ D+ F++ MRR+ LYY FNL+ PCI+ + M+LL FTLPP AGEKIT+ +T++LS+  FL +V++  P TS +VPL+G++F+C MI+ + S VFTV VLN H+++ E  +M  W + L+  W+   L M      +T +    +   +     PN  HS    E+L      N  +     S +  C  RL+ +I TQ+ S G  ++G+      S     + + S     +   L  + HELK +T ++ E   + + SN WKFAA V+DR CL  F +F + S++ I  SAP
Sbjct:    7 LLLSCALFLVAHGSLQERRLYEDLMRN-----YNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWKDYNLVWDQAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSSGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPAT----------GGFDISEYLPNGEWALPLTTVERNEKFYDCCPE-PYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYASLPSLFASK-----PN-RHS----ESLIRNIKDNEHSLSRANSFDADC--RLNQYIMTQSVSNGLTSMGSIPSTMISSTNGALTDVSQQATLLI--LHRIYHELKIVTKRMIEGDKEEQASNNWKFAAMVVDRLCLYVFTIFIIASTIGIFWSAP 495          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P48180|ACH1_CAEEL (Acetylcholine receptor subunit alpha-type acr-16 OS=Caenorhabditis elegans OX=6239 GN=acr-16 PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.003e-120
Identity = 199/487 (40.86%), Postives = 292/487 (59.96%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLS-HIYTQNNS-GKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            +N+LERPV + ++ + V  KV L QI+D+DEKNQV+  N WLD TW DYN  W+  E+GNIT +  P+ K+WKPD+L+YNS D  FD TY  N++V + GL+H VPPG+FK +CKI+I WFPFD+Q C  KFG+WTY G K+D +             G  D   ++ NGEW +     E++ + Y CCPE P+ D+ F++ MRR+ LYY FNL+ PCI+ + M+LL FTLPP AGEKIT+ +T++LS+  FL +V++  P TS +VPL+G++F+C MI+ + S VFTV VLN H+++ E  +M  W + L+  W+   L M      +T +      +    S  PN  HS    E+L      N  +     S +  C  RL+ +I TQ+ S G  ++G+     ++ I         ++ +    L  + HELK +T ++ E   + +  N WKFAA V+DR CL  F +F ++S++ I  SAP
Sbjct:   34 YNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQ----------PATGGFDISEYISNGEWALPLTTVERNEKFYDCCPE-PYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYA-----SLPSLFSTKPN-RHS----ESLIRNIKDNEHSLSRANSFDADC--RLNQYIMTQSVSNGLTSLGS---IPSTMISSNGTTTDVSQQATLLILHRIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTIFIIVSTIGIFWSAP 494          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A267EGF0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020283g1 PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 2.183e-156
Identity = 246/559 (44.01%), Postives = 339/559 (60.64%), Query Frame = 3
Query:  102 YQNSSMKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSK----FYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGS------------NCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPT----RKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGST-----------NVTCTKRLSHIYTQNNSGKA-NIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDM 1682
            + +++  +  +    ++V   G H +RLL YLF+ +        HNS+ERPV +E+  L V FKV+L QI+DLDEKNQ++  NIWLD+TW DY+F W+P +FG IT + +  ++VW+PDIL+YNSADEKFDGTYP NVV+ + G M+ +PPGMF+STCKI+ TWFPFD Q C +KFG+W+Y G  +D RLKC   S            NC+ + G AD E+++ +GEW +  +  ++    Y CCP  PFID+ + +++RR+ LYY  NL+ PC++IS+MSLL F LPP AGEKI++GVTIMLSL+MF  +VAD +PQTS SVPLIG+YFSC M+MCS SVVFTV+VLN HH+  E   +P W+K  +  +LAN L M   +      P     RK    +  S     N +    E  +     N+ + + D  T                   S    QN  G + + GA+                 + CS   EL  V+ EL+ IT KI ++  D + S+EWKFAARV+DR CLI F+ FT+IS+  IL SAPD+
Sbjct:    2 HSSATALWAAITAALVSVSLAGLHERRLLYYLFDPANRTNPLEVHNSMERPVKNESNVLYVWFKVSLQQIIDLDEKNQILFANIWLDLTWHDYHFMWDPKDFGGITKINIDPKRVWRPDILLYNSADEKFDGTYPTNVVIEHTGNMNFIPPGMFRSTCKIDTTWFPFDTQVCKLKFGSWSYDGGTLDLRLKCSNESLSTNEMRLNDPNNCS-EIGGADLETYVPSGEWYLEGMDGKRTAAEYDCCP-YPFIDLSYFIQIRRRTLYYGINLIIPCVLISSMSLLTFVLPPDAGEKISLGVTIMLSLSMFQLLVADAMPQTSESVPLIGMYFSCTMVMCSLSVVFTVIVLNYHHRDAESHPVPNWVKKFICTYLANILCMRNHHRDEEKEPVYLRRRKNASFRTSSYREAANANVELKERSSKSLLANVLDLEDDIRTVGGVGGVGVSGIGASAGAFSPPTYQNVMGSSMDGGAERGGGGGGGGGGGGPSCGSNCSTRNELAAVVRELQVITKKIADDTADGEISSEWKFAARVVDRLCLIIFSCFTVISTCAILFSAPDV 558          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A267DHA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020283g2 PE=3 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 9.587e-155
Identity = 245/561 (43.67%), Postives = 336/561 (59.89%), Query Frame = 3
Query:  102 YQNSSMKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSK----FYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGS------------NCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPT----RKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGST-----------NVTCTKRLSHIYTQNNSGKANIGAKN---IYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDM 1682
            + +++  +  +    ++V   G H +RLL YLF+ +        HNS+ERPV +E+  L V FKV+L QI+DLDEKNQ++  NIWLD+TW DY+F W+P +FG IT + +  ++VW+PDIL+YNSADEKFDGTYP NVV+ + G M+ +PPGMF+STCKI+ TWFPFD Q C +KFG+W+Y G  +D RLKC   S            NC+ + G AD E+++ +GEW +  +  ++    Y CCP  PFID+ + +++RR+ LYY  NL+ PC++IS+MSLL F LPP AGEKI++GVTIMLSL+MF  +VAD +PQTS SVPLIG+YFSC M+MCS SVVFTV+VLN HH+  E   +P W+K  +  +LAN L M   +      P     RK    +  S     N +    E  +     N+ + + D  T                   S    QN  G +  G                      + CS   EL  V+ EL+ IT KI ++  D + S+EWKFAARV+DR CLI F+ FT+IS+  IL SAPD+
Sbjct:    2 HSSATALWAAITAALMSVSLAGLHERRLLYYLFDPANRTNPLEVHNSMERPVKNESNVLYVWFKVSLQQIIDLDEKNQILFANIWLDLTWHDYHFMWDPKDFGGITKINIDPKRVWRPDILLYNSADEKFDGTYPTNVVIEHTGNMNFIPPGMFRSTCKIDTTWFPFDTQVCKLKFGSWSYDGGTLDLRLKCSNESLSTNEMRLNDPNNCS-EIGGADLETYVPSGEWYLEGMDGKRTAAEYDCCP-YPFIDLSYFIQIRRRTLYYGINLIIPCVLISSMSLLTFVLPPDAGEKISLGVTIMLSLSMFQLLVADAMPQTSESVPLIGMYFSCTMVMCSLSVVFTVIVLNYHHRDAESHPVPNWVKKFICTYLANILCMRNHHRDEEKEPIYLRRRKNASFRTSSYREAANANVELKERSSKSLLANVLDLEDDIRTVGGVGGVGVSGIGASAGAFSPPTYQNVMGSSMDGGAERGGGGGGGGGGGGGGPSCGSNCSTRNELAAVVRELQVITKKIADDTADGEISSEWKFAARVVDRLCLIIFSCFTVISTCAILFSAPDV 560          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A4Y0BGM3 (Uncharacterized protein OS=Anopheles funestus OX=62324 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.374e-150
Identity = 238/541 (43.99%), Postives = 340/541 (62.85%), Query Frame = 3
Query:  117 MKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS--------PRNPQV--TNSPTRKIEIQQR--RSILPNM---------NHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            +  +  +   L V   GYH KRLL +L ++     +N LERPVV+E+  L++ F +TL+QI+D+DEKNQ++ TNIWL + W D N +WN  E+G +  L +P  ++WKPD+LMYNSADE FDGTYP NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  SF+ NGEWE++ VP +++   Y CCPE P+IDI F + +RRK LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++V+   WL   L MS        P  P V   N   +++E+++R  +S+L N+         NH   T  +  P  Y  +  +  DGS  V        I      G  + G   +++       + +H+    S   EL  ++ EL+ ITD++++E    + + EWKFAA V+DR CLI F LFT+I+++ +L SAP
Sbjct:  148 LPLILGIAAMLPVIDAGYHEKRLLHHLLDN-----YNVLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNVRWNSSEYGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYPTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDESG---------GDISSFITNGEWELLGVPGKRNEIYYNCCPE-PYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNSDTHEMSEWIRVVFLIWLPFILRMSRPGEPYPHPCRPTVDEKNKQLQEVEMRERSSKSLLANVLDIDDDFRCNHRCNTLPH-NPTYYRTVYRQGEDGS--VGPIGATDTIGRSAGLGTISAGGGRLHET------VSSHTCLSSSAEYELALILKELRYITDQLRKEDESGEITREWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 664          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: Q7QI13 (AGAP000962-PA (Fragment) OS=Anopheles gambiae OX=7165 GN=1270457 PE=2 SV=3)

HSP 1 Score: 451.825 bits (1161), Expect = 5.039e-150
Identity = 236/531 (44.44%), Postives = 337/531 (63.47%), Query Frame = 3
Query:  162 CGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS--------PRNPQV--TNSPTRKIEIQQR--RSILPNM---------NHSFLTYENLAPKPYGNITNRKSDGSTN-VTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
             GYH KRLL +L ++     +N LERPVV+E+  L++ F +TL+QI+D+DEKNQ++ TNIWL + W D N +WN  E+G +  L +P  ++WKPD+LMYNSADE FDGTYP NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ + G          D  SF+ NGEWE++ VP +++   Y CCPE P+IDI F + +RRK LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++V+   WL   L MS        P  P V   N   +++E+++R  +S+L N+         NH   T  +  P  Y  +  +  DGS   +  T  +       ++G   I A        +   + +H+    S   EL  ++ EL+ ITD++++E    + + EWKFAA V+DR CLI F LFT+I+++ +L SAP   +
Sbjct:    3 AGYHEKRLLHHLLDN-----YNVLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNVRWNSSEYGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYPTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDESG---------GDISSFITNGEWELLGVPGKRNEIYYNCCPE-PYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNSDTHEMSEWIRVVFLIWLPFILRMSRPGEPYPHPCRPTVDEKNKQLQEVEMRERSSKSLLANVLDIDDDFRCNHRCNTLPH-NPTYYRTVYRQGEDGSVGPIGATDTIGR-----SAGLGTISA----GGGRLHETVSSHTCLSSSAEYELALILKELRYITDQLRKEDETGEVTREWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAPHFIV 508          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A084VN01 (AGAP000962-PA-like protein OS=Anopheles sinensis OX=74873 GN=ZHAS_00006813 PE=3 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.882e-149
Identity = 237/530 (44.72%), Postives = 338/530 (63.77%), Query Frame = 3
Query:  150 NVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS--------PRNPQV--TNSPTRKIEIQQR--RSILPNM---------NHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            ++   GYH KRLL +L ++     +N LERPVV+E+  L++ F +TL+QI+D+DEKNQ++ TNIWL + W D N +WN  E+G +  L +P  ++WKPD+LMYNSADE FDGTYP NVVV N G    VPPG+FKSTCKI+ITWFPFD Q C MKFG+WTY G ++D +L+ DE        G  D  SF+ NGEWE++ VP +++   Y CCPE P+IDI F + +RRK LYY FNL+ PC++I++M+LL FTLPP +GEK+++GVTI+LSLT+FL MVA+ +P TS +VPL+G YF+CIM M + SVV T+L+LN HH++ +  EM  W++V+   WL   L MS        P  P V   N   +++E+++R  +S+L N+         NH   T  +  P  Y  +  +  DGS  V        I      G  + G   +++       + +H+    S   EL  ++ EL+ ITD++++E    + + +WKFAA V+DR CLI F LFT+I+++ +L SAP
Sbjct:    8 SIIEAGYHEKRLLHHLLDN-----YNVLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNVRWNSSEYGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYPTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQ-DE--------GGGDISSFITNGEWELLGVPGKRNEIYYNCCPE-PYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNSDTHEMSEWIRVVFLIWLPFILRMSRPGEPYPHPCRPTVDEKNKQLQEVEMRERSSKSLLANVLDIDDDFRCNHRCNTLPH-NPTYYRTVYRQGEDGS--VGPIGATDTIGRTAGVGTISAGGGRLHET------VSSHTCLSSSAEYELALILKELRYITDQLRKEDESGEITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 513          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 385.185 bits (988), Expect = 2.153e-127
Identity = 198/527 (37.57%), Postives = 309/527 (58.63%), Query Frame = 3
Query:  144 CLNVCHC-------GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS--------PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            CL V  C       G H +RL   L  +     +N LERPV +++QSL V F  +L+QI+D+DEKNQV+ +NIWL + W D+  KWN  ++  +T +  P  ++WKPDIL+YNSADE+FD T+  NVVV+  G  H +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+V  +++ + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TV VL  H+   +  +MP W ++++  W A FL M         P + +   S    +E+        N N  ++ +  +   PY       +   + V C + +S             G +++  ++   P I    ++   + TEL  ++ E++ I+ + +++  +    +EWKFAA VIDR CL+ F++FT++ ++ IL SAP+
Sbjct:    9 CLAVTICLWRVSLQGEHQRRLYQDLMKN-----YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM------------EADISGYIANGEWDLVEVQGQRNEKFYDCCRE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGEDRVRPCHNKQPRSSISSVELSTGVPQSTNGNMLYIGFRGMESMPYA------TSPDSGVICGRLVSA------------GEEDVLLSTNPAPSI----SSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAPN 495          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: ENSAMXT00000053066.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 380.178 bits (975), Expect = 3.429e-126
Identity = 192/490 (39.18%), Postives = 281/490 (57.35%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNI----YKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++QSL V F  +L+QI+D+DEKNQV+ TNIWL + W DY  +WN  ++  +  +  P  ++W+PDIL+YNSADE+FD T+  NV+V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+VP  ++ + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TVLVL  HH   +  +MP W +VL+  W A FL M     +   S     ++ +                                GS +             NNS    IG + +    Y  S    ++C          TEL  ++ EL+ I  + + +  D    NEWKFAA VIDR CL+ F++FT++ +  IL SAP+
Sbjct:    4 YNPLERPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM------------DADITGYIANGEWDLVEVPGRRNEKFYDCCKE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLLNWCAWFLRMRRPGEERVRSACHNKQLHR--------------------------------GSVSSVELSVSQGALQPNNSNMLYIGFRGMEGVHYTTSPDSGVLCGRIMGGSEEDTELAKILEELRYIARRFRNQDEDESVCNEWKFAAAVIDRLCLMAFSIFTILCTFGILMSAPN 448          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 380.563 bits (976), Expect = 3.681e-126
Identity = 189/494 (38.26%), Postives = 298/494 (60.32%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS--------PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++QSL V F  +L+QI+D+DEKNQV+ +NIWL + W D+  KWN  ++  +T +  P  ++WKPDIL+YNSADE+FD T+  NVVV+  G  H +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+V  +++ + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TV VL  H+   +  +MP W ++++  W A FL M         P + +   S    +E+        N N  ++ +  +   PY       +   + V C + +S             G +++  ++   P I    ++   + TEL  ++ E++ I+ + +++  +    +EWKFAA VIDR CL+ F++FT++ ++ IL SAP+
Sbjct:    4 YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM------------EADISGYIANGEWDLVEVQGQRNEKFYDCCRE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGEDRVRPCHNKQPRSSISSVELSTGVPQSTNGNMLYIGFRGMESMPYA------TSPDSGVICGRLVSA------------GEEDVLLSTNPAPSI----SSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAPN 462          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: ENSAMXT00000055784.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 377.096 bits (967), Expect = 1.604e-124
Identity = 190/498 (38.15%), Postives = 289/498 (58.03%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQ-----------RRSILP-NMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++QSL V F  +L+QI+D+DEKNQV+ TNIWL + W DY  +WN  ++  +  +  P  ++W+PDIL+YNSADE+FD T+  NV+V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+VP  ++ + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TVLVL  HH   +  +MP W +VL+  W A FL M     +   S     ++ +           + ++ P N N  ++ +  +    Y       +   + V C + +           A + +   Y+                +  TEL  ++ EL+ I  + + +  D    NEWKFAA VIDR CL+ F++FT++ +  IL SAP+
Sbjct:    4 YNPLERPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM------------DADITGYIANGEWDLVEVPGRRNEKFYDCCKE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLLNWCAWFLRMRRPGEERVRSACHNKQLHRGSVSSVELSVSQGALQPNNSNMLYIGFRGMEGVHY------TTSPDSGVLCGRIMGGSEEDVLLPGATVSS---YQGRVGVGGRVTGGVVGGATETELAKILEELRYIARRFRNQDEDESVCNEWKFAAAVIDRLCLMAFSIFTILCTFGILMSAPN 479          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 377.096 bits (967), Expect = 1.842e-124
Identity = 193/513 (37.62%), Postives = 303/513 (59.06%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS--------PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            G H +RL   L  +     +N LERPV +++QSL V F  +L+QI+D+DEKNQV+ +NIWL + W D+  KWN  ++  +T +  P  ++WKPDIL+YNSADE+FD T+  NVVV+  G  H +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V    +++ + Y CC E P+ D+ F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TV VL  H+   +  +MP W ++++  W A FL M         P + +   S    +E+        N N  ++ +  +   PY       +   + V C + +S             G +++  ++   P I    ++   + TEL  ++ E++ I+ + +++  +    +EWKFAA VIDR CL+ F++FT++ ++ IL SAP+
Sbjct:   10 GEHQRRLYQDLMKN-----YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM------------EADISGYIANGEWDLVG-KGQRNEKFYDCCRE-PYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGEDRVRPCHNKQPRSSISSVELSTGVPQSTNGNMLYIGFRGMESMPYA------TSPDSGVICGRLVSA------------GEEDVLLSTNPAPSI----SSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAPN 481          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 308.916 bits (790), Expect = 1.227e-99
Identity = 163/438 (37.21%), Postives = 255/438 (58.22%), Query Frame = 3
Query:  387 LEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGN-----ITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMT 1685
            +E   +  L     ++W PDIL+YNSADE+FD T+  NV+V   G    +PPGM KSTC I++ WFPFD Q C +KFG+WT+ G  +D             Q   ADT  ++ NGEW++V++P +++   Y CC E P+ D+ + + +RR+ LYY  NL+ PC++IS +SLLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLIG YF+  MI+ +FSVV TV+VL  HH + + ++MP W++V++  W A FL M     +  +   R++ I  R S++ +++ + L+   +  K  G+      TN  +      + +  +    T  NS        N  +     P           + +E+  ++ EL+ I  + + +  +   ++EWKFAA V+DR CL+ F LFT+IS++ IL SAP  T
Sbjct:    1 MEHPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDL------------QMLEADTSGYIANGEWDLVEIPGKRNELYYDCCQE-PYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQPGRE-RHELARRLSILHRNSMV-SLDLALLSASGIHKKTNGHGVFIGFTNPDAPQQPPTSDSGVMCGRETCFNSTGPEEEPGNAQRGMPPDP--------TAGMSSEITKILIELRYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTISILMSAPHFT 415          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 289.271 bits (739), Expect = 2.969e-91
Identity = 167/502 (33.27%), Postives = 273/502 (54.38%), Query Frame = 3
Query:  156 CHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQV--TNSPTRKI-EIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISS 1652
            C       RL   LF       +N   RPV + +  + V+F+V++ Q++ LDE NQ+M TN+WL  TW DY F+WNP +F  +  + +PS+K+WKPDI++YN+AD  F        ++   G +  +PP +FKS+CKI++T+FPFD Q+C MKFG+WTY   K+D  L   +           + + F ++GEW I+DVP  KH   Y CC E  + DI + V +RR  L+Y  NL+ PC++IS +++LVF LP   GEK+T+ ++++LSLT+FL ++ + +P TS  +PLIG Y    MI  + S+V T+ VLN H+++ E   MP W++ +    L   +L+ P    V    SP   + E  Q+ + L     S     + +    G I+   S    +V+ + RL  +        A++ +  +  +S  + +    +    S   E++ VI  +K I + ++ +    +  ++WK+ A V+DR  L  F L  ++ +
Sbjct:    2 CRASEAASRLYKTLFT-----SYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGTK----------INLKDFWESGEWVIIDVPGYKHDIKYNCC-EQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQPPKGSVGTAASPDAVVSEADQQPACLCAGELSAAAASSSSSCQSGGISRASSSMEAHVS-SVRLPRLRA------ADVMSDELSSSSSTESLDALLALCLLS--PEIRQVIDSVKYIAENLRTQDEAKEVCDDWKYVAMVVDRIFLWVFVLVCILGT 478          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000149.1 (pep scaffold:Pmarinus_7.0:GL480219:31373:46583:1 gene:ENSPMAG00000000129.1 transcript:ENSPMAT00000000149.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.478 bits (698), Expect = 8.961e-86
Identity = 156/449 (34.74%), Postives = 234/449 (52.12%), Query Frame = 3
Query:  462 SADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLM--------------SP---RNPQVTNSPTRKIEIQQRRSILPNMNHSF-------------LTYENLAPKPYGNITNRKSDGSTNVTCTKRLSH--------------IYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            SADE+FD T+  +V+V + G    +PPG+ KS+CKI++ WFPFD QSC +KFG+WT+ G  +D  L              ADT  +L NGEW+++ V  +++   Y CC E P+ D+ + + +RR+ LYY  NL+ PC++IS ++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLIG YF+  +++  FSVV TVLVL CHH   +   MP W++VL+  W A  L M              SP   + P ++  P    +  Q  +     NHS               TY    P  Y    N   + ST +T T+  S                  Q++      G  NI   +  +        +      EL  ++ E+  + ++++      +   EW+FAA VIDR CLI F++ T+ S+  IL SAP
Sbjct:    1 SADERFDATFHTSVLVNHTGGCQYIPPGILKSSCKIDVRWFPFDVQSCDLKFGSWTHDGWLIDLHLL------------HADTSGYLPNGEWDLIGVVGKRNELFYECCQE-PYTDVTYTLLLRRRTLYYALNLLLPCMLISALALLVFLLPAESGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTLMIVGFSVVVTVLVLQCHHHDPDGTNMPTWVRVLLVHWCAWLLRMKQPVRDARSGGPHGSPAPWKPPCLSEHPGTGADRGQVTTATQPHNHSHNNTRGYTGNHNPDNTYAQSQPLNYSQPFNHTHNHSTTITNTQPHSQPPNHTDNHPIAQPRTAAQHHEDSCCPGCPNIAGAAGGEGGGAARQESPLQ-SCELAGLLAEVHYLAERMRAADAGARLGGEWRFAAAVIDRLCLIAFSIVTISSTAAILVSAP 435          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 242.662 bits (618), Expect = 8.482e-74
Identity = 122/342 (35.67%), Postives = 194/342 (56.73%), Query Frame = 3
Query:  180 RLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTET-----YPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEE-MPYWLKVLVNRWLANFLLM 1187
            RLL  +  D     +    RPV   + ++EV+F + + Q++D+DEKNQ+M TN+WL   W D N +WNP ++G I ++ +P+  +W PDI++Y++AD +F+G+     VV + G +   PP ++KS+C I++T+FPFDQQ+C MKFG+WTY G  VD  +   +           D   +  NGEWE ++    K         YP         I +   +RR  L+Y   L+ PC+ +S +++ VF LP   GEKI++  ++++SLT+FL ++ + +P +S  +PLIG Y   IMI  + S++ TV V+N HH+S      M  W++ L    L   L M
Sbjct:   37 RLLKRMLKD-----YQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVNSD----------VDRGEYFDNGEWEFLNATGNKGVRLDGHRFYPY--------ITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCM 355          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 242.276 bits (617), Expect = 1.262e-72
Identity = 127/331 (38.37%), Postives = 196/331 (59.21%), Query Frame = 3
Query:  270 VQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILP 1262
            V++      + D DEKNQ+M TN+WL   W DY  +W+P E+ N+T++ +PSE +W PDI++YN+AD  F  T+     + + G +   PP ++KS+C I++T+FPFDQQ+C MKFG+WTY   K+D                  D + + ++GEW IV      +T+ Y CCP+  + DI +   +RR  L+Y  NL+ PC++IS +++LVF LP   GEKIT+ ++++LSLT+FL ++ + +P TS  +PLIG Y    MI  + S+V TV VLN HH+S     MP W++ +    +  +L+M    PQ      R+ E+   R+  P
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL----------VSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQV-YPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRRPPPQ-----QRRSELLLARAARP 315          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 278.1 bits (710), Expect = 4.738e-87
Identity = 131/347 (37.75%), Postives = 221/347 (63.69%), Query Frame = 3
Query:  177 KRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDG---TYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQV 1208
            KRLL+ LF +     ++S  RPV +++  + V+F ++L+QI+ ++ K+Q++  ++W+   WT+    WN  ++G I ++ L   KVW PDI++YN+ADE + G    Y  +V+ ++ G      P  F STC IN+ +FPFD Q+C +KFG+WTY G+++            T    SAD   ++ NGEW ++ +PA+ +   Y CC + PF D+  +++++RK LYY+FNL+ PC +I+T++L+ F LPP +GEK+ +G+T++L++T+FL +VA+ LP TS  +PL+G YF   M + + S+V T L+LN  H++     MP+W+KV++  ++A     SPRN ++
Sbjct:   39 KRLLADLFRN-----YDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTM----------TSTSDSADLSKYVNNGEWHLLAMPAKLNRVFYNCC-KYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMAR----SPRNARL 365          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 269.24 bits (687), Expect = 2.244e-85
Identity = 130/341 (38.12%), Postives = 211/341 (61.88%), Query Frame = 3
Query:  177 KRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDG---TYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDE---EMPYWLKVLVNRWLANFL 1181
            +RL+S L       G++   RPV++ N +L+V F + ++QI++++ +NQ++ TN+W+   W +    W+P  +  + T+ L ++ VW PDI++Y+SAD  F G    Y  +V+++  G      P  F+STCKI++T+FPFD+Q+C MKFG+WTYT   VD +                 +  +LK+ EW+++     + ++ Y CCPE P  D+   + +RRK L+Y FNL+TPC+I+ TM LL F LPP +GE+IT+ +T++L++ +FL +VA+ LP+ S S+PL+G ++  IM   + S++ T  VLN HH++       EMP W+ V+V RWLA  L
Sbjct:    2 QRLISDLLQ-----GYSRNARPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ----------ASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPE-PISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVL 326          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P0])

HSP 1 Score: 265.774 bits (678), Expect = 1.658e-81
Identity = 159/510 (31.18%), Postives = 273/510 (53.53%), Query Frame = 3
Query:  177 KRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGT---YPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNM-NHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMIC-NHSAT-KCSI-FTELQDVIHELKQIT---DKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 1676
            +RLL+ +F       +++  RPV+ +  ++ V+  +TL QI+D+ EK ++++ ++++   W +    WN  E+G I  + L    +WKPDI +YN+AD  +DG+   + A + V   G    + P +F ++CKIN+ +FPFDQQ C +KFG+WTY  + VD   + D+ S           + + KNGEW+ +  P ++    YPCCP+SPF D+   + +RRK LYY  NL+ PC++I+ +SLL F +   +GE++ + +T +L+LT+F+ +VAD LP TS  VP+I +Y  C  I    ++V T +V+ C+H + +   MP+W+K  + + L   L        +T+   +K E Q +      + NH   T   +             +G  +    + L+ ++               Y N  ++P++   H+ T K  +   ++ DV H ++ IT   D ++E+     K ++W  AA VIDRF LI FAL  L+S+++   + P
Sbjct:   70 RRLLADVFG-----SYDNKLRPVLSKTHNVTVKLGLTLNQIMDVIEKFELLSVSLYVRQKWENPLVAWNKSEYGGIVQVNLDPSTLWKPDIYLYNNADSGYDGSLYGFTAKIKVNYSGTNTWLAPKIFTTSCKINVKYFPFDQQECRLKFGSWTYDANSVDIFPEEDQAS----------IKGYQKNGEWDFIGFPCKRSILYYPCCPDSPFTDVTCTLIIRRKTLYYWVNLIIPCMLITVLSLLSFIVSTDSGERVGLVITDLLALTVFMLIVADILPPTSEVVPVISIYIICSTIEVGLALVATTIVVQCYHTNPDINVMPFWVKYFICQKLGGLL-------GITHVKDKKEEEQAKELDDETVTNHMGFTLNQIM----------DVEGIYDDDERRLLADVFGS-------------YDNK-LRPVLSKTHNVTVKLGLTLNQIMDVDHLVEGITKLIDNMEEQDEGNSKRDDWILAATVIDRFFLILFALVILLSTILTFATIP 533          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 262.307 bits (669), Expect = 1.397e-80
Identity = 147/494 (29.76%), Postives = 271/494 (54.86%), Query Frame = 3
Query:  210 KFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDG---TYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDE--EMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSA--TKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTS 1670
            K Y  ++   P++++ Q + V F + L+Q++++D+KNQ++ TN+W+   WT+   KW+P ++G IT + + + K+W PDI++YNSAD +F G    Y   V++ + G+     P  F+STC+I++T+FPFDQQ+C MKFG+WT+  + VD  +  D+    + QY        +K+ EW+++    +++ E Y CC   PF D+      RRK L+Y+FNL+ PC+II+ M LL F LPP +GE+IT+ +T++L++ +FL + A+ LP+ S +VP++G+++  +M+  + S++ T  VL+ HHK+       +P+W++V +  +L   L +     + T   + K++ ++   +  +M  +    +       G  + R+  GS  V+    +     ++++   +            +      S+  TK +     Q +I     + D ++ +        EW++ A V+DR     F L  ++S+ VIL S
Sbjct:   21 KGYNKDAHPVPILNKTQYM-VTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTF--EVVDLDIFADKSPLHSSQY--------MKSAEWDLIAASKKRNVEYYACC-TYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVKKPITEDTYDASSKLDFKRLSMMKRDMERAVGDGKRRFGLSNGGKSGRRL-GSRAVSDDLLMDSFDQEDDTNSNSTNQNTTNNTGNNQRTFSVQSSMNTKAT-----QGII----VLADHVKHKRLVEINQGEWRYLAMVLDRLFFWLFVLMIILSASVILRS 492          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N9])

HSP 1 Score: 256.529 bits (654), Expect = 5.856e-78
Identity = 143/490 (29.18%), Postives = 261/490 (53.27%), Query Frame = 3
Query:  213 FYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGT---YPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPN-MNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTEL---QDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVI 1661
            F G+N   RPV  + +++ V   +++ QI+D+ EK+Q++ T+ W+   W +   +WN   +G I  + +   +VW PD+++YN+AD   DG+   +   ++V++ G    + P +F S+C I I +FPFD Q C +KFG+WT+ G  +D + +  + S             F+ NGEW+++  PA ++   Y CCP +P+ D+ F + +RR+ L+++FNL+ PC +I  ++ L F LPP +GE+I++ +T +L++T+F+ MVAD LP TS  V +I +++SC +I    +++ T +VL  H  S    +MP W++ LV   L              +S +  I++   +  L N +    +   N   K +G     +S G         LS   TQ++ G+   G      +  +  +I   +++  ++F  L   + ++  L+ +    + +  + ++ NEWK AA ++D F    F +   ISS+V+
Sbjct:   58 FAGYNPKLRPVFHKRENVTVVLGMSVHQIIDVYEKDQIIKTSFWVRQIWYNPFLRWNETFYGGIKEINVSPLQVWTPDLVLYNNADASTDGSLENFKTRIIVSSDGKNMWLAPVIFSSSCTIKIKYFPFDDQYCSLKFGSWTFDGFHLDLKPEAPQAS----------LSKFIPNGEWDLIGAPAIRNVLRYDCCP-APYPDVTFTLHLRRRVLFFLFNLIIPCFVIVVLTSLSFYLPPDSGERISVVITNLLAMTVFMLMVADILPPTSDEVSIISIFYSCSIIEVGIALLGTCIVLKYHFCSTSIHKMPPWVRFLVIECLGKVFCRQEHTNDQEDSKSDTIKLDNCKHKLENGLKDPLIKQCNFFGK-FGVRERVRSSGMKTTDGGSNLS--MTQDDEGRGR-GGTPYSSHRNMDDIIAAEASSNSTVFALLSRQESMVKNLEILAHAQRCQDEEDREKNEWKLAASILDNFFCWLFLMSIFISSIVL 532          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 394.045 bits (1011), Expect = 1.386e-130
Identity = 206/511 (40.31%), Postives = 318/511 (62.23%), Query Frame = 3
Query:  153 VCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMI-CNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            V H G + +RL S L +      +N LERPV +++QSL V F ++LLQI+D+DEKNQV+ TNIWL + W D+  +WN  ++  +T +  P   +WKPDIL+YNSADE+FD T+  N++V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+VP +++   Y CC E P++DI F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TVLVL  HH   +  +MP W +V++  W A FL M  P   +V ++   K     RRS L +M+ +  T  +L+    GN+      G  ++    + S   T  +SG   +  + I +    + ++  +H+++  ++  EL  ++ E++ I  + +++  D    NEWKFAA V+DR CL+ F+LFT++ ++ IL SAP+
Sbjct:   43 VSHQGPNQRRLYSDLMST-----YNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKML------------EADVSGYIANGEWDLVEVPGQRNERFYECCDE-PYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNK----TRRSSLTSMDLNAPTSTSLSTN--GNLLYVGVRGLESL----QYSPGATSPDSGV--VCGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPN 523          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000046008.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 392.504 bits (1007), Expect = 5.074e-130
Identity = 205/509 (40.28%), Postives = 317/509 (62.28%), Query Frame = 3
Query:  159 HCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMI-CNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            H G + +RL S L +      +N LERPV +++QSL V F ++LLQI+D+DEKNQV+ TNIWL + W D+  +WN  ++  +T +  P   +WKPDIL+YNSADE+FD T+  N++V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+VP +++   Y CC E P++DI F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TVLVL  HH   +  +MP W +V++  W A FL M  P   +V ++   K     RRS L +M+ +  T  +L+    GN+      G  ++    + S   T  +SG   +  + I +    + ++  +H+++  ++  EL  ++ E++ I  + +++  D    NEWKFAA V+DR CL+ F+LFT++ ++ IL SAP+
Sbjct:   42 HQGPNQRRLYSDLMST-----YNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKML------------EADVSGYIANGEWDLVEVPGQRNERFYECCDE-PYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNK----TRRSSLTSMDLNAPTSTSLSTN--GNLLYVGVRGLESL----QYSPGATSPDSGV--VCGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPN 520          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000033785.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 390.578 bits (1002), Expect = 5.951e-130
Identity = 199/488 (40.78%), Postives = 308/488 (63.11%), Query Frame = 3
Query:  222 HNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMS-PRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMI-CNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPD 1679
            +N LERPV +++QSL V F ++LLQI+D+DEKNQV+ TNIWL + W D+  +WN  ++  +T +  P   +WKPDIL+YNSADE+FD T+  N++V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D ++              AD   ++ NGEW++V+VP +++   Y CC E P++DI F V MRR+ LYY  NL+ PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M++   SV+ TVLVL  HH   +  +MP W +V++  W A FL M  P   +V ++   K     RRS L +M+ +  T  +L+    GN+      G  ++    + S   T  +SG   +  + I +    + ++  +H+++  ++  EL  ++ E++ I  + +++  D    NEWKFAA V+DR CL+ F+LFT++ ++ IL SAP+
Sbjct:    4 YNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKML------------EADVSGYIANGEWDLVEVPGQRNERFYECCDE-PYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNK----TRRSSLTSMDLNAPTSTSLSTN--GNLLYVGVRGLESL----QYSPGATSPDSGV--VCGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPN 466          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000023459.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 377.096 bits (967), Expect = 1.277e-124
Identity = 196/517 (37.91%), Postives = 293/517 (56.67%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIF----------TELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMT 1685
            G H +RL   L  +     +N LERPV +++ SL V F  +LLQI+D+DEKNQV+ TNIWL + W D+  +WN  ++  +T +  P  ++W+PDIL+YNSADE+FD ++  N++V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D             Q  +ADT  ++ NGEW++V+VP ++    Y CC E P+ D+ F V MRR+ LYY  N + PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M +   SV+ TVLVL  HH   +   MP W +V++  W A FL M                   RR   P      L   N+  +  G++++ +   S N        H+   N       G + ++  S   P         C+ F           ELQ ++ E++ I  + + +  +    +EWKFAA VIDR CL+ F++FT++ ++ IL SAP+  
Sbjct:    7 GVHQRRLYKELIRN-----YNPLERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDL------------QMINADTTGYIANGEWDLVEVPGQRSERFYDCCKE-PYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMAIVGLSVIATVLVLQYHHHDPDGGHMPQWTRVVLLNWCAWFLRM-------------------RR---PGEAKVLLACHNMGKRQRGSLSSLEL--SINPVSVPPQPHVTNSNLLYVGFQGVEGLHCGSATDP------EPLCARFIEEDFLRVGEVELQQILEEVRFIGQRFRNQDQEKAACSEWKFAAAVIDRLCLVAFSVFTILCTIGILMSAPNFV 475          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000023454.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 374.4 bits (960), Expect = 2.323e-123
Identity = 193/510 (37.84%), Postives = 294/510 (57.65%), Query Frame = 3
Query:  165 GYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPY---GNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMT 1685
            G H +RL   L  +     +N LERPV +++ SL V F  +LLQI+D+DEKNQV+ TNIWL + W D+  +WN  ++  +T +  P  ++W+PDIL+YNSADE+FD ++  N++V + G    +PPG+FKSTC I++ WFPFD Q C +KFG+WTY G  +D             Q  +ADT  ++ NGEW++V+VP ++    Y CC E P+ D+ F V MRR+ LYY  N + PC++IST++LLVF LP  +GEKI++G+T++LSLT+F+ +VA+ +P TS SVPLI  YF+  M +   SV+ TVLVL  HH   +   MP W +V++  W A FL M              +  +QR S L ++  S +   ++ P+P+    N+      G   + C        T      A    ++  +                ++  ELQ ++ E++ I  + + +  +    +EWKFAA VIDR CL+ F++FT++ ++ IL SAP+  
Sbjct:    2 GVHQRRLYKELIRN-----YNPLERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDL------------QMINADTTGYIANGEWDLVEVPGQRSERFYDCCKE-PYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMAIVGLSVIATVLVLQYHHHDPDGGHMPQWTRVVLLNWCAWFLRMRRPGEAKVLLACHNMGKRQRGS-LSSLELS-INPVSVPPQPHVTNSNLLYVGFQGVEGLHCGSA-----TDPEPLCARFIEEDFLRVGGGTRRRQGGVLNDSALEVELQQILEEVRFIGQRFRNQDQEKAACSEWKFAAAVIDRLCLVAFSVFTILCTIGILMSAPNFV 486          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 1091.64 bits (2822), Expect = 0.000e+0
Identity = 523/524 (99.81%), Postives = 523/524 (99.81%), Query Frame = 3
Query:  117 MKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            MKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVT TKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI
Sbjct:    1 MKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTSTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 524          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 286/287 (99.65%), Postives = 286/287 (99.65%), Query Frame = 3
Query:  828 MRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            MRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVT TKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI
Sbjct:    1 MRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTSTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 287          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 274/275 (99.64%), Postives = 274/275 (99.64%), Query Frame = 3
Query:  864 MTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            MTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVT TKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI
Sbjct:    1 MTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTSTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 275          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 265/266 (99.62%), Postives = 265/266 (99.62%), Query Frame = 3
Query:  891 MSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 1688
            MSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVT TKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI
Sbjct:    1 MSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTSTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAPDMTI 266          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000002905.1 (SMESG000002905.1)

HSP 1 Score: 465.307 bits (1196), Expect = 1.365e-158
Identity = 225/526 (42.78%), Postives = 332/526 (63.12%), Query Frame = 3
Query:  117 MKF---VFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRNP---------------------QVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLI 1622
            MKF    F +L        G   K+LL +LF++ +   HN LERP  D+ +SL V   + L+QI+D+DEKNQ+++TN+W+D+ WTDY+F W+P+ + NITTL++P+ ++W+PDIL+YNSADE+FD T+PAN+VV   G MH VPPGMFKSTC+INI W+PFD Q C MKFG+WTY G+ +D    CD  + C   +G  + E+ ++NGEW+++   A +  + YPCCPE+ +IDI ++++++R+ LYY FNL+ PCIIISTM+LL F +PP AGEKI++GVTI+LSLT+FL MVA+K+P TS ++PLIG+YF+C+MI+CS S+VFTVLVLN HH+S +  ++P  L  +VN WLA  L M PRN                       + N   +   ++  +S+L N+    L  EN   + +       S    +      +    +QNN+G   I  + +                     +++++++  L+Q+T K+ E      ++NEWKFAARV+DRFCL+
Sbjct:    1 MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPET-YIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGVTILLSLTVFLMMVAEKMPPTSKAIPLIGMYFTCVMIVCSLSLVFTVLVLNFHHRSSDSIDVPESLHKVVNIWLARILFMKPRNKVASEVFESGDLKQNTGQFKRNAIYNRAFQSGSMKGSKSLLANV----LDMEN---EIWARAAQSVSFSYPSANVNSEVPPYESQNNNG--GIMGEGLLPEGR----------------SQIKEILSHLRQVTSKLAETEIQELRANEWKFAARVMDRFCLV 500          
The following BLAST results are available for this feature:
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA75.003e-12339.01cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.15.003e-12339.01cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA71.765e-12239.01cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.18.055e-12238.60cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.18.055e-12238.60cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-167.884e-12240.86Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-195.797e-10535.47AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-199.191e-10535.26AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-92.139e-10046.33AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-111.606e-9944.22AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha52.927e-14641.83gene:FBgn0028875 transcript:FBtr0300594[more]
nAChRalpha52.927e-14641.83gene:FBgn0028875 transcript:FBtr0080594[more]
nAChRalpha52.927e-14641.83gene:FBgn0028875 transcript:FBtr0309867[more]
nAChRalpha76.847e-14643.67gene:FBgn0086778 transcript:FBtr0301834[more]
nAChRalpha76.847e-14643.67gene:FBgn0086778 transcript:FBtr0343798[more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna73.875e-12640.24cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna75.525e-12640.24cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
FO907089.12.107e-12539.02neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.29.876e-11337.98si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:ch73-380n15.21.206e-11236.52si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021532.16.207e-12137.50cholinergic receptor, nicotinic alpha 7 [Source:NC... [more]
clca21.881e-11239.61chloride channel accessory 2 [Source:Xenbase;Acc:X... [more]
prepl7.334e-8930.29prolyl endopeptidase-like [Source:Xenbase;Acc:XB-G... [more]
CHRNA99.914e-8732.01cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
CHRNA91.466e-8632.01cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna73.310e-11938.40cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna33.157e-8932.99cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna34.161e-8932.99cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna22.432e-8732.32cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna22.432e-8732.32cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22770|ACHA7_CHICK2.582e-12339.63Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|P36544|ACHA7_HUMAN2.402e-12239.01Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|Q866A2|ACHA7_MACMU8.657e-12238.81Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|A8WQK3|ACH1_CAEBR3.198e-12140.27Acetylcholine receptor subunit alpha-type acr-16 O... [more]
sp|P48180|ACH1_CAEEL1.003e-12040.86Acetylcholine receptor subunit alpha-type acr-16 O... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EGF02.183e-15644.01Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DHA49.587e-15543.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Y0BGM32.374e-15043.99Uncharacterized protein OS=Anopheles funestus OX=6... [more]
Q7QI135.039e-15044.44AGAP000962-PA (Fragment) OS=Anopheles gambiae OX=7... [more]
A0A084VN011.882e-14944.72AGAP000962-PA-like protein OS=Anopheles sinensis O... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna72.153e-12737.57neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSAMXT00000053066.13.429e-12639.18neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna73.681e-12638.26neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSAMXT00000055784.11.604e-12438.15neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna71.842e-12437.62neuronal acetylcholine receptor subunit alpha-7-li... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008550.11.227e-9937.21pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrna32.969e-9133.27cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
ENSPMAT00000000149.18.961e-8634.74pep scaffold:Pmarinus_7.0:GL480219:31373:46583:1 g... [more]
chrnb3b8.482e-7435.67cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a1.262e-7238.37cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420544.738e-8737.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479692.244e-8538.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420391.658e-8131.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448961.397e-8029.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420385.856e-7829.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038695.11.386e-13040.31neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000046008.15.074e-13040.28neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000033785.15.951e-13040.78neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000023459.21.277e-12437.91neuronal acetylcholine receptor subunit alpha-7 [S... [more]
ENSORLT00000023454.22.323e-12337.84neuronal acetylcholine receptor subunit alpha-7 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011827.10.000e+099.81SMESG000011827.1[more]
SMESG000011827.10.000e+099.65SMESG000011827.1[more]
SMESG000011827.10.000e+099.64SMESG000011827.1[more]
SMESG000011827.10.000e+099.62SMESG000011827.1[more]
SMESG000002905.11.365e-15842.78SMESG000002905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000957 ID=SMED30000957|Name=Acetylcholine receptor subunit alpha-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1827bp
TAGAATTCTAAAAAATTTTGATTTTTGAATTTTCATTTGTTTTGAAAATG
AATTTCATTAAATAAAAAATTCGTTTCAAACAAATTCTAAATCGTTGAAA
TTATCAAAACTCGTCAATGAAATTTGTTTTTGTTTTATTGGGCTGTCTCA
ATGTTTGCCATTGTGGATATCACGGCAAACGGCTTTTGAGTTATCTTTTC
AATGATTCGAAGTTCTATGGCCACAATTCCTTGGAACGACCAGTTGTTGA
TGAAAATCAATCATTGGAAGTGCAATTCAAGGTCACTTTACTTCAAATTT
TGGATTTGGATGAAAAAAATCAAGTAATGAACACGAATATTTGGCTGGAC
ATAACATGGACAGATTATAATTTCAAATGGAATCCCCTTGAATTTGGGAA
TATCACAACTCTTATCTTACCTTCAGAAAAGGTTTGGAAGCCCGACATTC
TCATGTATAATAGTGCTGACGAAAAATTTGATGGAACCTATCCTGCAAAT
GTGGTGGTCACGAATCAAGGACTAATGCACATGGTTCCTCCGGGAATGTT
CAAATCAACATGTAAAATAAATATCACATGGTTCCCATTTGACCAGCAAA
GCTGTGTCATGAAATTCGGCACCTGGACATATACTGGGGATAAAGTTGAT
TTCAGGCTGAAATGCGACGAAGGCAGTAACTGTACCGGACAATACGGAAG
TGCCGATACCGAATCATTTCTGAAAAACGGAGAATGGGAAATAGTTGATG
TTCCTGCAGAGAAACATACCGAAACATACCCGTGCTGTCCCGAATCTCCA
TTCATCGATATAAAATTTCATGTCAAAATGAGAAGAAAAGCTCTCTATTA
TATTTTCAACTTGATGACTCCCTGTATAATTATCTCAACTATGTCTCTTC
TCGTCTTCACATTACCTCCAGGAGCTGGAGAAAAAATTACCATGGGAGTT
ACAATAATGTTGTCATTGACCATGTTCCTATTCATGGTGGCTGACAAATT
GCCACAAACTTCAGGATCTGTCCCTTTGATAGGATTATATTTCTCATGCA
TCATGATCATGTGTTCATTTTCAGTGGTTTTTACAGTTTTAGTTTTGAAC
TGTCACCACAAAAGTGGAGAAGATGAAGAAATGCCATACTGGCTTAAGGT
TTTAGTTAATCGCTGGTTGGCTAATTTCTTATTAATGAGCCCCAGAAATC
CTCAAGTGACAAATTCACCTACAAGAAAGATTGAGATCCAACAAAGAAGA
AGCATTCTACCAAATATGAACCACTCGTTCTTAACCTATGAAAACCTGGC
CCCAAAACCGTACGGAAATATCACCAATCGAAAATCGGATGGGTCAACGA
ATGTGACTTGTACTAAACGACTATCCCATATTTATACCCAAAATAATAGT
GGAAAAGCAAATATCGGAGCAAAAAATATTTACAAAAATTCTTACATAAA
ACCCATGATATGCAATCACTCAGCGACAAAATGCTCAATTTTCACAGAAT
TACAAGATGTTATTCACGAATTAAAACAAATCACTGACAAAATTCAAGAA
GAACATTTTGATTTCAAAAAGTCCAACGAATGGAAATTCGCCGCAAGAGT
GATTGATAGATTTTGTTTAATTGGATTCGCTCTTTTTACCCTGATATCAT
CCGTCGTAATTTTAACCTCGGCTCCCGACATGACGATTTGAGACGAATTT
GATTTAGATATCGGTTTGTTATTTGCTTTTACTCTTAGATTTTTGACCGG
CAAATGTTATTTAACTTTTTTGTGCTAAACCAAATTTTTTATTTAGAATA
AATTTATTTGAAATGTTCAAAAAAAAA
back to top

protein sequence of SMED30000957-orf-1

>SMED30000957-orf-1 ID=SMED30000957-orf-1|Name=SMED30000957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=525bp
MKFVFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSL
EVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLI
LPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCK
INITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTES
FLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLM
TPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSG
SVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRW
LANFLLMSPRNPQVTNSPTRKIEIQQRRSILPNMNHSFLTYENLAPKPYG
NITNRKSDGSTNVTCTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICN
HSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFC
LIGFALFTLISSVVILTSAPDMTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0005892acetylcholine-gated channel complex
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0006812cation transport
GO:0007165signal transduction
GO:0007271synaptic transmission, cholinergic
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 47..63
score: 44.12
coord: 117..135
score: 35.5
coord: 81..95
score: 38.52
coord: 99..111
score: 40.43
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 137..151
score: 48.69
coord: 60..76
score: 31.65
coord: 224..236
score: 33.45
coord: 93..104
score: 45.29
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 16..506
e-value: 3.5E-100
score: 333.9
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 1..510
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 435..511
e-value: 1.1E-7
score: 33.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 229..348
e-value: 1.8E-40
score: 140.2
NoneNo IPR availablePANTHERPTHR18945:SF825NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA5, ISOFORM Bcoord: 1..510
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 231..320
e-value: 1.1022E-42
score: 145.583
NoneNo IPR availableCDDcd18997LGIC_ECD_nAChRcoord: 38..229
e-value: 1.64722E-98
score: 293.242
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 262..279
NoneNo IPR availableTMHMMTMhelixcoord: 483..505
NoneNo IPR availableTMHMMTMhelixcoord: 292..314
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 6..228
e-value: 7.1E-77
score: 259.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 10..229
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 10..229
e-value: 7.8E-67
score: 224.9
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 237..503
e-value: 2.5E-48
score: 165.2
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 137..151
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 231..509