slc16a-22

Overview
Nameslc16a-22 (AKN21517.1)
Smed IDSMED30000950
Length (bp)3050
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-22 (SMED30000950) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-22 (SMED30000950) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-22 (SMED30000950) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-22 (SMED30000950) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000950

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000950SMESG000077590.1 dd_Smed_v4_6317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000950SMESG000077590.1 dd_Smed_v4_6317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000950SMESG000077590.1 dd_Smed_v4_6317_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30000950SMESG000077590.1 Smed-slc16a-22smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-22 vs. Ensembl Human
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 97.8265 bits (242), Expect = 1.837e-20
Identity = 65/210 (30.95%), Postives = 108/210 (51.43%), Query Frame = 2
Query:  428 NKEVTRK------QEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQ 1039
             KE  RK      + +  S  D  WGW++V G  +  +    +     +     ++YF   + + T    S+V  + ++ +PL + ++N+   +   M+G +  +  L  SSF  S     L  GV +G+GF L Y PAIA+V  +F++++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L +
Sbjct:   23 GKEEKRKTMAKVNRARSTSPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDY-AQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKE 231          
BLAST of slc16a-22 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 85.5001 bits (210), Expect = 1.336e-16
Identity = 56/197 (28.43%), Postives = 99/197 (50.25%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHIS--LTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            +K  +   ++D  W W++V  S    + + G     G L+ E+++ +    H S  LT    SL  GI LI  P      N  G R  A++G +  ++    S++  +     + FGV +G+G G+ YLPA+ +V  +F ++RA+A G++  G+G G+ +++ LL  L     W  ++++  A+     V  AL RP
Sbjct:   19 KKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEF----HQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRP 211          
BLAST of slc16a-22 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 85.5001 bits (210), Expect = 1.400e-16
Identity = 56/197 (28.43%), Postives = 99/197 (50.25%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHIS--LTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            +K  +   ++D  W W++V  S    + + G     G L+ E+++ +    H S  LT    SL  GI LI  P      N  G R  A++G +  ++    S++  +     + FGV +G+G G+ YLPA+ +V  +F ++RA+A G++  G+G G+ +++ LL  L     W  ++++  A+     V  AL RP
Sbjct:   19 KKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEF----HQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRP 211          
BLAST of slc16a-22 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 84.7297 bits (208), Expect = 2.615e-16
Identity = 56/197 (28.43%), Postives = 99/197 (50.25%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHIS--LTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            +K  +   ++D  W W++V  S    + + G     G L+ E+++ +    H S  LT    SL  GI LI  P      N  G R  A++G +  ++    S++  +     + FGV +G+G G+ YLPA+ +V  +F ++RA+A G++  G+G G+ +++ LL  L     W  ++++  A+     V  AL RP
Sbjct:   19 KKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEF----HQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRP 211          
BLAST of slc16a-22 vs. Ensembl Human
Match: SLC16A3 (solute carrier family 16 member 3 [Source:HGNC Symbol;Acc:HGNC:10924])

HSP 1 Score: 78.5666 bits (192), Expect = 3.406e-16
Identity = 50/158 (31.65%), Postives = 81/158 (51.27%), Query Frame = 2
Query:  461 ISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYF--LLSHISLTILPGSLVSGIYLI----TSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCIL 916
            + + D  WGW V+FG   C V      F+Y    + V  +F  L+    +     + +S I L     T PL +   N FG R V +VG +  ++ + A+SFCRS I   L  GV +G+G  L + P++ ++  +F+++R +A G+A  GS +  C L
Sbjct:   13 VKAPDGGWGWAVLFG---CFVITG---FSYAFP-KAVSVFFKELIQEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCAL 163          
BLAST of slc16a-22 vs. Ensembl Celegans
Match: mct-3 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:Q93896])

HSP 1 Score: 126.331 bits (316), Expect = 8.090e-30
Identity = 82/237 (34.60%), Postives = 129/237 (54.43%), Query Frame = 2
Query:  398 QIEEYQRIAINKEVTRKQEQH---ISSVDDCWGWIVVFGSLICMVFVDGICFTYG--LHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFAS-SFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWV--QWNGSLVLLSALCCQSLVAIALFRPYELH----QRIKQMRKDYKR 1072
            Q +E      + E   K+ +    I+  D  +GW +V  S +  + VDG+ FT G  L   +V S F +S  S   +  S++SG Y    P+A+ L N FG R VA+ GS+   +    S S    Y+L+V  FG+ +G GFG+MYLPAI I++ +F +KR+VA GIA+CGSGIG+ + + L   + ++V   W   LV  +A+    L A  L RP +      +++ ++ +DY+ 
Sbjct:    7 QADEKAAAHQDPETVEKELEDAGFIAPPDGGYGWAIVAASFLLNMIVDGVIFTVGKILQPAWVHS-FGISEAS-AAMTMSILSGCYFFAGPIASVLCNVFGCRQVALAGSLIAALGFLLSISAPNIYVLYV-SFGLIAGAGFGMMYLPAIVIISQYFAKKRSVATGIAVCGSGIGTTVFALLNDVVWDFVGGDWKQFLVYTAAVTISGLGACILLRPLKPSKDQIEKVAKVLEDYEE 240          
BLAST of slc16a-22 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 122.094 bits (305), Expect = 4.237e-28
Identity = 59/184 (32.07%), Postives = 104/184 (56.52%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            D  +GW++VF + +  + VDGI   +    +  K  +  S   LT+  GSL+ G YL+  PL + L N +  R+V M G + + I+   +    +  +F+L +GV  G+GFG++YLPAI +V  +F+ KRA+A GI++ GSG+G+ ++  +    I  + W  ++ +L+ +    +    L+RP
Sbjct:   71 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESD-GLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRP 253          

HSP 2 Score: 66.2402 bits (160), Expect = 9.624e-11
Identity = 79/291 (27.15%), Postives = 145/291 (49.83%), Query Frame = 2
Query: 1880 KELDRPINRKDLYFTGS---LSQFLNN------RNPTLN-SRYLSLSNFKQNNLP--ACPYSCPTMNDSNKLDVE--YNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESI-VWTSRALFAL---GCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            KE  RP+NR+D+++ GS   L +F         R  TL+  R +      Q NL         P + +  +  +E   +D      P   R + +S++ D ++L++    +L +S++  M+GF++P  F+      ES+ +  S A+F +   G  N +GR+        GW L  Q+   A LT+  L      +L +    L  ++     A V+GF I+  + + S+++ +L G+E+LT +F  L++ +G+A+++GP  AGI+ D    +  S + AF F G++ L++
Sbjct:  406 KEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNA-LSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKD--LSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GW-LTDQKILSA-LTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYD----ITGSYDTAFYFGGLVLLVA 681          
BLAST of slc16a-22 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 119.783 bits (299), Expect = 1.641e-27
Identity = 59/187 (31.55%), Postives = 105/187 (56.15%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYEL 1033
            D  +GW++VF + +  + VDGI   +    +  K  +  S   LT+  GSL+ G YL+  PL + L N +  R+V M G + + I+   +    +  +F+L +GV  G+GFG++YLPAI +V  +F+ KRA+A GI++ GSG+G+ ++  +    I  + W  ++ +L+ +    +    L+RP  +
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESD-GLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPM 201          

HSP 2 Score: 65.855 bits (159), Expect = 1.044e-10
Identity = 79/291 (27.15%), Postives = 145/291 (49.83%), Query Frame = 2
Query: 1880 KELDRPINRKDLYFTGS---LSQFLNN------RNPTLN-SRYLSLSNFKQNNLP--ACPYSCPTMNDSNKLDVE--YNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESI-VWTSRALFAL---GCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            KE  RP+NR+D+++ GS   L +F         R  TL+  R +      Q NL         P + +  +  +E   +D      P   R + +S++ D ++L++    +L +S++  M+GF++P  F+      ES+ +  S A+F +   G  N +GR+        GW L  Q+   A LT+  L      +L +    L  ++     A V+GF I+  + + S+++ +L G+E+LT +F  L++ +G+A+++GP  AGI+ D    +  S + AF F G++ L++
Sbjct:  351 KEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNA-LSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKD--LSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GW-LTDQKILSA-LTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYD----ITGSYDTAFYFGGLVLLVA 626          
BLAST of slc16a-22 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 119.783 bits (299), Expect = 1.641e-27
Identity = 59/187 (31.55%), Postives = 105/187 (56.15%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYEL 1033
            D  +GW++VF + +  + VDGI   +    +  K  +  S   LT+  GSL+ G YL+  PL + L N +  R+V M G + + I+   +    +  +F+L +GV  G+GFG++YLPAI +V  +F+ KRA+A GI++ GSG+G+ ++  +    I  + W  ++ +L+ +    +    L+RP  +
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESD-GLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPM 201          

HSP 2 Score: 65.855 bits (159), Expect = 1.044e-10
Identity = 79/291 (27.15%), Postives = 145/291 (49.83%), Query Frame = 2
Query: 1880 KELDRPINRKDLYFTGS---LSQFLNN------RNPTLN-SRYLSLSNFKQNNLP--ACPYSCPTMNDSNKLDVE--YNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESI-VWTSRALFAL---GCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            KE  RP+NR+D+++ GS   L +F         R  TL+  R +      Q NL         P + +  +  +E   +D      P   R + +S++ D ++L++    +L +S++  M+GF++P  F+      ES+ +  S A+F +   G  N +GR+        GW L  Q+   A LT+  L      +L +    L  ++     A V+GF I+  + + S+++ +L G+E+LT +F  L++ +G+A+++GP  AGI+ D    +  S + AF F G++ L++
Sbjct:  351 KEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNA-LSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKD--LSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GW-LTDQKILSA-LTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYD----ITGSYDTAFYFGGLVLLVA 626          
BLAST of slc16a-22 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 119.783 bits (299), Expect = 1.641e-27
Identity = 59/187 (31.55%), Postives = 105/187 (56.15%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYEL 1033
            D  +GW++VF + +  + VDGI   +    +  K  +  S   LT+  GSL+ G YL+  PL + L N +  R+V M G + + I+   +    +  +F+L +GV  G+GFG++YLPAI +V  +F+ KRA+A GI++ GSG+G+ ++  +    I  + W  ++ +L+ +    +    L+RP  +
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESD-GLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPM 201          

HSP 2 Score: 65.855 bits (159), Expect = 1.044e-10
Identity = 79/291 (27.15%), Postives = 145/291 (49.83%), Query Frame = 2
Query: 1880 KELDRPINRKDLYFTGS---LSQFLNN------RNPTLN-SRYLSLSNFKQNNLP--ACPYSCPTMNDSNKLDVE--YNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESI-VWTSRALFAL---GCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            KE  RP+NR+D+++ GS   L +F         R  TL+  R +      Q NL         P + +  +  +E   +D      P   R + +S++ D ++L++    +L +S++  M+GF++P  F+      ES+ +  S A+F +   G  N +GR+        GW L  Q+   A LT+  L      +L +    L  ++     A V+GF I+  + + S+++ +L G+E+LT +F  L++ +G+A+++GP  AGI+ D    +  S + AF F G++ L++
Sbjct:  351 KEFQRPMNRQDIFYGGSIQNLKEFKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNA-LSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKD--LSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GW-LTDQKILSA-LTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYD----ITGSYDTAFYFGGLVLLVA 626          
BLAST of slc16a-22 vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0072593)

HSP 1 Score: 184.496 bits (467), Expect = 8.428e-48
Identity = 189/769 (24.58%), Postives = 338/769 (43.95%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSI----FTRIMEEKSRQRTVSTG-SLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDV---------EYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESIVWTSRALF--ALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLK 2731
            D  +GW++ F S +C + VDGI +T+G+  E   +YF     ++  + GSL+SG+YL   P+ + LAN +G R V + GSI   I+   S+F  +  + +  +G   G GFG++YLPA+  V ++F  KR++A GIA+CGSG G+   + L   L+E   W  +L++ + L     +  A+ RP    ++                                   KK++   +++ ++K + ++RGS     F   + + + +R +    + D  + + +N  + A Q    GL                       P   +  + E+ +  +   N   S   G S  G LS +S+A ++      N    E+ P        A  +N  +      +H ++  K GS    N        +E      +    +++         A  D  S K+SL       +   +     + RP++RKD++++GS++       P   S+  SL+N++ + L    Y   +M    KLD          EY+  P    P D   S ++ + D S+L+   F ++ +S+I  M G +VPF ++     +  I     A+    +G +N VGR+        GW     Q N   L    L  S++++ L P       +  I ++  +G  I+  +S+ S+++V+L G++ LT  F  L++F+G A +IG  LAG + D    + ++ +  F  +G LF IST ++ +   LK
Sbjct:   73 DGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWV-GSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMMRPLTYPKK-----------------------------------KKQKPLMQRMYEEKQLQLERGSFAGSHFMVQLPDGTIERKLKMPLNADPGVHSSLNLELLAQQAGGGGLH----------------------PVSTLPTITESKVVDVHRQNGAQSPPNGDS-NGQLSARSAAGAVGRRPHRNSES-ENSP---YHSQDAMTRNASQPAFLAGDHQSLP-KNGSVPAFNTRVRKTSASERFQPSLAAIRATSRGDL---EAGAGGDFASSKLSLSQRQGGSQTGSS---GRMVRPMSRKDIFYSGSVTNL-----PQYQSQK-SLANYRNSVLSLTKYE-KSMQSVAKLDPLAEAEKHREEYDLCPCLGIP-DSVKSVVNTMLDVSLLKDPVFMLIGVSNIFGMAGLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFC------GWVADLPQVNSLLLNNCCLLVSTIAVTLTPL--CYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYD----MTHTYDLPFYMAGALFGISTITSFLAPCLK 751          
BLAST of slc16a-22 vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0345005)

HSP 1 Score: 184.496 bits (467), Expect = 8.428e-48
Identity = 189/769 (24.58%), Postives = 338/769 (43.95%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSI----FTRIMEEKSRQRTVSTG-SLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDV---------EYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESIVWTSRALF--ALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLK 2731
            D  +GW++ F S +C + VDGI +T+G+  E   +YF     ++  + GSL+SG+YL   P+ + LAN +G R V + GSI   I+   S+F  +  + +  +G   G GFG++YLPA+  V ++F  KR++A GIA+CGSG G+   + L   L+E   W  +L++ + L     +  A+ RP    ++                                   KK++   +++ ++K + ++RGS     F   + + + +R +    + D  + + +N  + A Q    GL                       P   +  + E+ +  +   N   S   G S  G LS +S+A ++      N    E+ P        A  +N  +      +H ++  K GS    N        +E      +    +++         A  D  S K+SL       +   +     + RP++RKD++++GS++       P   S+  SL+N++ + L    Y   +M    KLD          EY+  P    P D   S ++ + D S+L+   F ++ +S+I  M G +VPF ++     +  I     A+    +G +N VGR+        GW     Q N   L    L  S++++ L P       +  I ++  +G  I+  +S+ S+++V+L G++ LT  F  L++F+G A +IG  LAG + D    + ++ +  F  +G LF IST ++ +   LK
Sbjct:   73 DGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWV-GSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMMRPLTYPKK-----------------------------------KKQKPLMQRMYEEKQLQLERGSFAGSHFMVQLPDGTIERKLKMPLNADPGVHSSLNLELLAQQAGGGGLH----------------------PVSTLPTITESKVVDVHRQNGAQSPPNGDS-NGQLSARSAAGAVGRRPHRNSES-ENSP---YHSQDAMTRNASQPAFLAGDHQSLP-KNGSVPAFNTRVRKTSASERFQPSLAAIRATSRGDL---EAGAGGDFASSKLSLSQRQGGSQTGSS---GRMVRPMSRKDIFYSGSVTNL-----PQYQSQK-SLANYRNSVLSLTKYE-KSMQSVAKLDPLAEAEKHREEYDLCPCLGIP-DSVKSVVNTMLDVSLLKDPVFMLIGVSNIFGMAGLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFC------GWVADLPQVNSLLLNNCCLLVSTIAVTLTPL--CYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYD----MTHTYDLPFYMAGALFGISTITSFLAPCLK 751          
BLAST of slc16a-22 vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0302166)

HSP 1 Score: 116.701 bits (291), Expect = 3.132e-26
Identity = 65/200 (32.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  422 AINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFR 1021
            +I+   T K+   +   D  +GW+VVF SL+  +  DG+ F++GL    +  YF  S  S T    SL   + L+  P+ + L + +G R + ++G + +      SSFC S  + ++ FG+ SG+G G+ Y+ A+  +A WF++KR  A GI   G+GIG+ + + L   LIE   W G+ ++L      + V  AL R
Sbjct:  119 SIDSSSTEKKTPKMP--DGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGES-TSKTAWISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMR 315          
BLAST of slc16a-22 vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0336659)

HSP 1 Score: 116.701 bits (291), Expect = 3.132e-26
Identity = 65/200 (32.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  422 AINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFR 1021
            +I+   T K+   +   D  +GW+VVF SL+  +  DG+ F++GL    +  YF  S  S T    SL   + L+  P+ + L + +G R + ++G + +      SSFC S  + ++ FG+ SG+G G+ Y+ A+  +A WF++KR  A GI   G+GIG+ + + L   LIE   W G+ ++L      + V  AL R
Sbjct:  119 SIDSSSTEKKTPKMP--DGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGES-TSKTAWISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMR 315          
BLAST of slc16a-22 vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0086140)

HSP 1 Score: 116.701 bits (291), Expect = 3.132e-26
Identity = 65/200 (32.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  422 AINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFR 1021
            +I+   T K+   +   D  +GW+VVF SL+  +  DG+ F++GL    +  YF  S  S T    SL   + L+  P+ + L + +G R + ++G + +      SSFC S  + ++ FG+ SG+G G+ Y+ A+  +A WF++KR  A GI   G+GIG+ + + L   LIE   W G+ ++L      + V  AL R
Sbjct:  119 SIDSSSTEKKTPKMP--DGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGES-TSKTAWISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMR 315          
BLAST of slc16a-22 vs. Ensembl Zebrafish
Match: slc16a12a (solute carrier family 16 member 12a [Source:ZFIN;Acc:ZDB-GENE-080721-24])

HSP 1 Score: 103.219 bits (256), Expect = 4.550e-22
Identity = 69/210 (32.86%), Postives = 108/210 (51.43%), Query Frame = 2
Query:  434 EVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKD 1063
            E+  K     ++ D  WGW++V G  +  V    +     +     + YF   + S T    SL+    ++ +PL + + N    R   M+G + ++  L  SS   S     L  GV +G+GF L Y PAIA+V  +F Q++A+A GIA+ GSGIG+ IL+  +  LIE+  W G+L++L+ L     V  AL RP +  QR +Q + D
Sbjct:   54 EMGEKNPCLATAPDGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEFQLYFSRDY-SATAWIHSLLDCTTMLCAPLGSYIGNRLSSRIAIMIGGLLSSTGLLLSSLATSVEFLYLTLGVLTGVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCVCGALMRPLQ-SQRGRQNKMD 261          
BLAST of slc16a-22 vs. Ensembl Zebrafish
Match: slc16a12b (solute carrier family 16 member 12b [Source:NCBI gene;Acc:449947])

HSP 1 Score: 91.2781 bits (225), Expect = 1.244e-18
Identity = 63/205 (30.73%), Postives = 98/205 (47.80%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGIC-----FTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR 1042
             K++  +   D  WGW++V G  +  V    +      F       + K Y      S T    SLV    ++ +PL + + N    R   ++G    ++ L  SSF  S        G+ +G+GF L Y PAIA+V  +F +++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L + 
Sbjct:   15 EKKKGGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFAKDY------SGTAWIHSLVDCTTMLCAPLGSLIGNQLSCRIAVILGGFLASVGLVLSSFATSLEYLYATLGLLTGLGFALCYTPAIAMVGIYFCERKALAYGIAMSGSGIGTFILAPVVQLLIEHYSWRGALLILGGFVLNLCVCGALLRPIILKEE 213          
BLAST of slc16a-22 vs. Ensembl Zebrafish
Match: slc16a9a (solute carrier family 16 member 9a [Source:ZFIN;Acc:ZDB-GENE-040426-1364])

HSP 1 Score: 88.1965 bits (217), Expect = 1.523e-17
Identity = 59/206 (28.64%), Postives = 100/206 (48.54%), Query Frame = 2
Query:  464 SSVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP-----YELHQRIKQMRKD 1063
            S++D  WGW++V  S +      G   + G L+ E++ ++       +T   GS+VSG+ LITSP+ +   + FG R V +   +     L  S+F  +    +  +G+  G+G GL+Y   + I   +F+++R +A+GI   G+ +G  I + L   LIE     G L+++ AL    +      RP     Y L QR    R +
Sbjct:    8 STLDGGWGWMIVVASFMAQFLSFGSPQSVGVLYPEWLSAF--QEGKGMTAWVGSMVSGVALITSPVCSACVDNFGARPVTIFSGVMVAGGLMLSAFAPNISFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSVGGFIYATLQNELIELFGLEGCLLIIGALALNLMACAGPMRPLNLPGYYLKQRAALQRTE 211          
BLAST of slc16a-22 vs. Ensembl Zebrafish
Match: si:dkey-246g23.4 (si:dkey-246g23.4 [Source:ZFIN;Acc:ZDB-GENE-050419-234])

HSP 1 Score: 87.4261 bits (215), Expect = 1.557e-17
Identity = 53/202 (26.24%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  470 VDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLIT----SPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLL-PS---LIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQ 1051
            +D  +GW +V  + +      G+  ++G+    +  YF     S T    S ++ I + T    +P+ + L+ YFG+R V M G + +++ +   SF +  +   +  G  +G G+ L + P + ++  +F+++R VA  +    S  G C+L+F+L PS   +++   W G++++L AL     V  AL RP   H   K 
Sbjct:   15 LDGGYGWFIVLSTFLVFGLTFGVIKSFGVFFVEIHHYF-----STTATASSWITSISVATVHIGAPVGSALSTYFGHRPVVMAGGLLSSVGMVLGSFAQDLLQLYITVGFLTGFGYALTWTPTVTMLGWYFDKRRPVANAL----SSTGECLLTFILTPSFQLMVDQFSWRGAMLILGALQLNLCVCGALLRPLSRHDYFKD 207          
BLAST of slc16a-22 vs. Ensembl Zebrafish
Match: BX511087.3 (solute carrier family 16 member 12a [Source:NCBI gene;Acc:557762])

HSP 1 Score: 87.0409 bits (214), Expect = 2.777e-17
Identity = 66/204 (32.35%), Postives = 105/204 (51.47%), Query Frame = 2
Query:  464 SSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRW 1075
            ++ D  WGW++V G  +  V    +     +     + YF   + S T    SL+    ++ +PL + + N    R   M+G + ++  L  SS   S     L  GV +G+GF L Y PAIA+V  +F Q++A+A GIA+ GSGIG+ IL+  +  LIE+  W G+L++L+ L        AL RP  L +  + M ++ K W
Sbjct:    9 TAPDGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEFQLYFSRDY-SATAWIHSLLDCTTMLCAPLGSYIGNRLSSRIAIMIGGLLSSTGLLLSSLATSVEFLYLTLGVLTGVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCFCGALMRP--LQKPSENMLRNGKGW 209          
BLAST of slc16a-22 vs. Ensembl Xenopus
Match: slc16a12 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:394932])

HSP 1 Score: 100.138 bits (248), Expect = 3.240e-22
Identity = 66/208 (31.73%), Postives = 106/208 (50.96%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPY-----ELHQRIKQ 1051
             K+  H +  D  WGW++V G     V    +     +     +SYF   + + T    S+V    ++ +P+ + ++N+F  +   ++G +  +  L  SSF  S     L  GV +G+GF L Y PAIA+V  +F +++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP       LH  +KQ
Sbjct:    4 EKRNLHKAPPDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDY-ARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPITLKEDSLHYPLKQ 210          
BLAST of slc16a-22 vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 95.9005 bits (237), Expect = 8.072e-20
Identity = 62/203 (30.54%), Postives = 105/203 (51.72%), Query Frame = 2
Query:  467 SVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKR 1072
            ++D  W W+VV  S +  + V G     G L+ E+++ +       LT    SL  GI LI  P+     N  G R  AM+G   T++    S++  +       FGV +GIG G++YLPA+  V H+F ++RA+A G++  G+G G+ +++ LL  L   + W  ++++  A+     V  AL RP + H   ++  KD++ 
Sbjct:   28 NIDRGWAWMVVLSSFLVHLLVMGSQMALGILNLEWLEEF--KQSRGLTAWISSLSMGITLIVGPIIGLFINTCGCRKTAMIGGFLTSLGWVLSAYAPNVHFLFFSFGVTAGIGSGMVYLPAVVTVGHYFQKRRALAQGLSTTGTGFGTFLITVLLKYLCRELGWRNAMIIQGAVTLNLCVCGALMRPLD-HD--EEHLKDHEE 225          
BLAST of slc16a-22 vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 87.0409 bits (214), Expect = 4.614e-17
Identity = 56/200 (28.00%), Postives = 100/200 (50.00%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPY---ELHQRIKQMRKD 1063
            D  WGW+VVFGS I + F         +  + ++  F  S+  +  +   +++ +Y    P+++ L N +G R V + G +  ++++ ++SFC S +   +C GV  G G      P++ I+  +F +KR +A G+A+ GS +    L+ L   L     W GS ++L  L     VA +L RP     + + I++  KD
Sbjct:   14 DGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMY-AGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPIGPKPVKKDIEKAPKD 212          
BLAST of slc16a-22 vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 86.6557 bits (213), Expect = 6.754e-17
Identity = 57/187 (30.48%), Postives = 96/187 (51.34%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLP---SLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            D  WGW+VV G+ I M F         +  + ++ +F  S+  +  +   L++ +Y    P+++ L N +G R V + G + + + +  ++F  S +   +  GV +G GF L   P++ +V  +F +KR +A G+A+ GS +   +LS L P    L +   W GS  +L AL     VA ALFRP
Sbjct:   15 DGGWGWMVVLGAFISMGFSYAFSKAITVFFKEIQEHFGASYSEIAWISSILLAAMY-AGGPVSSILVNRYGSRPVVIFGGLLSGVGMIIATFSSSILQLYIFIGVIAGFGFSLNLQPSVIVVGKYFLKKRPIANGLAMAGSPV---VLSTLAPLNQFLFDKFGWRGSFFILGALLLNCCVAGALFRP 197          
BLAST of slc16a-22 vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 82.8037 bits (203), Expect = 5.962e-16
Identity = 56/200 (28.00%), Postives = 100/200 (50.00%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPY---ELHQRIKQMRKD 1063
            D  WGW+VVFGS I + F         +  + ++  F  S+  +  +   +++ +Y    P+++ L N +G R V + G +  ++++ ++SFC S +   +C GV  G G      P++ I+  +F +KR +A G+A+ GS +    L+ L   L     W GS ++L  L     VA +L RP     + + I++  KD
Sbjct:   14 DGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMY-AGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPIGPKPVKKDIEKAPKD 212          
BLAST of slc16a-22 vs. Ensembl Mouse
Match: Slc16a12 (solute carrier family 16 (monocarboxylic acid transporters), member 12 [Source:MGI Symbol;Acc:MGI:2147716])

HSP 1 Score: 93.2041 bits (230), Expect = 3.061e-19
Identity = 62/203 (30.54%), Postives = 103/203 (50.74%), Query Frame = 2
Query:  464 SSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKR 1072
            S  D  WGW++V G  +  +    +     +     ++YF   + S T    S+V  + ++ +PL + ++N    +   M+G +  +      SF  S     L  GV +G+GF L Y PAIA+V  +F++++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L +      K++ R
Sbjct:   11 SPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDY-SQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPEKNHNR 212          
BLAST of slc16a-22 vs. Ensembl Mouse
Match: Slc16a14 (solute carrier family 16 (monocarboxylic acid transporters), member 14 [Source:MGI Symbol;Acc:MGI:1919031])

HSP 1 Score: 86.2705 bits (212), Expect = 6.830e-17
Identity = 61/209 (29.19%), Postives = 101/209 (48.33%), Query Frame = 2
Query:  407 EYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHIS--LTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            E  R A NK+  +        +D  W W++V  S    + + G     G L+ E+++ +    H S  LT    SL  GI LI  P      N  G R  A++G +  ++    S++  +     + FGV +G+G G+ YLPA+ +V  +F ++RA+A G++  G+G G+ +++ LL  L     W  ++ +  AL     V  AL RP
Sbjct:   13 EDDRKAKNKKTLKPHPD----IDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEF----HQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVQSLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMFIQGALSLNLCVCGALMRP 213          
BLAST of slc16a-22 vs. Ensembl Mouse
Match: Slc16a6 (solute carrier family 16 (monocarboxylic acid transporters), member 6 [Source:MGI Symbol;Acc:MGI:2144585])

HSP 1 Score: 84.3445 bits (207), Expect = 3.859e-16
Identity = 54/201 (26.87%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  428 NKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSH--ISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            N ++  +   +    D  WGW V        VF  GI  ++G+    +   F  S+  IS  I   S+   +   T+PL+  L+N FG+R V M G +  ++ +  +SF +      +  GV SG+G+   +LP + I++ +F+++R+V   +A  G        +  + +L E + W  SL+ +  L    +V  AL RP
Sbjct:   89 NSKLCARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSFGVFFNDLMDSFDESNSKISWII---SICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLGMITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAVFAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRP 286          
BLAST of slc16a-22 vs. Ensembl Mouse
Match: Slc16a6 (solute carrier family 16 (monocarboxylic acid transporters), member 6 [Source:MGI Symbol;Acc:MGI:2144585])

HSP 1 Score: 82.4185 bits (202), Expect = 1.033e-15
Identity = 54/201 (26.87%), Postives = 95/201 (47.26%), Query Frame = 2
Query:  428 NKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSH--ISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            N ++  +   +    D  WGW V        VF  GI  ++G+    +   F  S+  IS  I   S+   +   T+PL+  L+N FG+R V M G +  ++ +  +SF +      +  GV SG+G+   +LP + I++ +F+++R+V   +A  G        +  + +L E + W  SL+ +  L    +V  AL RP
Sbjct:    5 NSKLCARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSFGVFFNDLMDSFDESNSKISWII---SICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLGMITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAVFAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRP 202          
BLAST of slc16a-22 vs. Ensembl Mouse
Match: Slc16a3 (solute carrier family 16 (monocarboxylic acid transporters), member 3 [Source:MGI Symbol;Acc:MGI:1933438])

HSP 1 Score: 76.6406 bits (187), Expect = 7.262e-15
Identity = 66/211 (31.28%), Postives = 101/211 (47.87%), Query Frame = 2
Query:  425 INKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYF--LLSHISLTILPGSLVSGIYLI----TSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQ 1039
            +   V  +    I + D  WGW V+FG  I    + G  F+Y    + V  +F  L+    +     + +S I L     T PL +   N FG R V +VG +  ++ + A+SFCRS I   L  GV +G+G  L + P++ ++  +FN++R +A G+A  GS +  C LS L   L +   W G  ++L  L     V  AL RP    Q
Sbjct:    1 MGGAVVDEGPTGIKAPDGGWGWAVLFGCFI----ITG--FSYAFP-KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQIYLTTGVITGLGLALNFQPSLIMLNRYFNKRRPIANGLAAAGSPVFLCALSPLGQLLQDHYGWRGGFLILGGLLLNCCVCAALMRPLVAPQ 204          
BLAST of slc16a-22 vs. UniProt/SwissProt
Match: sp|Q6P2X9|MOT12_XENTR (Monocarboxylate transporter 12 OS=Xenopus tropicalis OX=8364 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.356e-20
Identity = 66/208 (31.73%), Postives = 106/208 (50.96%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPY-----ELHQRIKQ 1051
             K+  H +  D  WGW++V G     V    +     +     +SYF   + + T    S+V    ++ +P+ + ++N+F  +   ++G +  +  L  SSF  S     L  GV +G+GF L Y PAIA+V  +F +++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP       LH  +KQ
Sbjct:    4 EKRNLHKAPPDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDY-ARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPITLKEDSLHYPLKQ 210          
BLAST of slc16a-22 vs. UniProt/SwissProt
Match: sp|Q6ZSM3|MOT12_HUMAN (Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3)

HSP 1 Score: 97.8265 bits (242), Expect = 8.821e-20
Identity = 65/210 (30.95%), Postives = 108/210 (51.43%), Query Frame = 2
Query:  428 NKEVTRK------QEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQ 1039
             KE  RK      + +  S  D  WGW++V G  +  +    +     +     ++YF   + + T    S+V  + ++ +PL + ++N+   +   M+G +  +  L  SSF  S     L  GV +G+GF L Y PAIA+V  +F++++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L +
Sbjct:   23 GKEEKRKTMAKVNRARSTSPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDY-AQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKE 231          
BLAST of slc16a-22 vs. UniProt/SwissProt
Match: sp|Q6GM59|MOT12_XENLA (Monocarboxylate transporter 12 OS=Xenopus laevis OX=8355 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.766e-19
Identity = 63/199 (31.66%), Postives = 103/199 (51.76%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQ 1039
             K+  H +  D  WGW++V G     V    +     +     +SYF   + + T    S+V    ++ +P+ + ++N+F  +   ++G +  +  L  SSF  S     L  GV +G+GF L Y PAIA+V  +F +++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L +
Sbjct:    4 EKRSLHKTPPDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDY-ARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPISLKE 201          
BLAST of slc16a-22 vs. UniProt/SwissProt
Match: sp|D4A734|MOT12_RAT (Monocarboxylate transporter 12 OS=Rattus norvegicus OX=10116 GN=Slc16a12 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.385e-18
Identity = 63/203 (31.03%), Postives = 102/203 (50.25%), Query Frame = 2
Query:  464 SSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKR 1072
            S  D  WGW++V G  +  +    +     +     ++YF   + S T    S+V  + ++ +PL + ++N    +   M+G +  +  L   SF  S     L  GV +G+GF L Y PAIA+V  +F++++A A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L +      K + R
Sbjct:   11 SPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDY-SQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGLILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKAFAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDPSGPEKSHDR 212          
BLAST of slc16a-22 vs. UniProt/SwissProt
Match: sp|Q8BGC3|MOT12_MOUSE (Monocarboxylate transporter 12 OS=Mus musculus OX=10090 GN=Slc16a12 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.141e-18
Identity = 62/203 (30.54%), Postives = 103/203 (50.74%), Query Frame = 2
Query:  464 SSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKR 1072
            S  D  WGW++V G  +  +    +     +     ++YF   + S T    S+V  + ++ +PL + ++N    +   M+G +  +      SF  S     L  GV +G+GF L Y PAIA+V  +F++++A+A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L        V  AL RP  L +      K++ R
Sbjct:   11 SPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDY-SQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPEKNHNR 212          
BLAST of slc16a-22 vs. TrEMBL
Match: A0A0H3YFA4 (Slc16a-22 OS=Schmidtea mediterranea OX=79327 GN=slc16a-22 PE=2 SV=1)

HSP 1 Score: 1732.23 bits (4485), Expect = 0.000e+0
Identity = 917/917 (100.00%), Postives = 917/917 (100.00%), Query Frame = 2
Query:  116 MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLKSQFDSDIKXXXXXXXXXXXXGRDGXXXXXXXXXXXXXXXVMIPCE 2866
            MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVPFFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLKSQFDSDIKNNNNSMSFSVMSGRDGNMNTNYNPQTTQTTNVMIPCE
Sbjct:    1 MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVPFFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLKSQFDSDIKNNNNSMSFSVMSGRDGNMNTNYNPQTTQTTNVMIPCE 917          
BLAST of slc16a-22 vs. TrEMBL
Match: A0A0H3YK72 (Slc16a-18 OS=Schmidtea mediterranea OX=79327 GN=slc16a-18 PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 1.049e-112
Identity = 288/947 (30.41%), Postives = 468/947 (49.42%), Query Frame = 2
Query:  125 YAKTD---SISGVFMLTDSMKNTMEINDNFKTEI--NDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRA--EVKRGSCSSKEGSI--------------SIYDQ-IEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQM---RKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQK-RREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTL---TPNTDANSD-------------QISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRN-----PTLNSRY---------------LSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRA-------------------------SWISDIFDFSILRSCAFQMLTLSSIAMMLG--XXXXXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            YAK     +I+GV  L ++ +N     ++  TE+  N+ +    E N+ TT SEDLR   +E+ +    N S + + A    K     S  GS+              S Y Q I+ YQ   I  +    +   +   D  W W++V  S  CM+ +DG CF YGL    +   F  + I   + PGSL++G Y+   P+A+ L+N F +R VA+ G I + I++  SSF  + + F++ FGV  GIGF L+YLPAIAIV HWF++KR +A+G+AL GSG G+ +   L+P LIE V W G ++L++A+C Q LV I LFRP ELH R++Q+   R   ++   +  E+ + +   + E ++     ++++ R    +K K IVI RGSI  +I+EEK RQRTVS GSLDGM+IT+ N+L+  ++  ++    P +SM                    I+R+ E+ +K++ +    +++   + V   +  K+   + S   +NN+  +++    LV+EY+  Q               +S +V +T LIN     V  +  +++    +   +  + L   +PN  ++++             + S    + L    K  + A + KE+ RP N+K+L+FTGS+ Q  NN       P  N R+               L++ N    +L + P     +N+S  + +    + QN  P                              +++ ++ D S+L S  F ++ +SS+A M+G      F    +   D  +      +  +G +N  GRL AT+YIEK W+  Y  A+   +  F L  + V+   +P+    + +LV +L  +YG C+A  VS++S+LVVEL GV  LT  F FLLIFQGLAT+IGP LAG +CD   +  +  E  F F+G + ++S
Sbjct:   39 YAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDI--QAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSM------------------DAINRITESVVKRLENK---MNKHGPNGVVSIVDSKNGGINGSSNMTNNQ--LKNSLSQLVQEYINSQ---------------MSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLC-LYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICD---LKFHKYEYGFYFAGSMIILS 941          
BLAST of slc16a-22 vs. TrEMBL
Match: A0A183QXY0 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.120e-58
Identity = 123/329 (37.39%), Postives = 192/329 (58.36%), Query Frame = 2
Query:  374 EGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYV--KSYFLLS-----------HISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASS-FCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTAS 1318
            E + +I   I + +   IN++  R+      + +  WGW+V  GS +C+  VDG+CFT+GLH   +  +  F ++            ++L  LPG+L+ G+Y +  P  + L N FGYR VA VG++ T++    S+ F    + F++ FG+  GIG  L+YLPAI ++ HWF + RA  +GI +CG  +G+ +++ + P L     W GSL+L+S L  Q+LV IALFRP  +H+RI+ +R                +K+++++K +  +L   +K +    +K  I I+RGSI  RI+EEKSRQRT STGSLDGM+IT+ N+LV  S
Sbjct:  125 EPTRNIQSDIADKEGYEINEDFLRE-----PAPNGGWGWLVALGSFLCIFAVDGVCFTFGLHINEMIHEGQFRINPSDPNESQRKPSLALLSLPGALLCGMYFLFGPFTSALVNRFGYRIVASVGAVITSLCFLISALFIYDLVTFIVVFGIIGGIGCSLVYLPAITVIGHWFEEHRAFIVGIVMCGGCLGAGLMAIITPYLAVHFSWRGSLILISGLFSQTLVGIALFRPVSVHERIRAVR----------LLKQMAKKQIKQKKYKFNSLLSSRKPKHHPARK--ITIQRGSIMARIIEEKSRQRTTSTGSLDGMVITRENELVALS 436          
BLAST of slc16a-22 vs. TrEMBL
Match: A0A430QKF1 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0009599 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.882e-58
Identity = 124/327 (37.92%), Postives = 187/327 (57.19%), Query Frame = 2
Query:  386 SIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYV--KSYFLL-----------SHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASS-FCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMR--KDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTAS 1318
            +I   + + +   IN++  R+      + +  WGW+V  GS +C+  VDG+CFT+GLH   +  +  F +             ++L  LPG+L+ G+Y +  P    L N FGYR VA VG++ T++    S+ F    + F++ FG+  GIG  L+YLPAI ++ HWF + RA  +GI +CG  +G+ +++ + P L     W GSL+L+S L  Q+LV IALFRP  +H+RI+ +R  K+ ++  IQ  +             ++  L    K +   VKK  I I+RGSI  RI+EEKSRQRT STGSLDGM+IT+ N+LV  S
Sbjct:  129 NIRPHVSDKEGYEINEDFLRE-----PAPNGGWGWLVALGSFLCIFAVDGVCFTFGLHINEMIHEGQFRIDPSDSNESQRKPSLALLSLPGALLCGMYFLFGPFTGALVNRFGYRIVASVGAVITSLCFLISALFIYDLVTFIVVFGIIGGIGCSLVYLPAITVIGHWFEEHRAFIVGIVMCGGCLGAGLMAIITPHLAVHFSWRGSLILISGLFSQTLVGIALFRPVSVHERIRAIRSLKEVEKKQIQRKK------------CKLNCLLSSHKPKHHSVKK--IAIQRGSIMARIIEEKSRQRTTSTGSLDGMVITRENELVALS 436          
BLAST of slc16a-22 vs. TrEMBL
Match: A0A095C1L8 (Monocarboxylate transporter 7 OS=Schistosoma haematobium OX=6185 GN=MS3_03728 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 8.555e-58
Identity = 136/370 (36.76%), Postives = 203/370 (54.86%), Query Frame = 2
Query:  251 QLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYV--KSYFLLS-----------HISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASS-FCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTAS 1318
            QL+TNS+          +    N       A   R   S KEG          Y+   IN++  R+      + +  WGW+V  GS +C+  VDG+CFT+GLH   +  +  F +             ++L  LPG+L+ G+Y +  P    L N FGYR VA VG++ T++    S+ F    + F++ FG+  GIG  L+YLPAI ++ HWF + RA  +GI +CG  +G+ +++ + P L     W GSL+L+S L  Q+LV IALFRP  +H+RI+ +R       ++  E    +K+++++K ++  L    K +   VKK  I I+RGSI  RI+EEKSRQRT STGSLDGM+IT+ N+LV  S
Sbjct:   97 QLSTNSDHQFTQPSRTTDNPFENLKPPSDPARNIRPHVSDKEG----------YE---INEDFLRE-----PAPNGGWGWLVALGSFLCIFAVDGVCFTFGLHINEMIHEGQFRIDPSDSNESQRKPSLALLSLPGALLCGMYFLFGPFTGALVNRFGYRIVASVGAVITSLCFLISALFIYDLVTFIVVFGIIGGIGCSLVYLPAITVIGHWFEKHRAFIVGIVMCGGCLGAGLMAIITPHLAVHFSWRGSLILISGLFSQTLVGIALFRPVSVHERIRAIRS------LKEVE----KKQIKRKKCKLNCLLSSHKPKHHSVKK--IAIQRGSIMARIIEEKSRQRTTSTGSLDGMVITRENELVALS 436          
BLAST of slc16a-22 vs. Ensembl Cavefish
Match: slc16a12a (uncharacterized LOC103025054 [Source:NCBI gene;Acc:103025054])

HSP 1 Score: 106.301 bits (264), Expect = 6.119e-23
Identity = 69/205 (33.66%), Postives = 107/205 (52.20%), Query Frame = 2
Query:  446 KQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFL------LSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR 1042
            K+    ++ D  WGW++V G      F+  IC      C  V  +FL       S  S T    SLV    ++ +PL + + N F  R   MVG + +++ L  SSF  S     L  G+ +G+GF L Y PA+A+V  +F++++A+A GIA+ GSGIG+ +L+ ++  LIE   W G+L++L        V  AL RP   H++
Sbjct:    6 KRRSAAAAPDGGWGWMIVAG-----CFITTICTRAVTRC--VSIFFLEFQMHFSSDYSRTAWIHSLVDCTTMLCAPLGSYIGNRFSCRVAVMVGGLLSSLGLILSSFASSLEYLYLSLGILTGLGFALCYTPAVAMVGSYFSERKALAYGIAMSGSGIGTFVLAPVVQLLIELYSWRGALLILGGFASHLCVCGALMRPLNRHRQ 203          
BLAST of slc16a-22 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 101.293 bits (251), Expect = 6.332e-22
Identity = 66/205 (32.20%), Postives = 102/205 (49.76%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGIC-----FTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR 1042
            RK++  +   D  WGW++V G  +  V    +      F       + + Y      S T    SLV    ++ +PL + + N+   R   ++G    +I L  SSF  S     L  GV +G+GF L Y PAIA+V  +F +++++A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L  L     V  AL RP  L + 
Sbjct:    5 RKKKAGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDY------SGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEE 203          
BLAST of slc16a-22 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 99.7525 bits (247), Expect = 1.504e-21
Identity = 66/205 (32.20%), Postives = 102/205 (49.76%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGIC-----FTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR 1042
            RK++  +   D  WGW++V G  +  V    +      F       + + Y      S T    SLV    ++ +PL + + N+   R   ++G    +I L  SSF  S     L  GV +G+GF L Y PAIA+V  +F +++++A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L  L     V  AL RP  L + 
Sbjct:    5 RKKKAGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDY------SGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEE 203          
BLAST of slc16a-22 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 99.7525 bits (247), Expect = 1.865e-21
Identity = 66/204 (32.35%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGIC-----FTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQ 1039
            RK++  +   D  WGW++V G  +  V    +      F       + + Y      S T    SLV    ++ +PL + + N+   R   ++G    +I L  SSF  S     L  GV +G+GF L Y PAIA+V  +F +++++A GIA+ GSGIG+ IL+ ++  LIE   W G+L++L  L     V  AL RP  L +
Sbjct:    5 RKKKAGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDY------SGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKE 202          
BLAST of slc16a-22 vs. Ensembl Cavefish
Match: slc16a7 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103047734])

HSP 1 Score: 96.6709 bits (239), Expect = 2.508e-20
Identity = 58/184 (31.52%), Postives = 96/184 (52.17%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            D  WGW VVFGS I + F      +  ++ + ++ YF +S+  +  +   +++ +Y    P+++ L N +G R V MVG +   + + A+SF  + +   +C GV  GIG      PA+ I+  +F+ KR +A G+A+ GS +    L+ L   L +   W GS  +L A+     VA AL RP
Sbjct:   15 DGGWGWAVVFGSFISIGFSYAFPKSLTIYFKEIQEYFSISYSEIAWVSSIMLATMY-AGGPVSSILVNRYGSRPVVMVGGLLVGVGMVAASFGTTIMHLYICVGVIGGIGLAFNLQPALTIIGKYFHVKRPIANGLAMAGSPVFLSTLAPLNQFLFDTFGWQGSFFILGAIVLNCCVAGALMRP 197          
BLAST of slc16a-22 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 100.138 bits (248), Expect = 5.124e-22
Identity = 61/195 (31.28%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMR 1057
            D  WGW+VV    I  V    +     +     +S+F   + + T    S+V  + ++ +P+ + L+++FG R   M G + ++     +SF  S  +  +  GVF+G GF L Y P+I +V  +F ++RA+A G+A+ GSG+G+ +L+ L+  L++   W G+L+LL A      V  AL RP  L      MR
Sbjct:    7 DGGWGWMVVLACFIVNVCTRAVTRCISIFFMEFQSHFQKDYAT-TAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSSAGFIMASFATSIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALLRPIHLQYSCYAMR 200          
BLAST of slc16a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.690e-18
Identity = 58/197 (29.44%), Postives = 105/197 (53.30%), Query Frame = 2
Query:  449 QEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQ 1039
             E +  + D  WGW++V  + + +  V G+  + G+       YF  S  +++ +  S+   ++   SP+A+ L+N FG R V +VG I   I    +SF    +   L  G+ +G G+ +++ P+I+ ++ +F+++R++A+GIA  G G+ S   S L   L+E   W G+L++L+ L     V  AL RP  L +
Sbjct:    1 MEAYQQAPDGGWGWLIVLAAFVQVSLVFGVVRSVGVFFIEFTEYFQESSTAISWIT-SIALCVHQFASPIASTLSNQFGSRSVVIVGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALLRPIRLRE 196          
BLAST of slc16a-22 vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 86.2705 bits (212), Expect = 1.012e-17
Identity = 59/207 (28.50%), Postives = 96/207 (46.38%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAE 1093
            D  WGW VV G+ I + F         +  + ++  F  ++  +  +  S++  +     P+++ L N +G R + + G I     + A+SFC +      C GV  G+G      PA+ I+  +F +KR +A GI++ GS +G   ++ L   LI    W GS ++L+AL     VA +L RP       K  RK  K     N E
Sbjct:   15 DGGWGWAVVVGAFISIGFSYAFPKAITVFFKDIQEIFHTTYSEIAWI-SSIMLAVMYAGGPISSILVNKYGSRPIVIAGGILAGTGMIAASFCNTIFQLYFCIGVIGGLGLAFNLQPALTIIGKYFYKKRPIANGISMAGSPVGLSTIAPLNQVLINNFGWRGSFLILAALLFNCCVAGSLMRPVG-PTPAKDARKKGKEEVPNNLE 219          
BLAST of slc16a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009306.1 (pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 gene:ENSPMAG00000008418.1 transcript:ENSPMAT00000009306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 3.047e-16
Identity = 54/190 (28.42%), Postives = 87/190 (45.79%), Query Frame = 2
Query:  455 QHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            Q     D  WGW VV G+ I + F         +    ++  F  ++  +  +  S++  I     P+++ L N +G R V + G +     +  +SFC S +    C GV  G G  +   PA+ I+  +F +KR +A G+A+ GS +    L+ L   L+    W GS ++L  L     VA AL RP
Sbjct:    9 QACPPPDGGWGWAVVVGAFISIGFSYAFPKAITVFFSEIQEIFQTTYSEIAWI-SSIMLAIMYAGGPVSSILVNRYGSRPVVVAGGVLAGTGMVLASFCTSILQLYFCIGVIGGFGLAMNLQPALTIIGKYFYKKRPIANGLAMAGSPVMLSTLAPLNQLLLNNFGWRGSFMILGGLLLNCCVAGALMRP 197          
BLAST of slc16a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009308.1 (pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 gene:ENSPMAG00000008418.1 transcript:ENSPMAT00000009308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 7.861e-16
Identity = 54/190 (28.42%), Postives = 87/190 (45.79%), Query Frame = 2
Query:  455 QHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            Q     D  WGW VV G+ I + F         +    ++  F  ++  +  +  S++  I     P+++ L N +G R V + G +     +  +SFC S +    C GV  G G  +   PA+ I+  +F +KR +A G+A+ GS +    L+ L   L+    W GS ++L  L     VA AL RP
Sbjct:    9 QACPPPDGGWGWAVVVGAFISIGFSYAFPKAITVFFSEIQEIFQTTYSEIAWI-SSIMLAIMYAGGPVSSILVNRYGSRPVVVAGGVLAGTGMVLASFCTSILQLYFCIGVIGGFGLAMNLQPALTIIGKYFYKKRPIANGLAMAGSPVMLSTLAPLNQLLLNNFGWRGSFMILGGLLLNCCVAGALMRP 197          
BLAST of slc16a-22 vs. Ensembl Yeast
Match: MCH4 (Protein with similarity to mammalian monocarboxylate permeases; monocarboxylate permeases are involved in transport of monocarboxylic acids across the plasma membrane but mutant is not deficient in monocarboxylate transport [Source:SGD;Acc:S000005479])

HSP 1 Score: 71.633 bits (174), Expect = 2.880e-13
Identity = 59/198 (29.80%), Postives = 100/198 (50.51%), Query Frame = 2
Query:  488 WIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLAN-YF---GYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYK 1069
            W+VVFG+ + +V V G+  + G    Y+  + L +  S TI   S +  +YL  S L+  L+  YF   G   +   G++     LFA + C+S   F+L F V SG+G G++  P I  VA WF ++R +A  I+  G  IG  +   +L  L + V +  ++ +LS +C   L+  ++       +R K + + +K
Sbjct:   97 WLVVFGAFMGLVPVFGLINSLGAIESYISKHQLANISSSTI---SWIFSLYLAISFLSCILSGGYFDRNGSIGLMCTGTVIYAGGLFALANCKSVWQFILAFSVCSGLGTGILMTPLIGTVATWFLKRRGIATSISTMGGSIGGIVFPIMLRKLYKEVGFQWAIRILSFICLTCLICASVLA----RERTKPVVQPFK 287          
BLAST of slc16a-22 vs. Ensembl Yeast
Match: MCH2 (Protein with similarity to mammalian monocarboxylate permeases; monocarboxylate permeases are involved in transport of monocarboxylic acids across the plasma membrane but mutant is not deficient in monocarboxylate transport [Source:SGD;Acc:S000001704])

HSP 1 Score: 66.2402 bits (160), Expect = 1.204e-11
Identity = 41/153 (26.80%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  617 GSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIE--WVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYK 1069
            G L     L  +P+   L + F  +F+  +G +    +L  ++F  +     L  GV  G G   +++P++ ++  WF  KR++A GI   GSG+G  + +  + S+++   V+W    ++   + C SL  IAL      HQ ++Q ++ YK
Sbjct:   87 GGLAFSCGLFFAPVITWLYHIFSIQFIIGLGILFQGAALLLAAFSVTLWEIYLTQGVLIGFGLAFIFIPSVTLIPLWFRNKRSLASGIGTAGSGLGGIVFNLGMQSILQKRGVKWA---LIAQCIICTSLSTIALMLTRTTHQGLRQHKRSYK 236          
BLAST of slc16a-22 vs. Ensembl Yeast
Match: MCH5 (Plasma membrane riboflavin transporter; facilitates the uptake of vitamin B2; required for FAD-dependent processes; sequence similarity to mammalian monocarboxylate permeases, however mutants are not deficient in monocarboxylate transport [Source:SGD;Acc:S000005833])

HSP 1 Score: 63.929 bits (154), Expect = 6.233e-11
Identity = 57/253 (22.53%), Postives = 113/253 (44.66%), Query Frame = 2
Query:  212 EINDCQMGDIEQNQLTTNSE--DLRNLSKEVREFVLNNPSQMKSRAEVKRGS-----CSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYF---GYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLI 940
            + N  +  D++++ +  + E  DL +L         +  +++ ++ EV +G+         E + S +D  +E      N+E+    E    +      W+V FG  + ++   G+  + G+   +++   L S    TI  G L S    + S        YF   G+R + +VG++     LFA++    Y  F+L F +  G G G++  P +++ AH+F ++R  A+ +A  G  +G  +   +L S  
Sbjct:   17 QTNQLRQPDLDEDSIHYDPEADDLESLETTASYASTSVSAKVYTKKEVNKGTDIESQPHWGENTSSTHDSDKEEDS---NEEIESFPEGGFKA------WVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLSSESVSTI--GWLFSLFLFVCSASCIISGTYFDRNGFRTIMIVGTVFHVAGLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFFKRRGTALAMATIGGSVGGVVFPIMLRSFF 258          
BLAST of slc16a-22 vs. Ensembl Yeast
Match: ESBP6 (Protein with similarity to monocarboxylate permeases; appears not to be involved in transport of monocarboxylates such as lactate, pyruvate or acetate across the plasma membrane [Source:SGD;Acc:S000005069])

HSP 1 Score: 60.077 bits (144), Expect = 1.230e-9
Identity = 39/157 (24.84%), Postives = 69/157 (43.95%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGS------LVSGIYL----ITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCI 913
            D  +GW+V F   + M    G   ++G+   Y        +++    PG+      L++G+ +    + SPL   L    G R   + G      +   +SF        +  G   G    L+++PA  ++  WF +KRAVA+G++L G+G G  +
Sbjct:  208 DGGYGWVVTFCVFLTMFSTWGCNASFGVDLAY--------YLNHDTYPGASKYDYALIAGLTVFLGQLLSPLVMALMRIIGLRTTMLFGDAVMLAAYLLASFTTKLWQLYVTQGFMVGCSISLIFVPATTVLPGWFLKKRAVAMGVSLLGTGAGGVV 356          
BLAST of slc16a-22 vs. Ensembl Nematostella
Match: EDO49501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB3])

HSP 1 Score: 90.1225 bits (222), Expect = 1.216e-18
Identity = 79/267 (29.59%), Postives = 128/267 (47.94%), Query Frame = 2
Query:  344 EVKRGSCSSKEGSI---SIYDQIEEYQRIAINKEVT--RKQEQHISSVDD-CWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPG--SLVSG-------------------IYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKD 1063
            ++KR +  S EG++   +  D+    Q+   +   T  + +E  + SV D  W W++   +   +  V G  +T+G+    + + F  S    T L G  SL+                     IY +   L++ LA  FG R + +VG I T++ L  SSFC S       +G+  GIG  L YLPA+ +VA +F +KR++A GIA  G  IG+ IL+ L  +L+E + W   +  LSA     +V   LF+P    ++   M++D
Sbjct:    2 QIKRQARGSSEGTLLSSTCSDRSSLSQQSPYSNSSTQIKARESPVKSVKDRGWAWVICAAAFFDIFIVLGTLYTFGVLYVPLLAQFKASKAE-TGLDGRRSLLKSKLDLFRRLEAWVGSIGQFSIYFVCY-LSSLLAERFGCRKITIVGGIITSLGLLISSFCTSIKSMYFTYGILVGIGSSLSYLPALVMVAFYFEKKRSLATGIAAAGGNIGALILAPLQQTLVEHIGWRNCMRCLSAFSSLIIVCGLLFKPLPEREQKICMQED 266          
BLAST of slc16a-22 vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 70.8626 bits (172), Expect = 8.354e-13
Identity = 54/189 (28.57%), Postives = 95/189 (50.26%), Query Frame = 2
Query:  470 VDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISL----TILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            V+  WGWIV  G+ I    V GI  ++G+   YV    LL  + L    T   G++  G+  +  PL + L   +  +  A +G++ + + LF +SF +      L +G+  G+G  L ++ +I I+  +F ++ A+  GIA  GSG+GS +   ++  L+  + W   + +LS       +A  LF+P
Sbjct:    3 VEGGWGWIVCAGTFIVNFIVFGIHNSFGV--VYVN---LLDELKLGKAETAWIGAMAMGLNFLCGPLTSILCTRYSCQATAFIGALLSVLGLFLTSFVQEPPKMYLTYGLLFGVGSSLSFVSSIVILGEYFQKRLALVNGIATSGSGVGSLVTGPVMNYLLANIGWQNCMRVLSGFAMLLWIAAFLFKP 186          
BLAST of slc16a-22 vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 69.707 bits (169), Expect = 2.192e-12
Identity = 52/229 (22.71%), Postives = 103/229 (44.98%), Query Frame = 2
Query:  431 KEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPY------ELHQRIKQMRKDYKRWCIQNAEY 1096
            K +  K E  +   D  WGW+V   + I    V G    +G ++ E ++ + +    +  +  GS+  G+  +  PL   L    G R   +VG I         S   +  +  L +G+  G+G  + Y P++ I+  +FN++ ++A G+   GSG+GS  +  +L  +IE V    ++ + +A+    ++  A++RP             K    + K+ C++  ++
Sbjct:    6 KSLDEKPEPLVDYPDGGWGWLVCLAAFITQFIVLGTMNNFGVIYVELLQEFKVGKAEAAWV--GSITYGMMFLLGPLGTTLCKKIGCRLTTVVGCIIAAGGCLLGSVAPNIYIMDLTYGLMFGVGASMCYFPSVIILGTYFNKRLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPINTPFLNAAKYETKHQEANKKKGCLKFLDF 232          
BLAST of slc16a-22 vs. Ensembl Nematostella
Match: EDO46666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD0])

HSP 1 Score: 69.707 bits (169), Expect = 2.790e-12
Identity = 48/166 (28.92%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  485 GWIVVFGSLICMVFVDGICFTYG-LHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLS 979
            GW+V   +   M  V GI  +YG ++   V  +      S  I  GS+   +  +  P+A+ L + +G R VA +G I + + LF +SF ++     + +G+  G+G GL + P+I ++  +F ++  +A GIA  GSGIG  + +  +  L+    W  S+ +L+
Sbjct:   25 GWVVCAAAFFAMFTVFGIHISYGVIYANLVDEHGFGEAESAWI--GSVAGSLNFLCGPVASFLCDRYGCRSVAFIGGILSVLGLFLTSFVQNPGKMYVTYGLLWGVGSGLSFTPSIIVLGQYFRKRFPLANGIASSGSGIGGLLAAPFIQFLLSNFGWQNSMRILA 188          
BLAST of slc16a-22 vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 68.5514 bits (166), Expect = 6.763e-12
Identity = 51/192 (26.56%), Postives = 97/192 (50.52%), Query Frame = 2
Query:  467 SVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSA----LCCQSLVAIALFRPYE 1030
            S D  W W+V  GS + M  V GI  ++G+    + ++F  S  + T   GS+      + SP+ + +A  +G R V ++G +  ++ LF +S+  + ++  + +G+  G G  L    A+ I   +F++  ++A GI   G  IG+ +L+  L  L+E + W  ++ +L+     + C   V    +RP+E
Sbjct:   45 SKDRGWAWMVCAGSFLIMFIVYGIHTSFGVLLNALLNHFHESK-AKTAWVGSIGLNFLFLGSPVTSRVAERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDKHLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRILAMSGVFIACAGFV----YRPHE 231          
BLAST of slc16a-22 vs. Ensembl Medaka
Match: slc16a12a (monocarboxylate transporter 12-B-like [Source:NCBI gene;Acc:101175502])

HSP 1 Score: 96.6709 bits (239), Expect = 1.700e-20
Identity = 66/225 (29.33%), Postives = 112/225 (49.78%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGIC-----FTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYK--RWCIQNAEY 1096
            ++  +  ++ +  WGW+VV G  +  + +  +      F       + K Y      S T    SL+    ++ +PL + L N    R   M+G + ++  L  SSF  S     +  GV +G+GF L + PAIAIV  +F +++A+A GIAL GSGIG+ +L+  +  LIE   W G+L++L  +     V  AL RP E    +++ +   +   +C++  EY
Sbjct:   10 KRAPEGPNAPEGGWGWMVVAGCFLATICIRAVTRCVSMFFVEFQMHFEKDY------STTAWIHSLIDSTTMLCAPLGSFLGNRLSCRVTVMLGGLLSSAGLVLSSFASSVEFLYISLGVITGLGFALSFTPAIAIVGKYFVERKALAYGIALSGSGIGTFLLAPAVQLLIEHYSWRGALLILGGIVSNLCVCGALMRPLE-DMEVQKTKPSSRCQNFCLKTREY 227          
BLAST of slc16a-22 vs. Ensembl Medaka
Match: ENSORLT00000025268.2 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:101161384])

HSP 1 Score: 90.5077 bits (223), Expect = 2.075e-18
Identity = 65/203 (32.02%), Postives = 110/203 (54.19%), Query Frame = 2
Query:  443 RKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQ 1051
            +++   +S  D  WGW++V    +  V    +     +     + +F   + S T    SLV  I ++ +P+ + + N +  R   M+G + ++  L  SSF  S  L  L  GV +G+GF L Y PAIA+V  +F Q++A+A GIA+ GSGIG+ +L+ +L  LIE   W G+L+++SA+     V  AL RP  + ++ ++
Sbjct:    5 KQKSVGVSPPDGGWGWVIVGCCFMVTVCTRAVTRCISIFFVEFQGHFGAEY-SATAWIHSLVDCITMLCAPVGSLVGNRWSCRVAVMLGGVLSSCGLLLSSFSTSLELLYLTMGVLTGLGFALCYTPAIALVGCYFQQRKALAYGIAMSGSGIGTFVLAPVLQLLIELYSWRGALLIMSAVVANLCVCGALMRPITVQEQTEE 206          
BLAST of slc16a-22 vs. Ensembl Medaka
Match: slc16a7 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101167208])

HSP 1 Score: 88.1965 bits (217), Expect = 1.001e-17
Identity = 57/191 (29.84%), Postives = 99/191 (51.83%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRI 1045
            D  WGW VV  + I + F      +  ++ + ++ YF +S+  +  L   +++ +Y    P+++ L N +G R V M+G +  + ++  SSF  + I   LC GV  G G      PA+ I+  +F  KR +A G+A+ GS +   IL+ L   L +   W GS ++L ++     VA AL RP  +H+++
Sbjct:   15 DGGWGWAVVVAAFISIGFSYAFPKSLTIYFKEIQEYFSVSYSEIAWLSSVMLASMY-AGGPVSSILVNRYGSRPVVMLGGLMVSAAMVLSSFGTTIIHLYLCVGVIGGFGLAFNLQPALTIIGTYFQAKRPLANGLAMTGSPVFLSILAPLNQFLFDSYGWRGSFLILGSIVLNCCVAGALMRP--VHKQV 202          
BLAST of slc16a-22 vs. Ensembl Medaka
Match: slc16a6a (monocarboxylate transporter 7 [Source:NCBI gene;Acc:101155804])

HSP 1 Score: 86.6557 bits (213), Expect = 4.107e-17
Identity = 50/184 (27.17%), Postives = 94/184 (51.09%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            D  WGW+V     +  +F  G    +G+    +K+ F  S+  ++ +  S+   +     PLA+ + N FGY+FV M+G +       A+SF  S     + +G  +G+G+ L YLP + I++ +FN++R++ + +A  G  +    L+    ++ + + W  ++ L+ AL    +V  AL RP
Sbjct:   22 DGGWGWVVAVAFFLVEIFTYGTIKIFGIFLLDLKTEFKESNSRISWVV-SIAVFVMTFNGPLASVMTNRFGYQFVVMIGGLLICCGTIATSFASSINQIYITYGFVAGLGYCLTYLPTVTILSKYFNRRRSLVVAVASIGESLSLFALAPAYSAVRDKIGWRHTMTLIGALQSIVIVCGALLRP 204          
BLAST of slc16a-22 vs. Ensembl Medaka
Match: slc16a6a (monocarboxylate transporter 7 [Source:NCBI gene;Acc:101155804])

HSP 1 Score: 86.6557 bits (213), Expect = 4.107e-17
Identity = 50/184 (27.17%), Postives = 94/184 (51.09%), Query Frame = 2
Query:  473 DDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRP 1024
            D  WGW+V     +  +F  G    +G+    +K+ F  S+  ++ +  S+   +     PLA+ + N FGY+FV M+G +       A+SF  S     + +G  +G+G+ L YLP + I++ +FN++R++ + +A  G  +    L+    ++ + + W  ++ L+ AL    +V  AL RP
Sbjct:   22 DGGWGWVVAVAFFLVEIFTYGTIKIFGIFLLDLKTEFKESNSRISWVV-SIAVFVMTFNGPLASVMTNRFGYQFVVMIGGLLICCGTIATSFASSINQIYITYGFVAGLGYCLTYLPTVTILSKYFNRRRSLVVAVASIGESLSLFALAPAYSAVRDKIGWRHTMTLIGALQSIVIVCGALLRP 204          
BLAST of slc16a-22 vs. Planmine SMEST
Match: SMESG000077590.1 (SMESG000077590.1)

HSP 1 Score: 1731.07 bits (4482), Expect = 0.000e+0
Identity = 916/917 (99.89%), Postives = 917/917 (100.00%), Query Frame = 2
Query:  116 MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLKSQFDSDIKXXXXXXXXXXXXGRDGXXXXXXXXXXXXXXXVMIPCE 2866
            MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSL+SGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVPFFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLKSQFDSDIKNNNNSMSFSVMSGRDGNMNTNYNPQTTQTTNVMIPCE
Sbjct:    1 MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLLSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVPFFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLISTFSALILKKLKSQFDSDIKNNNNSMSFSVMSGRDGNMNTNYNPQTTQTTNVMIPCE 917          
BLAST of slc16a-22 vs. Planmine SMEST
Match: SMESG000077590.1 (SMESG000077590.1)

HSP 1 Score: 1541.94 bits (3991), Expect = 0.000e+0
Identity = 790/792 (99.75%), Postives = 791/792 (99.87%), Query Frame = 2
Query:  116 MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGXXXXXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIA 2491
            MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSL+SGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVPFFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCI 
Sbjct:    1 MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLLSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVPFFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIG 792          

HSP 2 Score: 68.9366 bits (167), Expect = 1.550e-11
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 1
Query: 2581 GSSYNNWSSAGGNIMRLFSCIAEFCRTCFLI 2673
            GSSYNNWSSAGGNIMRLFSCIAEFCRTCFLI
Sbjct:  792 GSSYNNWSSAGGNIMRLFSCIAEFCRTCFLI 822          
BLAST of slc16a-22 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 387.497 bits (994), Expect = 7.274e-118
Identity = 299/938 (31.88%), Postives = 460/938 (49.04%), Query Frame = 2
Query:  140 SISGVFMLTDSMKNTMEINDNFKTEI--NDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRA--EVKRGSCSSKEGSI--------------SIYDQ-IEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR----------IKQMRK---DYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTLTPNTDANSDQISFKVSLELPHDI------KKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRN-----PTLNSRY---------------LSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRA-------------------------SWISDIFDFSILRSCAFQMLTLSSIAMMLGXXX--XXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            +I+GV  L ++ +N     ++  TE+  N+ +    E N+ TT SEDLR   +E+ +    N S + + A    K     S  GS+              S Y Q I+ YQ   I  +    +   +   D  W W++V  S  CM+ +DG CF YGL    +   F  + I   + PGSL++G Y+   P+A+ L+N F +R VA+ G I + I++  SSF  + + F++ FGV  GIGF L+YLPAIAIV HWF++KR +A+G+AL GSG G+ +   L+P LIE V W G ++L++A+C Q LV I LFRP ELH R          I+QMR+   D+KR      E+ KE +  +K KK      +   R    +K K IVI RGSI  +I+EEK RQRTVS GSLDGM+IT+ N+L+  ++  ++    P +SM                    I+R+ E+ +K++ +    +++   + V   +  K+   + S   +NN+  +++    LV+EY+  Q               +S +V +T LIN     V  +               PQTL  N  + S +        L H +      K  + A + KE+ RP N+K+L+FTGS+ Q  NN       P  N R+               L++ N    +L + P     +N+S  + +    + QN  P                              +++ ++ D S+L S  F ++ +SS+A M+G FV   F    +   D  +      +  +G +N  GRL AT+YIEK W+  Y  A+   +  F L  + V+   +P+    + +LV +L  +YG C+A  VS++S+LVVEL GV  LT  F FLLIFQGLAT+IGP LAG +CD   +  +  E  F F+G + ++S
Sbjct:   47 NINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDI--QAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKR-----LEHEKEIEAEKKRKKAEKEELRNNNR----MKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSM------------------DAINRITESVVKRLENK---MNKHGPNGVVSIVDSKNGGINGSSNMTNNQ--LKNSLSQLVQEYINSQ---------------MSLQVWNTQLINNTNANVPTS---------------PQTLN-NIQSTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLC-LYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICD---LKFHKYEYGFYFAGAMIILS 915          
BLAST of slc16a-22 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 386.341 bits (991), Expect = 2.040e-117
Identity = 291/932 (31.22%), Postives = 464/932 (49.79%), Query Frame = 2
Query:  140 SISGVFMLTDSMKNTMEINDNFKTEI--NDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRA--EVKRGSCSSKEGSI--------------SIYDQ-IEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR----------IKQMRK---DYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTL---TPNTDANSD-------------QISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPTLNSRY----LSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRA-------------------------SWISDIFDFSILRSCAFQMLTLSSIAMMLG--XXXXXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            +I+GV  L ++ +N     ++  TE+  N+ +    E N+ TT SEDLR   +E+ +    N S + + A    K     S  GS+              S Y Q I+ YQ   I  +    +   +   D  W W++V  S  CM+ +DG CF YGL    +   F  + I   + PGSL++G Y+   P+A+ L+N F +R VA+ G I + I++  SSF  + + F++ FGV  GIGF L+YLPAIAIV HWF++KR +A+G+AL GSG G+ +   L+P LIE V W G ++L++A+C Q LV I LFRP ELH R          I+QMR+   D+KR      E+ KE +  +K KK      +   R    +K K IVI RGSI  +I+EEK RQRTVS GSLDGM+IT+ N+L+  ++  ++    P +SM                    I+R+ E+ +K++ +    +++   + V   +  K+   + S   +NN+  +++    LV+EY+  Q               +S +V +T LIN     V  +  +++    +   +  + L   +PN  ++++             + S    + L    K  + A + KE+ RP N+K+L+FTGS+ Q  NN     +++     L++ N    +L + P     +N+S  + +    + QN  P                              +++ ++ D S+L S  F ++ +SS+A M+G      F    +   D  +      +  +G +N  GRL AT+YIEK W+  Y  A+   +  F L  + V+   +P+    + +LV +L  +YG C+A  VS++S+LVVEL GV  LT  F FLLIFQGLAT+IGP LAG +CD   +  +  E  F F+G + ++S
Sbjct:   47 NINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDI--QAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKR-----LEHEKEIEAEKKRKKAEKEELRNNNR----MKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSM------------------DAINRITESVVKRLENK---MNKHGPNGVVSIVDSKNGGINGSSNMTNNQ--LKNSLSQLVQEYINSQ---------------MSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTEIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLC-LYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICD---LKFHKYEYGFYFAGAMIILS 925          
BLAST of slc16a-22 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 384.415 bits (986), Expect = 1.627e-116
Identity = 294/948 (31.01%), Postives = 465/948 (49.05%), Query Frame = 2
Query:  140 SISGVFMLTDSMKNTMEINDNFKTEI--NDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRA--EVKRGSCSSKEGSI--------------SIYDQ-IEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQR----------IKQMRK---DYKRWCIQNAEYXXXXXXXXXXXXXXXALKKEQKRREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELXXXXXXXXXXXNKPQTL---TPNTDANSD-------------QISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRN-----PTLNSRY---------------LSLSNFKQNNLPACPYSCPTMNDSNKLDVEYNDLPQNNFPSDKRA-------------------------SWISDIFDFSILRSCAFQMLTLSSIAMMLG--XXXXXXXXXXXXCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 2698
            +I+GV  L ++ +N     ++  TE+  N+ +    E N+ TT SEDLR   +E+ +    N S + + A    K     S  GS+              S Y Q I+ YQ   I  +    +   +   D  W W++V  S  CM+ +DG CF YGL    +   F  + I   + PGSL++G Y+   P+A+ L+N F +R VA+ G I + I++  SSF  + + F++ FGV  GIGF L+YLPAIAIV HWF++KR +A+G+AL GSG G+ +   L+P LIE V W G ++L++A+C Q LV I LFRP ELH R          I+QMR+   D+KR      E+ KE +  +K KK      +   R    +K K IVI RGSI  +I+EEK RQRTVS GSLDGM+IT+ N+L+  ++  ++    P +SM                    I+R+ E+ +K++ +    +++   + V   +  K+   + S   +NN+  +++    LV+EY+  Q               +S +V +T LIN     V  +  +++    +   +  + L   +PN  ++++             + S    + L    K  + A + KE+ RP N+K+L+FTGS+ Q  NN       P  N R+               L++ N    +L + P     +N+S  + +    + QN  P                              +++ ++ D S+L S  F ++ +SS+A M+G      F    +   D  +      +  +G +N  GRL AT+YIEK W+  Y  A+   +  F L  + V+   +P+    + +LV +L  +YG C+A  VS++S+LVVEL GV  LT  F FLLIFQGLAT+IGP LAG +CD   +  +  E  F F+G + ++S
Sbjct:   47 NINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDI--QAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKR-----LEHEKEIEAEKKRKKAEKEELRNNNR----MKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSM------------------DAINRITESVVKRLENK---MNKHGPNGVVSIVDSKNGGINGSSNMTNNQ--LKNSLSQLVQEYINSQ---------------MSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLC-LYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICD---LKFHKYEYGFYFAGAMIILS 941          
The following BLAST results are available for this feature:
BLAST of slc16a-22 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A121.837e-2030.95solute carrier family 16 member 12 [Source:HGNC Sy... [more]
SLC16A141.336e-1628.43solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A141.400e-1628.43solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A142.615e-1628.43solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A33.406e-1631.65solute carrier family 16 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mct-38.090e-3034.60MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.237e-2832.07MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.641e-2731.55MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.641e-2731.55MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.641e-2731.55MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG139078.428e-4824.58gene:FBgn0035173 transcript:FBtr0072593[more]
CG139078.428e-4824.58gene:FBgn0035173 transcript:FBtr0345005[more]
chk3.132e-2632.50gene:FBgn0033095 transcript:FBtr0302166[more]
chk3.132e-2632.50gene:FBgn0033095 transcript:FBtr0336659[more]
chk3.132e-2632.50gene:FBgn0033095 transcript:FBtr0086140[more]
back to top
BLAST of slc16a-22 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a4.550e-2232.86solute carrier family 16 member 12a [Source:ZFIN;A... [more]
slc16a12b1.244e-1830.73solute carrier family 16 member 12b [Source:NCBI g... [more]
slc16a9a1.523e-1728.64solute carrier family 16 member 9a [Source:ZFIN;Ac... [more]
si:dkey-246g23.41.557e-1726.24si:dkey-246g23.4 [Source:ZFIN;Acc:ZDB-GENE-050419-... [more]
BX511087.32.777e-1732.35solute carrier family 16 member 12a [Source:NCBI g... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a123.240e-2231.73solute carrier family 16 member 12 [Source:NCBI ge... [more]
atf6b8.072e-2030.54activating transcription factor 6 beta [Source:Xen... [more]
slc16a74.614e-1728.00solute carrier family 16 member 7 [Source:NCBI gen... [more]
mad2l16.754e-1730.48mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
slc16a75.962e-1628.00solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a123.061e-1930.54solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a146.830e-1729.19solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a63.859e-1626.87solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a61.033e-1526.87solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a37.262e-1531.28solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of slc16a-22 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P2X9|MOT12_XENTR2.356e-2031.73Monocarboxylate transporter 12 OS=Xenopus tropical... [more]
sp|Q6ZSM3|MOT12_HUMAN8.821e-2030.95Monocarboxylate transporter 12 OS=Homo sapiens OX=... [more]
sp|Q6GM59|MOT12_XENLA2.766e-1931.66Monocarboxylate transporter 12 OS=Xenopus laevis O... [more]
sp|D4A734|MOT12_RAT1.385e-1831.03Monocarboxylate transporter 12 OS=Rattus norvegicu... [more]
sp|Q8BGC3|MOT12_MOUSE2.141e-1830.54Monocarboxylate transporter 12 OS=Mus musculus OX=... [more]
back to top
BLAST of slc16a-22 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFA40.000e+0100.00Slc16a-22 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YK721.049e-11230.41Slc16a-18 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A183QXY01.120e-5837.39Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A430QKF11.882e-5837.92Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A095C1L88.555e-5836.76Monocarboxylate transporter 7 OS=Schistosoma haema... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a6.119e-2333.66uncharacterized LOC103025054 [Source:NCBI gene;Acc... [more]
slc16a12b6.332e-2232.20solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12b1.504e-2132.20solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12b1.865e-2132.35solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a72.508e-2031.52monocarboxylate transporter 2-like [Source:NCBI ge... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A125.124e-2231.28solute carrier family 16 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000001631.11.690e-1829.44pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
zgc:1655071.012e-1728.50solute carrier family 16 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000009306.13.047e-1628.42pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 ... [more]
ENSPMAT00000009308.17.861e-1628.42pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 ... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MCH42.880e-1329.80Protein with similarity to mammalian monocarboxyla... [more]
MCH21.204e-1126.80Protein with similarity to mammalian monocarboxyla... [more]
MCH56.233e-1122.53Plasma membrane riboflavin transporter; facilitate... [more]
ESBP61.230e-924.84Protein with similarity to monocarboxylate permeas... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495011.216e-1829.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467098.354e-1328.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352382.192e-1222.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466662.790e-1228.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462076.763e-1226.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-22 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a1.700e-2029.33monocarboxylate transporter 12-B-like [Source:NCBI... [more]
ENSORLT00000025268.22.075e-1832.02solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a71.001e-1729.84monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
slc16a6a4.107e-1727.17monocarboxylate transporter 7 [Source:NCBI gene;Ac... [more]
slc16a6a4.107e-1727.17monocarboxylate transporter 7 [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc16a-22 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077590.10.000e+099.89SMESG000077590.1[more]
SMESG000077590.11.550e-1199.75SMESG000077590.1[more]
SMESG000003109.17.274e-11831.88SMESG000003109.1[more]
SMESG000003109.12.040e-11731.22SMESG000003109.1[more]
SMESG000003109.11.627e-11631.01SMESG000003109.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000950
GenBankAKN21517.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000950 ID=SMED30000950|Name=slc16a-22|organism=Schmidtea mediterranea sexual|type=transcript|length=3050bp
GTAATTTAATTTTACAATTTGTGTTTTGTAATTTTTCGCCTTATTTTTTG
GTATATTTATTTATAATGGATTACTTAACTGGGTGAATTTAGTTTCATTT
ATAGTTAATGTATGAATGGCCTATTATGCAAAAACTGATTCCATAAGTGG
CGTTTTTATGCTTACAGATTCTATGAAAAATACAATGGAAATAAATGATA
ATTTTAAGACAGAGATCAATGATTGCCAAATGGGAGATATCGAGCAAAAT
CAATTAACTACAAATAGTGAAGACTTGCGTAATTTATCCAAAGAAGTCCG
TGAATTTGTTCTTAACAATCCGAGTCAAATGAAATCAAGGGCTGAAGTTA
AAAGAGGTTCTTGTTCTTCTAAAGAGGGTTCCATTTCAATATATGATCAA
ATTGAGGAATATCAAAGAATCGCCATTAATAAAGAAGTTACAAGAAAACA
AGAACAACACATTTCGTCTGTGGACGATTGTTGGGGTTGGATAGTTGTTT
TTGGTTCATTAATCTGTATGGTATTTGTCGACGGGATTTGTTTTACATAC
GGTCTCCATTGTGAATACGTCAAATCTTATTTTCTACTGTCGCACATCTC
TTTGACTATTTTACCTGGTAGTCTTGTCTCAGGAATTTATCTTATCACAA
GTCCTCTGGCTAATCCACTTGCAAATTATTTTGGATATCGGTTTGTAGCG
ATGGTCGGTAGCATTTGCACAACTATTTCATTGTTTGCTAGCTCGTTCTG
CAGATCATACATTCTATTTGTTTTATGCTTTGGAGTGTTTAGTGGCATTG
GTTTTGGACTTATGTATTTGCCGGCTATTGCTATTGTGGCTCATTGGTTC
AATCAAAAACGAGCAGTGGCTATTGGAATAGCTCTATGTGGTAGTGGTAT
TGGTTCTTGTATTTTGAGTTTTTTGCTGCCGTCGCTTATTGAGTGGGTTC
AATGGAATGGTTCCTTAGTGTTATTATCTGCTCTTTGCTGTCAATCTTTG
GTTGCTATCGCATTGTTCAGACCCTATGAATTACATCAACGTATCAAACA
GATGAGAAAAGATTATAAAAGATGGTGTATTCAAAATGCCGAATACATTA
AAGAGCAAAAACGTCTACAGAAAGAGAAAAAACAGATAATTGCTTTAAAA
AAGGAACAAAAACGCCGAGAGAAATTAGTAAAAAAGAAACCAATTGTTAT
TAAGAGGGGGTCTATATTTACTCGTATAATGGAAGAAAAATCTCGTCAAA
GAACAGTATCCACTGGAAGTTTAGATGGAATGATGATCACACAAATGAAT
CAATTAGTGACTGCATCCCAGGTTGATATGAATGGACTACTGCTACCTCA
AATGAGTATGATCAACGACCAAACGGAGAGCATGACATCATTGGCAACGG
CTCTTTTGCCATCATATGTTATTGATAGAGTAATCGAAACAACTCTTAAA
AAGATCAGATCGTCTAATCGAAACATTTCTAGAAAAAAGGGATCTAGTGT
TTGTGGAACACTTTCAAAGAAATCATCCGCAAATTCAATTTCTGAAATGT
TTTCAAATAACGAAAATCCAATTGAGGATATACCTATATCTCTCGTTAAG
GAGTATGTTGCCAGACAAAAAAATATTGGTAGAGATGAAAATTCTGATTC
TAATCACTTGGCAATTTCTTTCAAGGTTGGATCAACAACTCTTATAAATG
AAGTCACGGATTGTGTAAAATGCAATGAATTATCGGTTAGTCAGTCTTCC
TTCAGTTCTCAGTCCAATAAACCTCAAACATTGACGCCAAATACTGACGC
CAATTCAGATCAAATATCTTTTAAAGTGTCATTAGAATTACCTCATGATA
TCAAAAAGTTTGTCCATGCCGAAATTTTGAAAGAACTCGATCGTCCTATA
AACAGAAAAGACTTATATTTCACTGGATCATTGTCTCAATTTCTAAATAA
CAGAAATCCTACTCTGAATAGTCGTTACCTCTCTTTAAGTAATTTTAAAC
AAAATAACCTTCCAGCTTGTCCTTATAGCTGTCCAACAATGAATGACTCA
AATAAATTGGATGTCGAGTATAATGATTTACCTCAAAATAATTTTCCTTC
AGATAAACGGGCAAGTTGGATATCAGATATTTTTGATTTCAGTATTTTGA
GGAGTTGTGCTTTTCAGATGTTGACTTTATCAAGTATTGCAATGATGTTG
GGATTTTTTGTTCCGTTTTTTTTTGTACCACTTTTGCTGTGTGATGAATC
AATTGTTTGGACATCTCGAGCATTGTTTGCTTTGGGTTGTTCAAATATCG
TTGGAAGATTAGTAGCAACATTGTATATCGAAAAAGGCTGGGCTTTAAAA
TATCAACAAGCCAATGGTGCTAATTTGACAGTTTTTTTTCTTGGGTTCTC
AAGTGTGTCAATATTGTTGATGCCTTATTTTCGATTAATTCATGTCAGTT
TGGTTATTATTCTGGCTTTTGTCTATGGATTTTGTATAGCTATGATTGTA
TCAATTCGCAGTATGCTTGTTGTTGAGCTTTTTGGAGTAGAAAGTTTAAC
GAAAACCTTTACTTTTCTCCTAATATTTCAGGGTCTAGCTACAATAATTG
GTCCAGTGCTGGCGGGAATATTATGCGATTATTTTCCTGTATTGCTGAAT
TCTGCAGAACCTGCTTTCTTATTTAGTGGAATTTTGTTTTTGATATCTAC
TTTCAGTGCTCTAATTTTGAAAAAACTTAAATCACAATTCGACTCAGATA
TTAAAAATAATAACAACTCAATGTCTTTTTCAGTCATGTCGGGACGTGAT
GGAAATATGAATACTAATTATAATCCGCAAACTACGCAAACCACCAACGT
TATGATACCATGTGAATAAATGTGTTTATAAATCATTTGAGGTAGATTGT
ATAGATTCATTTTTGTATGGATTTATCATCATTTCCTAACACGCAACTGT
CAGTATTTATTTGTAAATTATCACTATTCCTTTGTCAGTGTATACTTTAT
TTATAACTCAAACTTATTTTTAATAAAGAATTTTTATTTTTTAAAAAAAA
back to top

protein sequence of SMED30000950-orf-1

>SMED30000950-orf-1 ID=SMED30000950-orf-1|Name=SMED30000950-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=918bp
MAYYAKTDSISGVFMLTDSMKNTMEINDNFKTEINDCQMGDIEQNQLTTN
SEDLRNLSKEVREFVLNNPSQMKSRAEVKRGSCSSKEGSISIYDQIEEYQ
RIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCE
YVKSYFLLSHISLTILPGSLVSGIYLITSPLANPLANYFGYRFVAMVGSI
CTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRA
VAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIAL
FRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQKR
REKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTA
SQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSS
NRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVAR
QKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQS
NKPQTLTPNTDANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDL
YFTGSLSQFLNNRNPTLNSRYLSLSNFKQNNLPACPYSCPTMNDSNKLDV
EYNDLPQNNFPSDKRASWISDIFDFSILRSCAFQMLTLSSIAMMLGFFVP
FFFVPLLLCDESIVWTSRALFALGCSNIVGRLVATLYIEKGWALKYQQAN
GANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSM
LVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPA
FLFSGILFLISTFSALILKKLKSQFDSDIKNNNNSMSFSVMSGRDGNMNT
NYNPQTTQTTNVMIPCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0016891endoribonuclease activity, producing 5'-phosphomonoesters
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000087proximal tubule
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005034Dicer_dimerisation_dom
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 327..351
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 99..345
e-value: 3.9E-21
score: 77.0
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 672..875
e-value: 7.6E-9
score: 37.1
NoneNo IPR availablePANTHERPTHR11360:SF168GH22266Pcoord: 114..870
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 114..870
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 124..302
e-value: 1.42381E-46
score: 168.885
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 723..868
e-value: 1.48735E-19
score: 89.1488
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 780..802
NoneNo IPR availableTMHMMTMhelixcoord: 712..734
NoneNo IPR availableTMHMMTMhelixcoord: 155..177
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 282..304
NoneNo IPR availableTMHMMTMhelixcoord: 851..868
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 814..836
NoneNo IPR availableTMHMMTMhelixcoord: 754..776
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
NoneNo IPR availableTMHMMTMhelixcoord: 686..708
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 140..343
e-value: 4.1E-20
score: 72.0
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 125..872