Calpain-B

Overview
NameCalpain-B
Smed IDSMED30000946
Length (bp)2590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain-B (SMED30000946) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain-B (SMED30000946) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calpain-B (SMED30000946) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calpain-B (SMED30000946) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000946

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000946SMESG000067761.1 dd_Smed_v4_4020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000946SMESG000067761.1 dd_Smed_v4_4020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000946SMESG000067761.1 dd_Smed_v4_4020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000946SMESG000067761.1 dd_Smed_v6_4020_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000946SMESG000067761.1 dd_Smed_v4_4020_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000946SMESG000067761.1 dd_Smed_v4_4020_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN9 (calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 292/638 (45.77%), Postives = 417/638 (65.36%), Query Frame = 1
Query:  403 FYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFK-RENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            F   ++    + +LFED  FPA+N+SL+Y E P     WKRP E+ +N  FI  G +R D+ QGELGDCWLLAA++SL++    + +VIP DQ F   Y G F F+ WQ   W DVV+DDRLPT R RLV+LHS D NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+ E F     AP N ++I+ K + R SL+GC I+     + EA+   GLIKGHAYS+T +  V+ +  R+ L+R+RNPWG   EW G++SD SPEW  +   E+KRL  T  DDGEFWM F+DF  +F K+EIC+L+P++ LE  A     KWE+ +  G W +  +AGGCRNF++TF  NPQ K+ + + DE   E   + ++ LMQK+ R  ++ G ++ TIGYAIY+  D       L+K +F+  AS A+S TFINLREV  R KLP G+Y+++PSTF   +EA F LRIFSE+   ++ +D   +I   D  +   P    +E     + +  F+ ++G D E+ A+EL+ +L+   + +++ KF   S  +C++++++MDT  +G+L F+EFKV WD L+ W  +F +FD D+SGT ++YE+R AL   GF++S+ +   I+ RYA+++  + FDD++
Sbjct:   29 FEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQT-KEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWGQ-VEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDA-LEEDA---IHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEE--CSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDK---DEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDI---DLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFL 652          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 299/669 (44.69%), Postives = 436/669 (65.17%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIP-PEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            K  L+ DP FP + TSL+Y +  P +  WKRP E+ +N  FI DG +R D+ QGELGDCW LAA++ L++   L+ +VIP DQ F  +Y G F F+ W++G W DVV+DD LPT   +LV+  S   NEFWSALLEKAYAK+ GSYEALKGG+++EAMEDFTGG+ E F++   AP +++ IM K + R SLMGCSI+   P + E +   GL++GHAYS+T +  V  K  +V LVR+RNPWG   EW G++SD+  +W+ +   E+ RL     +DGEFWM+++DF+ +FTKLEIC+L+ ++   +K       W + +  G W +  SAGGCRNF +TF  NPQ+++K+++ D++ +++    + ++ LMQK  R  RK G  LFTIG+AIY++ K+   +K  L K +F   AS A+S T+IN+REV  R +LP  +YVIVPST+   +E +F+LR+FSE+   S++++    +  P     +P P    +E     + +N FK I+G D EI ADEL+++L+ V  K ++ K +GF+ E+CRSM+A+MDTD SG+L  +EF  LW+ ++ W+ +FK +D DQSGT NSYE+R A+N  GF ++N+++  I  RYA+K   I FD +I   VRL  +F  F A  K   G       E++Q  +Y
Sbjct:   71 KKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQ-VEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKL----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRP-----VPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 728          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 290/671 (43.22%), Postives = 425/671 (63.34%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEI-------------------------------------VAPDWKKEIP---PEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            K  L+ DP FP + TSL+Y +  P +  WKRP E+ +N  FI DG +R D+ QGELGDCW LAA++ L++   L+ +VIP DQ F  +Y G F F+ W++G W DVV+DD LPT   +LV+  S   NEFWSALLEKAYAK+ GSYEALKGG+++EAMEDFTGG+ E F++   AP +++ IM K + R SLMGCSI+   P + E +   GL++GHAYS+T +  V  K  +V LVR+RNPWG   EW G++SD+  +W+ +   E+ RL     +DGEFWM+++DF+ +FTKLEIC+L+ ++   +K       W + +  G W +  SAGGCRNF +TF  NPQ+++K+++ D++ +++    + ++ LMQK  R  RK G  LFTIG+AIY++ K+   +K  L K +F   AS A+S T+IN+REV  R +LP  +YVIVPST+   +E +F+LR+FSE+   S++++    +                                      +PD +K+ P   P    +E     + +N FK I+G D EI ADEL+++L+ V  K ++ K +GF+ E+CRSM+A+MDTD SG+L  +EF  LW+ ++ W+ +FK +D DQSGT NSYE+R A+N  GF ++N+++  I  RYA+K   I FD +I
Sbjct:   71 KKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQ-VEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKL----QTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFI 735          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN1 (calpain 1 [Source:HGNC Symbol;Acc:HGNC:1476])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 291/649 (44.84%), Postives = 425/649 (65.49%), Query Frame = 1
Query:  406 YNQKRMLKAKN-SLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPT-KVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKV---VDPDE-NDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSL--LDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            Y Q R+   ++ +LF D  FP    SL Y++  P       I+WKRP E+  N  FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F   Y G F F+LWQFG W DVVVDD LP   G+LV++HS + NEFWSALLEKAYAKV GSYEAL GGS+SE  EDFTGG+TE ++L   AP +L+ I++K + R SL+GCSI+      +EA   K L+KGHAYS+T  K VN +   V+L+R+RNPWG   EWTGA+SD S EWN +   ER +L +  E DGEFWM+F+DF++ FT+LEIC+L+P++ L+++      KW   +  G W++  +AGGCRN+  TF +NPQFK+++    DPD+  D E+  + ++ LMQK  R  R+ G+D+ TIG+A+Y++      +    L + +F   AS A+S  FINLREV  R +LP G+YV+VPSTF   +E  F+LR FSE+   + ++D++ +   PD       +V  EE+ +    +  F+ ++G D EI   EL+ IL+ +  K ++ +  GFS E+CRSMV +MD D +G+LG  EF +LW+ +R + ++F+KFD D+SG+ ++YE+R A+   GF+++ +++  IITRY+     + FD+++
Sbjct:   42 YEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYEL-RKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE-VEWTGAWSDSSSEWNNVDPYERDQLRVKME-DGEFWMSFRDFMREFTRLEICNLTPDA-LKSRT---IRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFVLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPD------EQVLSEEEIDE-NFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFV 676          
BLAST of Calpain-B vs. Ensembl Human
Match: CAPN1 (calpain 1 [Source:HGNC Symbol;Acc:HGNC:1476])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 291/649 (44.84%), Postives = 425/649 (65.49%), Query Frame = 1
Query:  406 YNQKRMLKAKN-SLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPT-KVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKV---VDPDE-NDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSL--LDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            Y Q R+   ++ +LF D  FP    SL Y++  P       I+WKRP E+  N  FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F   Y G F F+LWQFG W DVVVDD LP   G+LV++HS + NEFWSALLEKAYAKV GSYEAL GGS+SE  EDFTGG+TE ++L   AP +L+ I++K + R SL+GCSI+      +EA   K L+KGHAYS+T  K VN +   V+L+R+RNPWG   EWTGA+SD S EWN +   ER +L +  E DGEFWM+F+DF++ FT+LEIC+L+P++ L+++      KW   +  G W++  +AGGCRN+  TF +NPQFK+++    DPD+  D E+  + ++ LMQK  R  R+ G+D+ TIG+A+Y++      +    L + +F   AS A+S  FINLREV  R +LP G+YV+VPSTF   +E  F+LR FSE+   + ++D++ +   PD       +V  EE+ +    +  F+ ++G D EI   EL+ IL+ +  K ++ +  GFS E+CRSMV +MD D +G+LG  EF +LW+ +R + ++F+KFD D+SG+ ++YE+R A+   GF+++ +++  IITRY+     + FD+++
Sbjct:   42 YEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYEL-RKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE-VEWTGAWSDSSSEWNNVDPYERDQLRVKME-DGEFWMSFRDFMREFTRLEICNLTPDA-LKSRT---IRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFVLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPD------EQVLSEEEIDE-NFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFV 676          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 476.863 bits (1226), Expect = 1.064e-156
Identity = 235/491 (47.86%), Postives = 336/491 (68.43%), Query Frame = 1
Query:  376 KSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPE--SELENKAGIKKSK--WEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQI 1836
            +   E +D++  + + L++K  LFEDP F AN++SL++ + PP+++EW RP E+ +    I +G SRFDV+QGELGDCWLLAA ++L++   L ++V+P DQ F  +Y G F F+ WQ+G W DVV+DDRLPT  G L+Y+HS   NEFWSALLEKAYAK+ GSYEALKGG++SEA+ED TGG+TE  DL  + P NL  +MM+G    SL GCSIEADP   EAK   GL+KGHAYSIT  + V+   G+  ++R+RNPWGN  EW G +SD S EW  + D  ++ +GL F+ DGEFWM+F DF++ F K+EIC+L P+   E+    G+K +   W     +G W +N +AGGCRN+I TF  NPQF+V++ D D +D++   T+I  ++QK  R+ +++G D   IG+A+Y M +   ++  L K++F    S  +S  FINLRE+ GR ++P G YV+VPSTF   EEA+F+LR+++    +S+++
Sbjct:  249 RPTTEPQDFYELRDQCLESK-RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL-KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 476.863 bits (1226), Expect = 1.064e-156
Identity = 235/491 (47.86%), Postives = 336/491 (68.43%), Query Frame = 1
Query:  376 KSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPE--SELENKAGIKKSK--WEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQI 1836
            +   E +D++  + + L++K  LFEDP F AN++SL++ + PP+++EW RP E+ +    I +G SRFDV+QGELGDCWLLAA ++L++   L ++V+P DQ F  +Y G F F+ WQ+G W DVV+DDRLPT  G L+Y+HS   NEFWSALLEKAYAK+ GSYEALKGG++SEA+ED TGG+TE  DL  + P NL  +MM+G    SL GCSIEADP   EAK   GL+KGHAYSIT  + V+   G+  ++R+RNPWGN  EW G +SD S EW  + D  ++ +GL F+ DGEFWM+F DF++ F K+EIC+L P+   E+    G+K +   W     +G W +N +AGGCRN+I TF  NPQF+V++ D D +D++   T+I  ++QK  R+ +++G D   IG+A+Y M +   ++  L K++F    S  +S  FINLRE+ GR ++P G YV+VPSTF   EEA+F+LR+++    +S+++
Sbjct:  249 RPTTEPQDFYELRDQCLESK-RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL-KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 476.863 bits (1226), Expect = 1.064e-156
Identity = 235/491 (47.86%), Postives = 336/491 (68.43%), Query Frame = 1
Query:  376 KSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPE--SELENKAGIKKSK--WEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQI 1836
            +   E +D++  + + L++K  LFEDP F AN++SL++ + PP+++EW RP E+ +    I +G SRFDV+QGELGDCWLLAA ++L++   L ++V+P DQ F  +Y G F F+ WQ+G W DVV+DDRLPT  G L+Y+HS   NEFWSALLEKAYAK+ GSYEALKGG++SEA+ED TGG+TE  DL  + P NL  +MM+G    SL GCSIEADP   EAK   GL+KGHAYSIT  + V+   G+  ++R+RNPWGN  EW G +SD S EW  + D  ++ +GL F+ DGEFWM+F DF++ F K+EIC+L P+   E+    G+K +   W     +G W +N +AGGCRN+I TF  NPQF+V++ D D +D++   T+I  ++QK  R+ +++G D   IG+A+Y M +   ++  L K++F    S  +S  FINLRE+ GR ++P G YV+VPSTF   EEA+F+LR+++    +S+++
Sbjct:  249 RPTTEPQDFYELRDQCLESK-RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL-KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 470.7 bits (1210), Expect = 3.886e-154
Identity = 235/491 (47.86%), Postives = 335/491 (68.23%), Query Frame = 1
Query:  376 KSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPE--SELENKAGIKKSK--WEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQI 1836
            +   E +D++  + + L++K  LFEDP F AN++SL++ + PP+++EW RP E+ +    I +G SRFDV+QGELGDCWLLAA ++L++   L ++V+P DQ F  +Y G F F+ WQ+G W DVV+DDRLPT  G L+Y+HS   NEFWSALLEKAYAK+ GSYEALKGG++SEA+ED TGG+TE  DL  + P NL  +MM+G    SL GCSIEADP   EAK   GL+KGHAYSIT  + V+   G+  ++R+RNPWGN  EW G +SD S EW  + D  ++ +GL F+ DGEFWM+F DF++ F K+EIC+L P+   E+    G+K +   W     +G W +N +AGGCRN+I TF  NPQF+V++ D D +D++   T+I  ++QK  R+ +++G D   IG+A+Y   +N   +  L K++F    S  +S  FINLRE+ GR ++P G YV+VPSTF   EEA+F+LR+++    +S+++
Sbjct:  274 RPTTEPQDFYELRDQCLESK-RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL-KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGNN---RGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 759          
BLAST of Calpain-B vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 471.085 bits (1211), Expect = 4.764e-154
Identity = 235/491 (47.86%), Postives = 335/491 (68.23%), Query Frame = 1
Query:  376 KSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPE--SELENKAGIKKSK--WEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQI 1836
            +   E +D++  + + L++K  LFEDP F AN++SL++ + PP+++EW RP E+ +    I +G SRFDV+QGELGDCWLLAA ++L++   L ++V+P DQ F  +Y G F F+ WQ+G W DVV+DDRLPT  G L+Y+HS   NEFWSALLEKAYAK+ GSYEALKGG++SEA+ED TGG+TE  DL  + P NL  +MM+G    SL GCSIEADP   EAK   GL+KGHAYSIT  + V+   G+  ++R+RNPWGN  EW G +SD S EW  + D  ++ +GL F+ DGEFWM+F DF++ F K+EIC+L P+   E+    G+K +   W     +G W +N +AGGCRN+I TF  NPQF+V++ D D +D++   T+I  ++QK  R+ +++G D   IG+A+Y   +N   +  L K++F    S  +S  FINLRE+ GR ++P G YV+VPSTF   EEA+F+LR+++    +S+++
Sbjct:  295 RPTTEPQDFYELRDQCLESK-RLFEDPQFLANDSSLFFSKRPPKRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL-KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGNN---RGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 780          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 322/687 (46.87%), Postives = 455/687 (66.23%), Query Frame = 1
Query:  391 SKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVK----SVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQID------EKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            SK  F + +    A  ++FEDP FPA N SL Y   P +  EW RP ++  +  F  +G SRFDV QGELGDCWLLAA ++L+    L  +VIP DQDF  +Y G F F+ WQ+G W +VV+DDRLPT  G L+Y+HS + NEFWSALLEKAYAK+ GSYEALKGG++ EAMEDFTGG+TE +D+   APPNL+ IMMK   R S+MGCS+E DP  +EA+  +GLI+GHAYSIT V     S  +++G++ ++R+RNPWGN  EW+G +SD SPEW  I +  ++ +GL F+ DGEFWM+FQDF+ +F ++EIC+LSP+S  E++    + KWEM +  GEW   V+AGGCRNF+ETF  NPQ+ + + DPD+ D++   T I+ LMQK  RS+R  G D  TIG+AIY + D           +F+  AS A+SP FIN REVC R KLP G Y+IVPSTF+  EE +F++R+FSE   + ++ D      E  + +AP      PP  K E+D   + L+  F  ++G+D E+D  EL++ILD S +      +GFS++  RSMVAM+D D+SGRLGFEEF+ L  D+  W+ VFK +D  ++G+ + + +R ALN  G+ ++NR+  A+  RY +++G I FDD+++  +++RT    F+ +   +   A F  D++++  +Y
Sbjct:  242 SKGDFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI-KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLP---PPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0304675)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 322/687 (46.87%), Postives = 455/687 (66.23%), Query Frame = 1
Query:  391 SKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVK----SVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQID------EKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            SK  F + +    A  ++FEDP FPA N SL Y   P +  EW RP ++  +  F  +G SRFDV QGELGDCWLLAA ++L+    L  +VIP DQDF  +Y G F F+ WQ+G W +VV+DDRLPT  G L+Y+HS + NEFWSALLEKAYAK+ GSYEALKGG++ EAMEDFTGG+TE +D+   APPNL+ IMMK   R S+MGCS+E DP  +EA+  +GLI+GHAYSIT V     S  +++G++ ++R+RNPWGN  EW+G +SD SPEW  I +  ++ +GL F+ DGEFWM+FQDF+ +F ++EIC+LSP+S  E++    + KWEM +  GEW   V+AGGCRNF+ETF  NPQ+ + + DPD+ D++   T I+ LMQK  RS+R  G D  TIG+AIY + D           +F+  AS A+SP FIN REVC R KLP G Y+IVPSTF+  EE +F++R+FSE   + ++ D      E  + +AP      PP  K E+D   + L+  F  ++G+D E+D  EL++ILD S +      +GFS++  RSMVAM+D D+SGRLGFEEF+ L  D+  W+ VFK +D  ++G+ + + +R ALN  G+ ++NR+  A+  RY +++G I FDD+++  +++RT    F+ +   +   A F  D++++  +Y
Sbjct:  242 SKGDFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI-KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLP---PPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0340532)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 288/614 (46.91%), Postives = 393/614 (64.01%), Query Frame = 1
Query:  313 LSPDPKQTDSESIYGSRFHVSKSL---KESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDE------KTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFK---FNGFSRETC-RSMVAMMDTDQSGRLGF 2103
            + P   Q++S   YG+    S SL    E +D+       L A  SLFEDP FPA+N SL +   P + IEW RP E+ +N  F  +G SRFDV QGELGDCWLLAA ++L+    L  +VIP++Q F+ +Y G F FR WQ+G W DV++DDRLPT  G L+Y+HS + NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG++E +DL   AP NL+ I+ K   R S+MGCSIE DP   EA+  +GLI+GHAYSIT V  ++    +++G++ ++R+RNPWGN  EW G +SD SPEW  I + ++  +GLTF+ DGEFWM+FQDF+ +F ++EIC+LSP+S  E++    K KWEM +  GEW   V+AGGCRNF++TF  NPQ+ + +VDPDE D E   T+I+ LMQK  RS+R  G +  TIG+AIY + D   +       +F+  +S  +SP FIN REVC R KLP G Y+IVPSTF+  EE +F++R+FSE   + ++ D+      K + + P +    P + ++E       L+  F  I+G D E+D  EL++ILD S + +  K   FN FS      +  A    D +G  G 
Sbjct:   58 VQPLQSQSNSTLYYGNLGEKSSSLGPYSEVQDYETILNSCL-ASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYGGKADTITPGFPTPKPIDPQKE------GLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGL 663          

HSP 2 Score: 107.071 bits (266), Expect = 2.156e-23
Identity = 51/131 (38.93%), Postives = 86/131 (65.65%), Query Frame = 1
Query: 2029 NGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            +GFS++ CRSMVAM+D D+SG+LGFEEF+ L  ++  WK +FK +D + +G  + +++R+ALN  G+ ++NRV   +  RY ++ G I FDD+I+  V+++T    FK +       A F  +E+++  +Y
Sbjct:  712 HGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 842          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 277/572 (48.43%), Postives = 376/572 (65.73%), Query Frame = 1
Query:  430 AKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDE------KTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFK---FNGFSRETC-RSMVAMMDTDQSGRLGF 2103
            A  SLFEDP FPA+N SL +   P + IEW RP E+ +N  F  +G SRFDV QGELGDCWLLAA ++L+    L  +VIP++Q F+ +Y G F FR WQ+G W DV++DDRLPT  G L+Y+HS + NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG++E +DL   AP NL+ I+ K   R S+MGCSIE DP   EA+  +GLI+GHAYSIT V  ++    +++G++ ++R+RNPWGN  EW G +SD SPEW  I + ++  +GLTF+ DGEFWM+FQDF+ +F ++EIC+LSP+S  E++    K KWEM +  GEW   V+AGGCRNF++TF  NPQ+ + +VDPDE D E   T+I+ LMQK  RS+R  G +  TIG+AIY + D   +       +F+  +S  +SP FIN REVC R KLP G Y+IVPSTF+  EE +F++R+FSE   + ++ D+      K + + P +    P + ++E       L+  F  I+G D E+D  EL++ILD S + +  K   FN FS      +  A    D +G  G 
Sbjct:   84 ASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYGGKADTITPGFPTPKPIDPQKE------GLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGL 648          

HSP 2 Score: 107.457 bits (267), Expect = 1.936e-23
Identity = 51/131 (38.93%), Postives = 86/131 (65.65%), Query Frame = 1
Query: 2029 NGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            +GFS++ CRSMVAM+D D+SG+LGFEEF+ L  ++  WK +FK +D + +G  + +++R+ALN  G+ ++NRV   +  RY ++ G I FDD+I+  V+++T    FK +       A F  +E+++  +Y
Sbjct:  697 HGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain-B vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 277/572 (48.43%), Postives = 376/572 (65.73%), Query Frame = 1
Query:  430 AKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDE------KTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFK---FNGFSRETC-RSMVAMMDTDQSGRLGF 2103
            A  SLFEDP FPA+N SL +   P + IEW RP E+ +N  F  +G SRFDV QGELGDCWLLAA ++L+    L  +VIP++Q F+ +Y G F FR WQ+G W DV++DDRLPT  G L+Y+HS + NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG++E +DL   AP NL+ I+ K   R S+MGCSIE DP   EA+  +GLI+GHAYSIT V  ++    +++G++ ++R+RNPWGN  EW G +SD SPEW  I + ++  +GLTF+ DGEFWM+FQDF+ +F ++EIC+LSP+S  E++    K KWEM +  GEW   V+AGGCRNF++TF  NPQ+ + +VDPDE D E   T+I+ LMQK  RS+R  G +  TIG+AIY + D   +       +F+  +S  +SP FIN REVC R KLP G Y+IVPSTF+  EE +F++R+FSE   + ++ D+      K + + P +    P + ++E       L+  F  I+G D E+D  EL++ILD S + +  K   FN FS      +  A    D +G  G 
Sbjct:   84 ASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYGGKADTITPGFPTPKPIDPQKE------GLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGL 648          

HSP 2 Score: 107.457 bits (267), Expect = 1.936e-23
Identity = 51/131 (38.93%), Postives = 86/131 (65.65%), Query Frame = 1
Query: 2029 NGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            +GFS++ CRSMVAM+D D+SG+LGFEEF+ L  ++  WK +FK +D + +G  + +++R+ALN  G+ ++NRV   +  RY ++ G I FDD+I+  V+++T    FK +       A F  +E+++  +Y
Sbjct:  697 HGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: zgc:55262 (zgc:55262 [Source:ZFIN;Acc:ZDB-GENE-040426-2814])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 294/632 (46.52%), Postives = 419/632 (66.30%), Query Frame = 1
Query:  442 LFEDPFFPANNTSLYYREAPP-----QKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPT-KVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKS--LLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            LFEDP F A+++SL + E  P     Q + W RPKEM     FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  QDFD  Y G F F+ WQFG W DVV+DDRLPT  G+L+++HS +  EFWSALLEKAYAK+ G YEAL GGS+ E  EDFTGG+TEM++L   AP +L+ I+ + + R SL+GCSI+      +EA   K L+KGHAYS+T  + V  +     LVR+RNPWG   EWTGA+SD S EW+ +    R RL     +DGEFWM+F DF++ FT+LEIC+L+ ++   ++      KW     NGEW++  +AGGCRN+  TF +NPQFKV +  PD +  ++  + ++ LMQK+ R +R+EGQD+ TIG+AIY++      +S   L + +F   AS A+S  FINLREV  R +LP G+Y+IVPSTF   +EA F+LR+FSE+P +S+++D+K          EIP E + +E   +   ++ F+ ++GAD EI   ELQ IL+ +  K ++ K +GF +E+CRSM+ +MDTD SG+LG  EF VLW+ ++ +  +F+  D D+SGT +SYE+R+AL   GF+++N +F  II RY  +   + FD+++
Sbjct:   50 LFEDPMFTASSSSLGFNELGPRSSKTQGVRWMRPKEMCARPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQDFDSRYAGIFHFQFWQFGEWVDVVIDDRLPTKDGKLLFVHSAEGGEFWSALLEKAYAKLNGCYEALSGGSTCEGFEDFTGGVTEMYEL-KKAPADLFSIIGRAIERGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTGAEEVVYRGNMTKLVRIRNPWGE-VEWTGAWSDNSREWDNVDRSVRGRLQ-NRSEDGEFWMSFSDFLREFTRLEICNLTADALQASQV----KKWSTANYNGEWRRGSTAGGCRNYPATFWINPQFKVALKHPD-SPGQSECSFLVALMQKDRRKKRREGQDMETIGFAIYEVPREFLGQSGVHLKRDFFLTHASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPNKEADFVLRVFSEKPANSEEMDDKV-------MAEIPEEQRLDESQIDAGFKSLFRQLAGADMEISVTELQTILNRIIAKHKDLKTDGFGKESCRSMINLMDTDGSGKLGLVEFHVLWEKIKRYLQIFRDHDVDKSGTMSSYEMRKALETAGFKLNNHLFQLIILRYTEEDLSVDFDNFV 666          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 310/666 (46.55%), Postives = 432/666 (64.86%), Query Frame = 1
Query:  415 KRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQIL-DVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFM 2406
            +R    K  LFEDP FPA + SL+Y +  P   EWKRP E+ +   FI  G +R D+ QG+LGDCWLLAA++SL++    +++V+P+DQ FDR Y G F F+ WQ   W DVVVDDRLP VR +LV+LHS D NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+ EM++   + P NL+ I+ K + R S++GCSI+     + EA+   GL+KGHAYS+T V+ VN +  +V L+RVRNPWG   EW G +SD S EW  I   E+KRL     DDGEFWM F DF   + K+EIC+LSP++  ++ +     +W + +  G W +  +AGGCRN+I+TF  NPQFK+ + +PD  D +   ++I+ LMQK  R  RKEG DL TIG+AIY+  D   D+    K +F+   S A+S T+IN+REV  R +LP G Y++VP+TF   +EA FL+R+FSE+   + ++  K E   P+  K  PPE + +E+     L+  F+ ++G D  I A ELQ +L +V  +R+  KF+G S  TC S++ +MD D SG + F EFKV WD L+ W  +F  +D D+SGT +SYE+R ALN  G +++NR+   +  R+A+++  I FDDY+  +VRL  +F  F+A     KGE      +F+
Sbjct:   31 RRECLEKGKLFEDPDFPAVDGSLFYSQRVPVNFEWKRPGEICKEPQFITGGATRTDICQGQLGDCWLLAAIASLTLKEETLNRVVPNDQTFDRGYAGIFHFQFWQHNKWMDVVVDDRLPCVRDKLVFLHSADNNEFWSALLEKAYAKLNGSYEALKGGSTMEAMEDFTGGVGEMYET-KNGPNNLFLILKKAIERGSMLGCSIDITSSAESEAQTSTGLVKGHAYSVTGVEEVNYRGAKVQLIRVRNPWG-QVEWNGPWSDNSREWTVIDSSEKKRLLQNSLDDGEFWMEFGDFKSNYDKVEICNLSPDALSDDVS----KQWAVNLFEGSWIRGSTAGGCRNYIDTFWTNPQFKLHLENPD--DGDKLCSVIVALMQKNRRRLRKEGLDLETIGFAIYEAPD---DQDHQGKDFFRYNPSKARSRTYINVREVSERFRLPPGNYLLVPTTFQPHKEADFLIRLFSEKKAGAIEVGNKIEADLPEPPKPNPPEEETDEEKG---LRKLFEQVAGPDNVISARELQHVLNNVLGRRKEVKFDGLSLNTCISIINLMDVDGSGMMEFSEFKVFWDKLKKWIMLFLSYDVDRSGTMSSYELRSALNAAGMKLNNRILQLLGLRFADEKLEIDFDDYLTCIVRLENMFRIFQALDAQKKGEVSLNMHQFL 682          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 305/671 (45.45%), Postives = 436/671 (64.98%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGR---VNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTE---IVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            K  LFEDP FPA ++SL+Y E  P K+EWKRP E+ +N  FI  G +R D+ QG+LGDCWLLAA++ L++   ++ +V+P DQ F  +Y G F F+ W++G W DVV+DDRLPT + +LV+  S   NEFWSAL+EKAYAK+ GSYEALKGG+S EAMEDFTGG+TE +++ + AP  L++IM K + R SLMGC+I+   PT    K   GL++GHAYS+T V+    K G+   + LVRVR+PWG +       + KS +W E++  E+ +  L   + GEFWM F++F K FTKLEIC+L+P++ LE+    +  KW + +  G W K  SAGGCRNF +T+  NPQF++ +++ D    E T T+++ LMQK  R  R  G  L  IG+AIY+MK N   +  L K +F   AS A+S +++N+REV  R  L  G+YVI+PSTF+  +E++FLLR+FSE    SK ID + E   +   + KK+I P  + EE     + +  F+ I+G D EI+A+EL+ +L+ V  K +  K  GFS E+CRSM+A++DTD +G L  +EFK LW+ ++ WK VF +FD D+S T +S+E+R AL   GF+++N+++  I  RYAN+   + FD YI  LVRL  +F  F+A  K   G       E++Q  +Y
Sbjct:   62 KKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVA----PPPACKSNDWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDT-LEDD---QMFKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRLVLLEADA--KEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEMKGNQQQQ--LSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPMQVDNVKKKIKP-FEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKTEGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYANEHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLTMY 718          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: si:dkeyp-50d11.2 (si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-22])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 289/642 (45.02%), Postives = 418/642 (65.11%), Query Frame = 1
Query:  412 QKRMLKAKNSLFEDPFFPANNTSLYYREAPP-----QKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADP-TKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDK--SLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            + R L++ + LFED  FPA  +SL ++E  P     + + W RP E   +  FI DG +R D+ QG LGDCWLLAA++ L++   L+ +V+P  Q F + Y G F F+ WQFG W DVV+DDRLP   G+L+++HS + +EFWSAL+EKAYAK+ G YEAL GGS+SE  EDFTGG+TEM++L  +APPNL+ I+ + V R SLMGCSI+      +EA   K L+KGHAYSIT V  V  +R +  L+R+RNPWG   EWTG +SD+S EW EI    R RL    ++DGEFWM F DF + F++LEIC+L+ ++ L+++   +  KW   +  GEW++  +AGGCRN+  TF +NPQFK+ + +PD  DN+   T ++ LMQK  R  R+EG+D+ TIG+AIY++      +    L + +F    S A+S  FINLREV  R  LP G+Y+IVPSTF   +E  F+LR+FSE+  DS+++D+  EI A     ++P E   +E   +   +  F  ++G + EI+  +L+ IL+ V  K ++ K +GF +ETCR M+ +MDT  +G+LG  +F VLW+  + +  VF++FD D+SGT +SYE+R AL   GF+++N +F  II RYA     + FD+++
Sbjct:   41 RTRCLQSGH-LFEDDIFPAQQSSLGFKELGPNSSKTRGVRWMRPTEFCSDPHFIVDGATRTDICQGALGDCWLLAAIACLTLNEPLLRRVVPHGQSFHQQYAGIFHFQFWQFGDWVDVVIDDRLPVRDGKLLFVHSAEGSEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYEL-KNAPPNLFSIITRAVERGSLMGCSIDITSFFDMEAITFKKLVKGHAYSITGVDEVEYRRSQTKLLRIRNPWGE-VEWTGPWSDESKEWREIDASVRSRLH-NCQEDGEFWMAFSDFKREFSRLEICNLTADA-LQSR---EVKKWNSSLYPGEWRRGSTAGGCRNYPATFWINPQFKIVLKEPD-TDNQEGCTFLVALMQKNRRQLRREGKDMETIGFAIYEVPKEYLGRVGVHLKRDFFLKHTSSARSELFINLREVSSRFSLPAGEYIIVPSTFEPQKEGDFVLRVFSEKATDSQELDD--EISA-----DVPEEPVLQESDIDEGFKALFAKLAGPEMEINVAKLEMILNRVVSKHKDIKTDGFGKETCRGMINLMDTTGTGKLGLTDFHVLWEKFKRYLAVFREFDIDKSGTMSSYEMRLALESAGFKLTNNLFQLIILRYAKSDLNVDFDNFV 666          
BLAST of Calpain-B vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 305/675 (45.19%), Postives = 436/675 (64.59%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGR---VNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIY----QMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTE---IVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            K  LFEDP FPA ++SL+Y E  P K+EWKRP E+ +N  FI  G +R D+ QG+LGDCWLLAA++ L++   ++ +V+P DQ F  +Y G F F+ W++G W DVV+DDRLPT + +LV+  S   NEFWSAL+EKAYAK+ GSYEALKGG+S EAMEDFTGG+TE +++ + AP  L++IM K + R SLMGC+I+   PT    K   GL++GHAYS+T V+    K G+   + LVRVR+PWG +       + KS +W E++  E+ +  L   + GEFWM F++F K FTKLEIC+L+P++ LE+    +  KW + +  G W K  SAGGCRNF +T+  NPQF++ +++ D    E T T+++ LMQK  R  R  G  L  IG+AIY    +MK N   +  L K +F   AS A+S +++N+REV  R  L  G+YVI+PSTF+  +E++FLLR+FSE    SK ID + E   +   + KK+I P  + EE     + +  F+ I+G D EI+A+EL+ +L+ V  K +  K  GFS E+CRSM+A++DTD +G L  +EFK LW+ ++ WK VF +FD D+S T +S+E+R AL   GF+++N+++  I  RYAN+   + FD YI  LVRL  +F  F+A  K   G       E++Q  +Y
Sbjct:   62 KKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVA----PPPACKSNDWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDT-LEDD---QMFKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRLVLLEADA--KEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVPKEMKGNQQQQ--LSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPMQVDNVKKKIKP-FEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKTEGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYANEHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLTMY 722          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 321/665 (48.27%), Postives = 433/665 (65.11%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR-ENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAI-FPQDEFMQCVL 2418
            K  LFED  FPAN++SL+Y E P     WKRPKEM  +  FI  G SR DV QG+LGDCWLLAA++SL++   ++++V+P DQ F   Y G F F+ WQ   W DVV+DDRLPT R RLV++HS DLNEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+TE +++  SAP NL+DI+ K + + S++GCSI+     + EAK  +GL+KGHAYSIT    VN K  +V L+R+RNPWG   EW GA+SD S EWN I   E+ RL     DDGEFWM+F+DF ++F KLEIC+L+P+S L++ A   K KWE+ +  G W +  +AGGCRNF+ETF  NPQ K+ + + D  D +   T I  LMQK  R  RK G DL TIGY IYQ   +   +S+L K +F+   S A+S T++NLRE+  R KLP G Y+ +P+TF   +EA F LRIFSE+  D K++D +  I   D      P    +E     + +  F+ ISG D E+ A+ELQ +L+   +R +N KF   S  +C +++++MD   +G+LGF+EFK+ WD L+ W  +F ++D D+SGT +SYE+R AL   GF ++N V   I+ RYA+ Q  I FDD++  LVRL   +  FK   ++   E I   Q EF+   +
Sbjct:   39 KGVLFEDVDFPANDSSLFYSEKPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI-RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGADVVNFKGQKVKLIRIRNPWGQ-VEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDS-LDDDA---KHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIKLSLTEQD--DGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGS---ESILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGEVNI---DLPDPPAPTPPHKETEEERQFRTLFEQISGQDLEVSAEELQYVLNAVLRRTKNIKFKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYADDQFQIEFDDFLNCLVRLENSYRVFKQLNRSDTTETIQLNQAEFIALTM 689          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 310/628 (49.36%), Postives = 417/628 (66.40%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR-ENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            K  LFED  FPAN++SL+Y E P     WKRPKEM  +  FI  G SR DV QG+LGDCWLLAA++SL++   ++++V+P DQ F   Y G F F+ WQ   W DVV+DDRLPT R RLV++HS DLNEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+TE +++  SAP NL+DI+ K + + S++GCSI+     + EAK  +GL+KGHAYSIT    VN K  +V L+R+RNPWG   EW GA+SD S EWN I   E+ RL     DDGEFWM+F+DF ++F KLEIC+L+P+S L++ A   K KWE+ +  G W +  +AGGCRNF+ETF  NPQ K+ + + D  D +   T I  LMQK  R  RK G DL TIGY IYQ   +   +S+L K +F+   S A+S T++NLRE+  R KLP G Y+ +P+TF   +EA F LRIFSE+  D K++D +  I   D      P    +E     + +  F+ ISG D E+ A+ELQ +L+   +R +N KF   S  +C +++++MD   +G+LGF+EFK+ WD L+ W  +F ++D D+SGT +SYE+R AL   GF ++N V   I+ RYA+ Q  I FDD++
Sbjct:   39 KGVLFEDVDFPANDSSLFYSEKPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI-RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGADVVNFKGQKVKLIRIRNPWGQ-VEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDS-LDDDA---KHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIKLSLTEQD--DGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGS---ESILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGEVNI---DLPDPPAPTPPHKETEEERQFRTLFEQISGQDLEVSAEELQYVLNAVLRRTKNIKFKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYADDQFQIEFDDFL 652          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 301/629 (47.85%), Postives = 403/629 (64.07%), Query Frame = 1
Query:  433 KNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFK--RENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            K  LFED  FPAN++SL+Y E P     WKRPKEM  +  FI  G SR DV QG+LGDCWLLAA++SL++   ++++V+P DQ F   Y G F F+ WQ   W DVV+DDRLPT R RLV++HS DLNEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+TE +++  SAP NL+DI+ K + + S++GCSI+     + EAK  +GL+KGHAYSIT    VN K  +V L+R+RNPWG   EW GA+SD S EWN I   E+ RL     DDGEFWM+F+DF ++F KLEIC+L+P+S L++ A   K KWE+ +  G W +  +AGGCRNF+ETF  NPQ K+ + + D  D +   T I  LMQK  R  RK G DL TIGY IYQ   +   +S+L K +F+   S A+S T++NLRE+  R KLP G Y+ +P+TF   +EA F LRIFSE+  D K++D +  I   D      P    +E     + +  F+ ISG           Q+    +K  + ++ F   S+E  R  +       +G+LGF+EFK+ WD L+ W  +F ++D D+SGT +SYE+R AL   GF ++N V   I+ RYA+ Q  I FDD++
Sbjct:   39 KGVLFEDVDFPANDSSLFYSEKPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI-RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGADVVNFKGQKVKLIRIRNPWGQ-VEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDS-LDDDA---KHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIKLSLTEQD--DGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGS---ESILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGEVNI---DLPDPPAPTPPHKETEEERQFRTLFEQISG-----------QVSTTQYKAVQGSYLFKNKSKE--RKGIG------NGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYADDQFQIEFDDFL 634          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 287/668 (42.96%), Postives = 428/668 (64.07%), Query Frame = 1
Query:  412 QKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDEN--DNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAP----------DWKKEIPPEVKREEDANNV--------------------KLQNAFKVISGADGEIDADELQQIL-DVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            +K+ L+ +N  F+D  FP + +SL+Y ++ P K EWKRP E+ +N  FI  G +R D+ QG+LGDCW LAA++ L++   ++ +VIP DQ+F  +Y G F F+ W++G W DV++DD LPT    LV+  S   NEFWSALLEKAYAK+ GSYEALKGG+++EAMEDFTGG+TE ++L   AP ++++IM K   R SL+GCSI+   P ++E +   GL+KGHAYS+T V+    K   + LVR+RNPWG   EW GA+ D + EW  +   E+ RL    ++DGEFWM++ DF+K FTK EIC+L+P++   +   +    W + +  G W +  SAGGCRN+ +T+  NPQ+++K+++ D++  DNE   + ++ LMQK  R  RK G +LFTIG+AIY++ K+   +   L K +F   AS AK  ++IN+REVC R +LP  +YVI+PST+   +E +F+LR+FSE+   S++++ K E   P          +  KE+  +   +ED   +                    + +N F+ I+G D EI ADELQ +L +V  K +  K +GF+ E+CRSM+A+MDTD  GRL  +EF  LW  ++ W+ +F +FD DQSGT +S+E+R A+N  GF ++N+++  I  RYANK+  + FD +I
Sbjct:   56 RKKCLQ-RNFHFQDREFPPDESSLFYSQSFPIKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL-KEAPKDMYNIMKKAFERGSLIGCSIDTLVPVQLETRMANGLVKGHAYSVTGVEETKLKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQV----WTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKHKTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMDLDFDSFI 716          
BLAST of Calpain-B vs. Ensembl Xenopus
Match: capn1 (calpain 1, (mu/I) large subunit [Source:NCBI gene;Acc:541455])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 298/672 (44.35%), Postives = 425/672 (63.24%), Query Frame = 1
Query:  328 KQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDEN---DNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKS--LLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDY 2307
            KQ D E   G   +  K L +  D   ++        +LF+D  FP +  SL ++E  P       ++W RP ++  N  FI DG +R D+ QG LGDCWLLAA++SL++   ++H+V+P  Q F  +Y G F F+LWQFG W DVV+DD LP   G+LV++HS   NEFWSALLEKAYAK  G YEAL GGS+SE  EDFTGG+TE +++   AP +L+ I+MK V R SLMGCSI+    T +EA   K L+KGHAYS+T  K +N +     L+R+RNPWG   EWTGA+SD S EWN +   + + L +  E DGEFWM F+DF++ F++LEIC+L+P++        K  KW   + NG W+K  +AGGCRNF  TF +NPQFK+K+ + D++    +E   T ++ LMQK+ R  R+ G+D+ TIG+A+Y++    + +S   L + +F   AS A+S  FINLREV  RHKLP G+Y++VPSTF    E  F++R FSE  + S ++D+           ++PPE    E   +   +N FK ++GAD EI A ELQ IL+ +  K ++ + +GFS E+CRSMV +MD D +G+LG  EF VLW+ ++ + TVF+KFD D+SG+ ++YE+R A+   GF+++N +   IITRY+     + FD +
Sbjct:   20 KQRDQELGVGKHENAVKFLGQDYDRILHE---CLQNRTLFKDDTFPPSAYSLGFKELGPNSSKTYGVKWVRPSQLVSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTILHRVVPHGQSFQDNYAGVFHFQLWQFGEWVDVVIDDYLPVKDGKLVFVHSASGNEFWSALLEKAYAKANGCYEALSGGSTSEGFEDFTGGVTEWYEM-KKAPKDLFSIIMKAVERGSLMGCSIDITSATDMEAVTFKKLVKGHAYSVTGAKEINFRGRSQKLIRMRNPWGE-VEWTGAWSDNSSEWNSVDAADSQDLRIKME-DGEFWMAFEDFLREFSRLEICNLTPDA----LTARKYRKWNTTVFNGNWRKGSTAGGCRNFPATFWINPQFKIKLDEEDDDDDFGSEKGCTFLLALMQKDKRKERRFGKDMETIGFAVYEVPSQFHGQSGVHLKRDFFLQNASRARSEQFINLREVSTRHKLPPGEYIVVPSTFEPNVEGDFVVRFFSENKHGSVEMDDPLS-------ADLPPEEVLSEAEIDQGFKNLFKQLAGADNEISATELQSILNKIMSKHKDLRTSGFSLESCRSMVNLMDKDGNGKLGLVEFNVLWNKIKNYLTVFRKFDMDKSGSMSAYEMRLAVESAGFKLTNSLHQLIITRYSEPDMAVNFDSF 674          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn9 (calpain 9 [Source:MGI Symbol;Acc:MGI:1920897])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 296/648 (45.68%), Postives = 417/648 (64.35%), Query Frame = 1
Query:  373 SKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSF-KRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            ++++  S   F   ++      +LFED  FPA+N SL+Y E P     WKRP E+ +   FI  G +R D+ QGELGDCWLLAA++SL++    + +V+P DQ F   Y G F F+ WQ   W DVV+DDRLPT + RLV+LHS D NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+ E F +   AP + ++I+ K + R SL+GCSI+  + ++ EA+   GLIKGHAY++T +  VN    R+ L+RVRNPWG   EW G +SD SPEW  +   E+KRLG T  DDGEFWM F+DF  +F K+EIC+L+P++ LE+ A     +WE+ I  G W +  +AGGCRNF++TF  NPQ K+ + + DE   +   T +  LMQK+ R  ++ G ++ TIGYAIYQ  D       L + +F+  AS A+S TFINLREV  R +LP G Y+++PSTF   +EA F LRIFSE+   ++ +DE  +I  P+  K      + EE     + +  F+ ++G D E+ A+EL+ +L+    K+   KF   S  +CR+++++MDT  +G+L FEEF+V WD L+ W  +F +FD D+SGT +SYE+R AL   GF++   +   I+ RYA++   + FDDY+
Sbjct:   19 ARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQVPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI-REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVNFHGQRIKLIRVRNPWGQ-VEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDA-LEDSA---LHRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTERDE--GQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDK---DGHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLDENIDIDLPELPKP---TPQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYADEDLQLDFDDYL 652          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn1 (calpain 1 [Source:MGI Symbol;Acc:MGI:88263])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 303/673 (45.02%), Postives = 438/673 (65.08%), Query Frame = 1
Query:  328 KQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVK---VVDPDENDNENTG-TLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            K+ D E   G   +  K L   +D+   + R L++   LF+D  FP  + SL ++E  P       I+WKRP E+  N  FI DG +R D+ QG LGDCWLLAA++SL++   ++H+V+P  Q F   Y G F F+LWQFG W DVV+DD LPT  G+LV++HS   NEFWSALLEKAYAKV GSYEAL GG +SEA EDFTGG+TE +DL   AP +L+ I++K + R SL+GCSI  +D   +EA   K L++GHAYS+T  K V  +  RVNL+R+RNPWG   EW G +SD S EWN++   ER++L +  E DGEFWM+F+DF++ FTKLEIC+L+P++ L+++       W      G W++  +AGGCRN+  TF +NPQFK++   V D D+ DN  +G + ++ LMQK  R  R+ G+D+ TIG+A+YQ+ ++ A     L + +F   AS A+S  FINLREV  R +LP G+Y++VPSTF   +E  FLLR FSE+   ++++D++ +   PD K      V  EE+ ++   +  F  ++G D EI   ELQ IL+ +  K ++ + NGFS E+CRSMV +MD D +G+LG  EF +LW+ +R + T+F+KFD D+SG+ ++YE+R A+   GF+++ ++   IITRY+     + FD+++
Sbjct:   20 KKRDKELGLGRHENAIKYL--GQDYETLRARCLQS-GVLFQDEAFPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWG-EVEWKGPWSDSSYEWNKVDPYEREQLRVKME-DGEFWMSFRDFIREFTKLEICNLTPDA-LKSRT---LRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDNRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEK------VLSEEEIDD-NFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIITRYSEPDLAVDFDNFV 675          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn1 (calpain 1 [Source:MGI Symbol;Acc:MGI:88263])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 303/673 (45.02%), Postives = 438/673 (65.08%), Query Frame = 1
Query:  328 KQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVK---VVDPDENDNENTG-TLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            K+ D E   G   +  K L   +D+   + R L++   LF+D  FP  + SL ++E  P       I+WKRP E+  N  FI DG +R D+ QG LGDCWLLAA++SL++   ++H+V+P  Q F   Y G F F+LWQFG W DVV+DD LPT  G+LV++HS   NEFWSALLEKAYAKV GSYEAL GG +SEA EDFTGG+TE +DL   AP +L+ I++K + R SL+GCSI  +D   +EA   K L++GHAYS+T  K V  +  RVNL+R+RNPWG   EW G +SD S EWN++   ER++L +  E DGEFWM+F+DF++ FTKLEIC+L+P++ L+++       W      G W++  +AGGCRN+  TF +NPQFK++   V D D+ DN  +G + ++ LMQK  R  R+ G+D+ TIG+A+YQ+ ++ A     L + +F   AS A+S  FINLREV  R +LP G+Y++VPSTF   +E  FLLR FSE+   ++++D++ +   PD K      V  EE+ ++   +  F  ++G D EI   ELQ IL+ +  K ++ + NGFS E+CRSMV +MD D +G+LG  EF +LW+ +R + T+F+KFD D+SG+ ++YE+R A+   GF+++ ++   IITRY+     + FD+++
Sbjct:   20 KKRDKELGLGRHENAIKYL--GQDYETLRARCLQS-GVLFQDEAFPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWG-EVEWKGPWSDSSYEWNKVDPYEREQLRVKME-DGEFWMSFRDFIREFTKLEICNLTPDA-LKSRT---LRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDNRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEK------VLSEEEIDD-NFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIITRYSEPDLAVDFDNFV 675          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn1 (calpain 1 [Source:MGI Symbol;Acc:MGI:88263])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 303/673 (45.02%), Postives = 438/673 (65.08%), Query Frame = 1
Query:  328 KQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVK---VVDPDENDNENTG-TLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            K+ D E   G   +  K L   +D+   + R L++   LF+D  FP  + SL ++E  P       I+WKRP E+  N  FI DG +R D+ QG LGDCWLLAA++SL++   ++H+V+P  Q F   Y G F F+LWQFG W DVV+DD LPT  G+LV++HS   NEFWSALLEKAYAKV GSYEAL GG +SEA EDFTGG+TE +DL   AP +L+ I++K + R SL+GCSI  +D   +EA   K L++GHAYS+T  K V  +  RVNL+R+RNPWG   EW G +SD S EWN++   ER++L +  E DGEFWM+F+DF++ FTKLEIC+L+P++ L+++       W      G W++  +AGGCRN+  TF +NPQFK++   V D D+ DN  +G + ++ LMQK  R  R+ G+D+ TIG+A+YQ+ ++ A     L + +F   AS A+S  FINLREV  R +LP G+Y++VPSTF   +E  FLLR FSE+   ++++D++ +   PD K      V  EE+ ++   +  F  ++G D EI   ELQ IL+ +  K ++ + NGFS E+CRSMV +MD D +G+LG  EF +LW+ +R + T+F+KFD D+SG+ ++YE+R A+   GF+++ ++   IITRY+     + FD+++
Sbjct:   20 KKRDKELGLGRHENAIKYL--GQDYETLRARCLQS-GVLFQDEAFPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWG-EVEWKGPWSDSSYEWNKVDPYEREQLRVKME-DGEFWMSFRDFIREFTKLEICNLTPDA-LKSRT---LRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDNRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEK------VLSEEEIDD-NFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIITRYSEPDLAVDFDNFV 675          
BLAST of Calpain-B vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 301/679 (44.33%), Postives = 434/679 (63.92%), Query Frame = 1
Query:  403 FYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEAD-PTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIP-PEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            F   +R    K  L+ DP FP + TSL+Y +  P +  WKRP E+ +N  FI  G +R D+ QG+LGDCW LAA++ L++   L+ +VIP DQ F  +Y G F F+ W++G W DVV+DD LPT   +LV+  S   NEFWSALLEKAYAK+ GSYEALKGG+++EAMEDFTGG+TE F++   AP +++ IM K + R SLMGCSI+   P + E +   GL+KGHAYS+T ++    K  +V LVR+RNPWG   EW G++SD   +W+ +   E+ RL     +DGEFWM++ DFV +FTKLEIC+L+ ++ LE+    K   W + +  G W +  SAGGCRNF +TF  NPQ+++K+++ D++  ++    + ++ LMQK  R  RK G +LFTIG+AIY++ K+   +K  L K +F   AS A+S T+IN+REV  R +LP  +YVIVPST+   +E +F+LR+FSE+   S++ +    +  P     +P P    +E     + +N F+ I+G D EI ADEL+ +L+ V  K ++ K  GF+ E+CRSM+A+MDTD SGRL  +EF  LW  ++ W+ +FK +D D SGT NSYE+R A+N  GF ++++++  I  RYA+K   I FD +I   VRL  +F  F A  K   G       E++Q  +Y
Sbjct:   61 FEQLRRKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI-KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEALFKGEKVKLVRLRNPWGQ-VEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADA-LESD---KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAENTISVDRP-----VPRPGHTDQESEEQQQFRNIFRQIAGDDMEICADELKNVLNTVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMY 728          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|Q9VT65|CANB_DROME (Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 322/687 (46.87%), Postives = 455/687 (66.23%), Query Frame = 1
Query:  391 SKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVK----SVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQID------EKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            SK  F + +    A  ++FEDP FPA N SL Y   P +  EW RP ++  +  F  +G SRFDV QGELGDCWLLAA ++L+    L  +VIP DQDF  +Y G F F+ WQ+G W +VV+DDRLPT  G L+Y+HS + NEFWSALLEKAYAK+ GSYEALKGG++ EAMEDFTGG+TE +D+   APPNL+ IMMK   R S+MGCS+E DP  +EA+  +GLI+GHAYSIT V     S  +++G++ ++R+RNPWGN  EW+G +SD SPEW  I +  ++ +GL F+ DGEFWM+FQDF+ +F ++EIC+LSP+S  E++    + KWEM +  GEW   V+AGGCRNF+ETF  NPQ+ + + DPD+ D++   T I+ LMQK  RS+R  G D  TIG+AIY + D           +F+  AS A+SP FIN REVC R KLP G Y+IVPSTF+  EE +F++R+FSE   + ++ D      E  + +AP      PP  K E+D   + L+  F  ++G+D E+D  EL++ILD S +      +GFS++  RSMVAM+D D+SGRLGFEEF+ L  D+  W+ VFK +D  ++G+ + + +R ALN  G+ ++NR+  A+  RY +++G I FDD+++  +++RT    F+ +   +   A F  D++++  +Y
Sbjct:  242 SKGDFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI-KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLP---PPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|O35920|CAN9_RAT (Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 306/666 (45.95%), Postives = 428/666 (64.26%), Query Frame = 1
Query:  319 PDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSF-KRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            P P   D+ +++ S  H  + L++S               +LFED  FPA+N+SL+Y E P     WKRP E+ +N  FI  G +R D+ QGELGDCWLLAA++SL++    + +V+P DQ F   Y G F F+ WQ   W DVV+DDRLPT R RLV+LHS D NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+ E F +   AP + ++I+ K + R SL+GCSI+  + ++ EA+   GLIKGHAY++T +  VN    R+ L+RVRNPWG   EW G +SD SPEW  +S  E+KRLG T  DDGEFWM F+DF  +F K+EIC+L+P++  +N       KWE+ I  G W +  +AGGCRNF++TF  NPQ K+ + + DE   +   T +  LMQK+ R  ++ G ++ TIGYAIYQ  D       L++ +F+  AS A+S TFINLREV GR +LP G Y+++PSTF   +EA F LRIFSE+   ++ +DE  +I  P+  K  P   + EE     + +  F+ I+G D E+ A+EL+ +L+    K+   KF   S  +CR+++++MDT  +G++ FEEF+V WD LR W  +F +FD D+SGT +SYE+R AL   GF++ + +   I+ RYA++   + FDDY+
Sbjct:   12 PQPVPRDARTVHSSG-HSFEQLRQS----------CLQSGTLFEDADFPASNSSLFYSERPQVPFVWKRPGEIVENPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI-REAPEDFYEILEKALRRGSLLGCSIDTLNASESEARTPLGLIKGHAYTVTGLDQVNFHGQRIKLIRVRNPWGQ-VEWNGPWSDSSPEWRSMSLEEQKRLGHTALDDGEFWMAFEDFKTHFDKVEICNLTPDALEDNTL----HKWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTERDE--GQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDK---DGHLNRDFFRYHASLARSKTFINLREVSGRFQLPPGDYILIPSTFEPHQEADFCLRIFSEKKAVTQDLDENIDIDLPELPKPTP---QEEETEEERQFRALFRRIAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKMEFEEFRVFWDKLRYWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGSHLLQLIVLRYADENLQLDFDDYL 652          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|Q9D805|CAN9_MOUSE (Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 296/648 (45.68%), Postives = 417/648 (64.35%), Query Frame = 1
Query:  373 SKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSF-KRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            ++++  S   F   ++      +LFED  FPA+N SL+Y E P     WKRP E+ +   FI  G +R D+ QGELGDCWLLAA++SL++    + +V+P DQ F   Y G F F+ WQ   W DVV+DDRLPT + RLV+LHS D NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+ E F +   AP + ++I+ K + R SL+GCSI+  + ++ EA+   GLIKGHAY++T +  VN    R+ L+RVRNPWG   EW G +SD SPEW  +   E+KRLG T  DDGEFWM F+DF  +F K+EIC+L+P++ LE+ A     +WE+ I  G W +  +AGGCRNF++TF  NPQ K+ + + DE   +   T +  LMQK+ R  ++ G ++ TIGYAIYQ  D       L + +F+  AS A+S TFINLREV  R +LP G Y+++PSTF   +EA F LRIFSE+   ++ +DE  +I  P+  K      + EE     + +  F+ ++G D E+ A+EL+ +L+    K+   KF   S  +CR+++++MDT  +G+L FEEF+V WD L+ W  +F +FD D+SGT +SYE+R AL   GF++   +   I+ RYA++   + FDDY+
Sbjct:   19 ARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQVPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI-REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVNFHGQRIKLIRVRNPWGQ-VEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDA-LEDSA---LHRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTERDE--GQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDK---DGHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLDENIDIDLPELPKP---TPQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYADEDLQLDFDDYL 652          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|O14815|CAN9_HUMAN (Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 292/638 (45.77%), Postives = 417/638 (65.36%), Query Frame = 1
Query:  403 FYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFK-RENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            F   ++    + +LFED  FPA+N+SL+Y E P     WKRP E+ +N  FI  G +R D+ QGELGDCWLLAA++SL++    + +VIP DQ F   Y G F F+ WQ   W DVV+DDRLPT R RLV+LHS D NEFWSALLEKAYAK+ GSYEALKGGS+ EAMEDFTGG+ E F     AP N ++I+ K + R SL+GC I+     + EA+   GLIKGHAYS+T +  V+ +  R+ L+R+RNPWG   EW G++SD SPEW  +   E+KRL  T  DDGEFWM F+DF  +F K+EIC+L+P++ LE  A     KWE+ +  G W +  +AGGCRNF++TF  NPQ K+ + + DE   E   + ++ LMQK+ R  ++ G ++ TIGYAIY+  D       L+K +F+  AS A+S TFINLREV  R KLP G+Y+++PSTF   +EA F LRIFSE+   ++ +D   +I   D  +   P    +E     + +  F+ ++G D E+ A+EL+ +L+   + +++ KF   S  +C++++++MDT  +G+L F+EFKV WD L+ W  +F +FD D+SGT ++YE+R AL   GF++S+ +   I+ RYA+++  + FDD++
Sbjct:   29 FEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQT-KEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWGQ-VEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDA-LEEDA---IHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEE--CSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDK---DEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDI---DLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFL 652          
BLAST of Calpain-B vs. UniProt/SwissProt
Match: sp|P97571|CAN1_RAT (Calpain-1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn1 PE=1 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 303/673 (45.02%), Postives = 435/673 (64.64%), Query Frame = 1
Query:  328 KQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVK---VVDPDENDNENTG-TLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            KQ D E   G   +  K L +    + N +        LF+D  FP  + SL ++E  P       I+WKRP E+  N  FI DG +R D+ QG LGDCWLLAA++SL++   ++H+V+P  Q F   Y G F F+LWQFG W DVVVDD LPT  G+LV++HS   NEFWSALLEKAYAKV GSYEAL GG +SEA EDFTGG+TE +DL   AP +L+ I++K + R SL+GCSI  +D   +EA   K L++GHAYS+TD K V  +  RVNL+R+RNPWG   EW G +SD S EWN++   ER++L +  E DGEFWM+F+DF++ FTKLEIC+L+P++ L+++       W      G W++  +AGGCRN+  TF +NPQFK++   V D D+ D+  +G + ++ LMQK  R  R+ G+D+ TIG+A+YQ+ ++ A     L + +F   AS A+S  FINLREV  R +LP G+Y++VPSTF   +E  FLLR FSE+   ++++D++ +   PD K      V  EE+ ++   +  F  ++G D EI   ELQ IL+ +  K ++ + NGFS E+CRSMV +MD D +G+LG  EF +LW+ +R + T+F+KFD D+SG+ ++YE+R A+   GF+++ ++   IITRY+     + FD+++
Sbjct:   20 KQRDKELGLGRHENAIKYLGQD---YENLRARCLQNGVLFQDDAFPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQEGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTDAKQVTYQGQRVNLIRMRNPWG-EVEWKGPWSDNSYEWNKVDPYEREQLRVKME-DGEFWMSFRDFIREFTKLEICNLTPDA-LKSRT---LRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDSRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEK------VLSEEEIDD-NFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIITRYSEPDLAVDFDNFV 675          
BLAST of Calpain-B vs. TrEMBL
Match: A0A1I8HRD3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 415/720 (57.64%), Postives = 525/720 (72.92%), Query Frame = 1
Query:  295 INRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDF-DRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSV----NSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGI---KKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPP--EVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
             NR  P S    +  + S   S+     S  + K  F   K+ L +K  L+EDP FPA   S++Y   PP+  EWKRP E+  N  F   G SRFDV QGELGDCWLLAAV+SLSM+P L   V+P DQDF D DY G   FR WQFG W DV+VDDRLPT   RLV++HS D NEFWSALLEKAYAK+ GSYEALKGGS+SEAMEDFTGGITE +DL  S PP+L+  M+K   R+SLMGCSIEADP ++EA+   GLI GHAYSITDV++V      K+G V L+R+RNPWGN  EW GA+ D SPEW+ +S+ E+K++GL+F+DDGEFWM+FQDF   F KLEICHL P+S  E + G     K +WE    N  W+K VSAGGCRN+++TF  NPQF+VKV+DPDE+D+EN G++I+GLMQK MR +R EG DL TIGYAIY++KD   D   LD ++F+ TAS AK+P FINLREVCGRHKL  G YVIVPSTF   +EA+FLLRI+SE   +S ++D+ T +      +E+ P  E   +E A    L+ AF+ I+G D E+DA EL+ I++ +F++E FKF+GFS ETCRSMVA+MD DQSG+LGF+EFK LW+DLRLWKTVFKK+D D+SG FNSYE+RQALN +GFRV+N++F+ ++ RYA ++GII FDDY+L  VRL+TVF TFKAQ K  +G+A F Q+EF+Q ++Y+
Sbjct:    4 FNRNPPASAAASRGPATSRAASKKSAEISSGDEK--FRALKKELSSKKQLYEDPDFPAQPKSIFYSRQPPRPFEWKRPHELCDNPRFFVGGASRFDVRQGELGDCWLLAAVASLSMHPQLFDLVVPQDQDFTDADYCGVVRFRFWQFGEWTDVLVDDRLPTYNNRLVFMHSTDSNEFWSALLEKAYAKMMGSYEALKGGSASEAMEDFTGGITEFYDLRQSTPPSLFQTMVKANKRSSLMGCSIEADPNQIEAQLSNGLIMGHAYSITDVRTVEVNLRGKKGAVQLLRIRNPWGNEAEWKGAWGDSSPEWSILSEDEKKKMGLSFDDDGEFWMSFQDFCSNFQKLEICHLGPDSLNEEQLGAPDKNKRRWEALTHNSAWRKRVSAGGCRNYLDTFWTNPQFRVKVIDPDEDDDENKGSIIVGLMQKNMRKKRSEGLDLHTIGYAIYRIKDG--DDRPLDLKFFKCTASVAKAPAFINLREVCGRHKLDPGTYVIVPSTFEPNQEAEFLLRIYSETKNESGEMDDVTTV------EEVQPDREPTAQEKAQEKALKEAFQKIAGEDMEVDAYELRDIVNTAFQKE-FKFDGFSVETCRSMVALMDVDQSGKLGFDEFKTLWNDLRLWKTVFKKYDSDKSGNFNSYELRQALNAVGFRVNNKIFSCLVMRYATREGIIEFDDYVLCCVRLKTVFETFKAQPKDGQGKATFSQEEFLQTIIYV 712          
BLAST of Calpain-B vs. TrEMBL
Match: A0A267EIH1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019924g1 PE=3 SV=1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 414/720 (57.50%), Postives = 525/720 (72.92%), Query Frame = 1
Query:  295 INRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDF-DRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSV----NSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGI---KKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPP--EVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
             NR  P S    +  + S   S+     S  + K  F   K+ L +K  L+EDP FPA   S++Y   PP+  EWKRP E+  N  F   G SRFDV QGELGDCWLLAAV+SLSM+P L   V+P DQDF D DY G   FR WQFG W DV+VDDRLPT   RLV++HS D NEFWSALLEKAYAK+ GSYEALKGGS+SEAMEDFTGGITE +DL  + PP+L+  M+K   R+SLMGCSIEADP ++EA+   GLI GHAYSITDV++V      K+G V L+R+RNPWGN  EW GA+ D SPEW+ +S+ E+K++GL+F+DDGEFWM+FQDF   F KLEICHL P+S  E + G     K +WE    N  W+K VSAGGCRN+++TF  NPQF+VKV+DPDE+D+EN G++I+GLMQK MR +R EG DL TIGYAIY++KD   D   LD ++F+ TAS AK+P FINLREVCGRHKL  G YVIVPSTF   +EA+FLLRI+SE   +S ++D+ T +      +E+ P  E   +E A    L+ AF+ I+G D E+DA EL+ I++ +F++E FKF+GFS ETCRSMVA+MD DQSG+LGF+EFK LW+DLRLWKTVFKK+D D+SG FNSYE+RQALN +GFRV+N++F+ ++ RYA ++GII FDDY+L  VRL+TVF TFKAQ K  +G+A F Q+EF+Q ++Y+
Sbjct:    4 FNRNPPASAAASRGPATSRAASKKSAEISSGDEK--FRALKKELSSKKQLYEDPDFPAQPKSIFYSRQPPRPFEWKRPHELCDNPRFFVGGASRFDVRQGELGDCWLLAAVASLSMHPQLFDLVVPQDQDFTDADYCGVVRFRFWQFGEWTDVLVDDRLPTYNNRLVFMHSTDSNEFWSALLEKAYAKMMGSYEALKGGSASEAMEDFTGGITEFYDLRQNTPPSLFQTMVKANKRSSLMGCSIEADPNQIEAQLSNGLIMGHAYSITDVQTVEVNLRGKKGAVQLLRIRNPWGNEAEWKGAWGDSSPEWSILSEDEKKKMGLSFDDDGEFWMSFQDFCSNFQKLEICHLGPDSLNEEQLGAPDKNKRRWEALTHNSAWRKRVSAGGCRNYLDTFWTNPQFRVKVIDPDEDDDENKGSIIVGLMQKNMRKKRSEGLDLHTIGYAIYRIKDG--DDRPLDLKFFKCTASVAKAPAFINLREVCGRHKLDPGTYVIVPSTFEPNQEAEFLLRIYSETKNESGEMDDVTTV------EEVQPDREPTAQEKAQEKALKEAFQKIAGEDMEVDAYELRDIVNTAFQKE-FKFDGFSVETCRSMVALMDVDQSGKLGFDEFKTLWNDLRLWKTVFKKYDSDKSGNFNSYELRQALNAVGFRVNNKIFSCLVMRYATREGIIEFDDYVLCCVRLKTVFETFKAQPKDGQGKATFSQEEFLQTIIYV 712          
BLAST of Calpain-B vs. TrEMBL
Match: A0A5J4NR82 (Calpain, invertebrate OS=Paragonimus westermani OX=34504 GN=DEA37_0012115 PE=3 SV=1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 389/747 (52.07%), Postives = 509/747 (68.14%), Query Frame = 1
Query:  208 IVFSPIGFREMPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDT----DQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            I F P G  + PRF D       V  R + N    + PD   T ++ +  +R     S   S D     K  L+ +  LFEDP FPA + SLYY  +PP+K++W RP ++  N  FI  G SRFDV QGELGDCWLLAA++ LSM+  L  Q++P DQ F  +Y G F F  W +G W +VVVDDRLPTVRG L+Y+HS + NEFWSAL+EKAYAK+ GSYEALKGG++SEA+EDFTGGI EMF+L    PP+L  IM+K   R SLM CSI+ADP ++EA+   GLI GHAYS+T VK VN     + G + LVRVRNPWGN  EW GA+SDKS EW+ +SD  R+ +G+TF+DDGEFWM+++DFV+ F KLEICHL P+S L  ++  +   WEMC+E G W+  VSAGGCRNF+ETF +NPQ++V VVDPDEND++N GT+I+GLMQK  R  RK+G+DL TIGYA+Y++   +     LD  +F+  AS A+SP FINLREVCGRHKL  G YVI+PSTF   EEA F+LR+FSE+P  S+++DE   +  P        E + E       L+ AF  ++G DGEID +EL+ IL+V+F R+ FKF+GF+ E+CRSMVAMMD     D+S  L FEEFK LW+ LRLWKT FKKFD DQSG  NS+E+R AL  +GF V+N +F  ++ R++ + G I FDDY++   RL+T+F  + +  K ++ +A+F +  F+  VLYM
Sbjct:   38 IEFRPTGIIQFPRFKDPR-----VALRNAQNNKVVIPPDYGITSNKPVPSTRGGDLASTSLSYDQL---KAQLQQQGRLFEDPEFPAVDGSLYYSRSPPRKVDWLRPHQICSNPEFITGGASRFDVRQGELGDCWLLAAIACLSMHKNLFEQIVPEDQSFTSEYCGLFRFHFWHYGEWKEVVVDDRLPTVRGSLIYIHSTEKNEFWSALMEKAYAKLCGSYEALKGGTTSEALEDFTGGIAEMFELRDKCPPDLLKIMLKSQERCSLMACSIQADPNRIEAELPNGLIMGHAYSVTSVKVVNVSIPGRSGDIPLVRVRNPWGNEAEWKGAWSDKSREWSLLSDATRREVGITFDDDGEFWMSYEDFVRNFEKLEICHLGPQS-LGGESETRGRHWEMCVEQGSWKPRVSAGGCRNFLETFWINPQYRVTVVDPDENDDDNLGTMIVGLMQKNRRCLRKQGEDLLTIGYAVYELPQTS--GGTLDMNFFKYNASKARSPAFINLREVCGRHKLKPGNYVIIPSTFQPNEEADFMLRVFSEKPQTSEELDENVGVKDPIATVSTLNEQQVE------ALKRAFTKVAGEDGEIDCEELRDILNVAFTRD-FKFDGFTLESCRSMVAMMDVSFAFDRSSMLSFEEFKNLWNLLRLWKTAFKKFDVDQSGCMNSFELRNALKAVGFSVNNAIFATLVMRFSRRDGSILFDDYVICCARLKTLFDIYASTSKNTEDKAVFDETSFVNTVLYM 766          
BLAST of Calpain-B vs. TrEMBL
Match: A0A4S2LND8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007626 PE=3 SV=1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 388/731 (53.08%), Postives = 505/731 (69.08%), Query Frame = 1
Query:  235 EMPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGR-VNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            + PRF D       +  R + +    L  D  +T  + +  +R     S  +S D     K  L  +  LFEDP FP  ++SLYY + PP+ ++W RP E+ QN  FI  G SRFDV QG+LGDCWLLAA++ LSM+  L  QV+P DQ F   Y G F F  W+FG W +VVVDDRLPT    L+Y+HS + NEFWSAL+EKAYAK+ GSYEALKGG++SEA+EDFTGGI EMF+L S  PP+L+ IM+K   R SLM CSI+ADP + EA+   GLI GHAYS+T VK +++   R V LVRVRNPWG+  EW GA+SDKSPEWN+I    R+ +GLTFEDDGEFWM++ DF+  F KLEICHL P+S L     +   KWEMC+E+G W   VSAGGCRNF+ETF +NPQF V +VDPDE+D+ N GT+IIGLMQK  R  RK+G+DL TIGYAIY + ++      LD  +F+  AS A+SP FINLREVCGRHKLP G+Y I+PSTF   EEA+F+LRIF+E P  S++ID+   + A D    I P  + + +A    L+ AF  ++G DGEID++EL+ IL+V+F R +FKF+GF+ E+CRSM++MMD D+SG L F EFK LW+ LRLWKT FKKFD D+SG  NS+E+R AL  +GF ++N +F  ++ R+A + G I FDDY++   RL+T+F  FKA  KT++G AIF +  F+  +LYM
Sbjct:   46 KFPRFEDPR-----IALRKAKDNKVVLPFDAGETAKKPVPVTRGGALASTTQSYD---ELKVQLLQQGRLFEDPEFPPLDSSLYYSQPPPRPVQWLRPHEICQNPEFITGGASRFDVRQGQLGDCWLLAAIACLSMHKELFEQVVPGDQTFGSGYCGLFRFHFWRFGEWKEVVVDDRLPTYGKSLIYIHSTEKNEFWSALMEKAYAKLCGSYEALKGGTTSEALEDFTGGIAEMFELRSKCPPDLFKIMLKSQERCSLMACSIQADPNRYEARLANGLIMGHAYSVTSVKMIDTHTARQVTLVRVRNPWGDEAEWKGAWSDKSPEWNQIPAETRQLVGLTFEDDGEFWMSYTDFISNFEKLEICHLGPQS-LGGAGELPGRKWEMCVEHGSWVPRVSAGGCRNFLETFWINPQFSVNLVDPDEDDDVNEGTMIIGLMQKHRRKLRKQGEDLLTIGYAIYALPES--HSGTLDMNFFKYNASKARSPAFINLREVCGRHKLPPGRYAIIPSTFQPNEEAEFMLRIFAEHPQTSEEIDDA--VAAADTSALIQPLNEAQVEA----LKRAFTKVAGVDGEIDSEELRDILNVAFTR-DFKFDGFTLESCRSMISMMDFDRSGMLSFNEFKTLWNLLRLWKTAFKKFDVDKSGCMNSFELRNALKAVGFSINNSIFNTLVMRFARRDGSIAFDDYVICCARLQTLFEIFKASPKTTEGRAIFDETNFVNTLLYM 758          
BLAST of Calpain-B vs. TrEMBL
Match: A0A4S2LFH5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007626 PE=3 SV=1)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 388/731 (53.08%), Postives = 505/731 (69.08%), Query Frame = 1
Query:  235 EMPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGR-VNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            + PRF D       +  R + +    L  D  +T  + +  +R     S  +S D     K  L  +  LFEDP FP  ++SLYY + PP+ ++W RP E+ QN  FI  G SRFDV QG+LGDCWLLAA++ LSM+  L  QV+P DQ F   Y G F F  W+FG W +VVVDDRLPT    L+Y+HS + NEFWSAL+EKAYAK+ GSYEALKGG++SEA+EDFTGGI EMF+L S  PP+L+ IM+K   R SLM CSI+ADP + EA+   GLI GHAYS+T VK +++   R V LVRVRNPWG+  EW GA+SDKSPEWN+I    R+ +GLTFEDDGEFWM++ DF+  F KLEICHL P+S L     +   KWEMC+E+G W   VSAGGCRNF+ETF +NPQF V +VDPDE+D+ N GT+IIGLMQK  R  RK+G+DL TIGYAIY + ++      LD  +F+  AS A+SP FINLREVCGRHKLP G+Y I+PSTF   EEA+F+LRIF+E P  S++ID+   + A D    I P  + + +A    L+ AF  ++G DGEID++EL+ IL+V+F R +FKF+GF+ E+CRSM++MMD D+SG L F EFK LW+ LRLWKT FKKFD D+SG  NS+E+R AL  +GF ++N +F  ++ R+A + G I FDDY++   RL+T+F  FKA  KT++G AIF +  F+  +LYM
Sbjct:   36 KFPRFEDPR-----IALRKAKDNKVVLPFDAGETAKKPVPVTRGGALASTTQSYD---ELKVQLLQQGRLFEDPEFPPLDSSLYYSQPPPRPVQWLRPHEICQNPEFITGGASRFDVRQGQLGDCWLLAAIACLSMHKELFEQVVPGDQTFGSGYCGLFRFHFWRFGEWKEVVVDDRLPTYGKSLIYIHSTEKNEFWSALMEKAYAKLCGSYEALKGGTTSEALEDFTGGIAEMFELRSKCPPDLFKIMLKSQERCSLMACSIQADPNRYEARLANGLIMGHAYSVTSVKMIDTHTARQVTLVRVRNPWGDEAEWKGAWSDKSPEWNQIPAETRQLVGLTFEDDGEFWMSYTDFISNFEKLEICHLGPQS-LGGAGELPGRKWEMCVEHGSWVPRVSAGGCRNFLETFWINPQFSVNLVDPDEDDDVNEGTMIIGLMQKHRRKLRKQGEDLLTIGYAIYALPES--HSGTLDMNFFKYNASKARSPAFINLREVCGRHKLPPGRYAIIPSTFQPNEEAEFMLRIFAEHPQTSEEIDDA--VAAADTSALIQPLNEAQVEA----LKRAFTKVAGVDGEIDSEELRDILNVAFTR-DFKFDGFTLESCRSMISMMDFDRSGMLSFNEFKTLWNLLRLWKTAFKKFDVDKSGCMNSFELRNALKAVGFSINNSIFNTLVMRFARRDGSIAFDDYVICCARLQTLFEIFKASPKTTEGRAIFDETNFVNTLLYM 748          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 305/643 (47.43%), Postives = 431/643 (67.03%), Query Frame = 1
Query:  421 MLKAK----NSLFEDPFFPANNTSLYYREAPP-----QKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKS--LLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            MLKA+     SLFED  FPA+++SL + E  P     Q ++WKRP E+     FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F   Y G F F+ WQFG W DVV+DDRLP   G+L+++HS +  EFWSAL+EKAYAK+ G YEAL GGS+SE  EDFTGG+TEM++L   AP +L++I+ + V R SL+GCSI+      +EA   K L+KGHAYS+T V  V  +     LVR+RNPWG   EWTGA+SD S EW+ +    R RL +  E DGEFWM+F+DF++ F++LEIC+L+ ++ LE  AG  K KW  C+ NGEW++  +AGGCRNF  TF LNPQFKV +  PD+  + +  + ++ LMQK+ R +RKEG+D+ TIG+AIY++      +S   L + +F   AS A+S  FINLREV  R +LP G+Y+IVPSTF   +EA F+LR+FSE+P  ++++D+       D   E+P E + +E   +   ++ F+ ++G+D EI   ELQ IL+ +  K ++ K +GF  E CRSM+ +MDTD SG+LG  EF VLW+ ++ + TVF++FD D+SGT +SYE+R AL   GF+++N +F  II RY  +   + FD+++
Sbjct:   39 MLKARCLQSRSLFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFGSGYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYEL-KKAPSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTAVHEVVYRGTPTKLVRIRNPWGE-VEWTGAWSDNSREWDSVDSSSRARLQVRSE-DGEFWMSFRDFLQEFSRLEICNLTADA-LE--AGQVK-KWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEVPGQYVGQSGVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELDD-------DVTAELPSENQLDESQIDAGFKSLFRQLAGSDMEISVTELQTILNRIISKHKDLKTDGFGPEACRSMINLMDTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTEEDLTVDFDNFV 666          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 294/643 (45.72%), Postives = 419/643 (65.16%), Query Frame = 1
Query:  421 MLKAK----NSLFEDPFFPANNTSLYYREAPP-----QKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSR---ETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            MLKA+     SLFED  FPA+++SL + E  P     Q ++WKRP E+     FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F   Y G F F+ WQFG W DVV+DDRLP   G+L+++HS +  EFWSAL+EKAYAK+ G YEAL GGS+SE  EDFTGG+TEM++L   AP +L++I+ + V R SL+GCSI+      +EA   K L+KGHAYS+T   +V  +     LVR+RNPWG   EWTGA+SD S EW+ +    R RL +  E DGEFWM+F+DF++ F++LEIC+L+ ++ LE  AG  K KW  C+ NGEW++  +AGGCRNF  TF LNPQFKV +  PD+  + +  + ++ LMQK+ R +RKEG+D+ TIG+AIY+    +     L + +F   AS A+S  FINLREV  R +LP G+Y+IVPSTF   +EA F+LR+FSE+P  ++++D+       D   E+P E + +E   +   ++ F+ ++G+D EI   ELQ IL+    +  F  + +     + C      + TD SG+LG  EF VLW+ ++ + TVF++FD D+SGT +SYE+R AL   GF+++N +F  II RY  +   + FD+++
Sbjct:   39 MLKARCLQSRSLFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFGSGYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYEL-KKAPSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVT---AVVYRGTPTKLVRIRNPWGE-VEWTGAWSDNSREWDSVDSSSRARLQVRSE-DGEFWMSFRDFLQEFSRLEICNLTADA-LE--AGQVK-KWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEYVGQS--GVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELDD-------DVTAELPSENQLDESQIDAGFKSLFRQLAGSDMEISVTELQTILNRIISKREFSDSLYCLIFFDRC------IQTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTEEDLTVDFDNFV 655          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: si:dkeyp-50d11.2 (si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-22])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 284/632 (44.94%), Postives = 407/632 (64.40%), Query Frame = 1
Query:  442 LFEDPFFPANNTSLYYREAPP-----QKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADP-TKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKS--LLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            LFED  FPA  +SL ++E  P     + + W RP E   +  FI DG +R D+ QG LGDCWLLAA++ L++   L+H+V+P  Q F   Y G F F+ WQFG W DVV+DDRLP   G+L+++HS +  EFWSAL+EKAYAK+ G YEAL GG +SE  EDFTGG+TEM++L   APPNL+ I+ + V R SL+GCSI+      +EA   K L+KGHAYS+T V  V  +     L+R+RNPWG   EWTGA+SD+S EW+ I+   R RL    E DGEFWM+F DF+K F++LEIC+L+ ++   ++      KW   +  GEW++  +AGGCRN+  TF +NPQ+K+ + DPD  + ++  + ++ LMQK  R  R+EG+D+ TIG+AIY++       +   L + +F    S A+S  FINLREV  R  LP G+Y+IVPSTF   +E  F+LR+FSE+  DS+++D+  E+ A     ++P E    E   +   +  F  ++G D EID  +LQ IL+ V  K ++ K +GF +E CR M+++MDT   GRLG  +F VLW+ ++ + T+F++FD D+SGT +SYE+R AL   GF+++N +F  II RYA     + FD+++
Sbjct:   50 LFEDETFPAQPSSLGFKELAPGSAKTRGVRWMRPTEFCDDPHFIVDGATRTDICQGALGDCWLLAAIACLTLNEPLLHRVVPHGQSFHYQYAGIFHFQFWQFGDWVDVVIDDRLPVRDGKLLFVHSDEGAEFWSALVEKAYAKLNGCYEALSGGCTSEGFEDFTGGVTEMYEL-RKAPPNLFSIIRRAVERGSLLGCSIDITSFFDMEAVTFKKLVKGHAYSVTGVDEVEFRGNLTKLIRIRNPWGE-VEWTGAWSDESREWSGINPALRSRLHNRAE-DGEFWMSFSDFLKEFSRLEICNLTADALQSSEL----KKWNSSLYTGEWRRGSTAGGCRNYPATFWINPQYKIMLKDPD-TEGQDGCSFLVALMQKNRRQLRREGKDMETIGFAIYEVPLQFLGMAGVHLKRDFFLTNTSSARSELFINLREVSSRFCLPAGEYIIVPSTFEPQKEGDFVLRVFSEKAADSQELDD--ELTA-----DLPEEDALPESEIDEGFKALFAKLAGKDMEIDVPKLQMILNRVISKHKDLKTDGFGKEACRCMISLMDTSGCGRLGLTDFHVLWEKIKRYLTIFREFDLDKSGTMSSYEMRLALESAGFKLTNNLFQLIILRYAKPDLNVDFDNFV 666          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: capn1a (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103024720])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 280/634 (44.16%), Postives = 421/634 (66.40%), Query Frame = 1
Query:  442 LFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPT-KVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKD--NAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            LFEDP FPA   SL ++E  P       +EW RP E+  +  FI  G +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F  DY G F F+ WQFG W D+V+DDRLP   G L+++HS + NEFWSAL+EKAYAK+ GSYEAL GGS++E  EDFTGG++EM++L    P +L+ I+ K +   SL+GCSI+   T  +EA   K L+KGHAYS+T ++ VN +     L+R+RNPWG   EWTGA+SD S EW+EI   ER+ L L  E DGEFWM+F +F++ F++LEIC+L+P++  ++      S W     +G W++  +AGGCRN   TF +NPQ+K+ +++ D++  ++    + ++ L+QK+ R  R++GQD+ TIG+A+Y++ +         L K +F   +S A+S TFINLREV  R +LP G+Y+IVPSTF   +EA F+LR+F+E+  +++++D+  EI A     ++  E +  ED  +   ++ F  ++G D EI   EL+ IL+ V  + ++ K +GFS E+CR+MV +MD D S RLG  EF++LW+ +R W  ++++FD D+SGT +SYE+R A+   GF+++NR+   ++ RYA  + +I FD++I
Sbjct:   48 LFEDPCFPAEPPSLGFKELGPHSSKTSGVEWMRPTELCDDPQFILGGATRTDICQGALGDCWLLAAIASLTLNEKLLHRVVPHGQSFQDDYAGIFHFQFWQFGEWVDIVIDDRLPVKDGELMFVHSAEGNEFWSALIEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYEL-RKPPRDLYRIISKALELGSLLGCSIDITSTFDMEAVTFKKLVKGHAYSVTGLRQVNFRGDLQRLIRIRNPWGQ-VEWTGAWSDNSSEWDEIDPTEREDLCLQME-DGEFWMSFNEFLRQFSRLEICNLTPDALSDDGL----SHWNTIQFHGSWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDDEVACSFLVALLQKDRRRYRRQGQDMHTIGFAVYEIPEEFRGCQNVHLKKNFFLSHSSCARSETFINLREVSARLRLPPGEYLIVPSTFEPSKEADFVLRVFTEKQSETEELDD--EISA-----DLEDEEEITEDDIDDSFKSMFAQLAGEDMEISVHELRTILNRVVLRHKDLKTDGFSMESCRTMVNLMDKDGSARLGLVEFQILWNKIRKWLVIYRQFDLDKSGTMSSYEMRLAVESAGFKLNNRLNQILVARYAENE-VIDFDNFI 666          
BLAST of Calpain-B vs. Ensembl Cavefish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 284/659 (43.10%), Postives = 425/659 (64.49%), Query Frame = 1
Query:  358 SRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRG---RVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVV--DPDENDNENTG-TLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            SR    K  K  KD+   + + ++ K  LF+DP FPA+++SLYY +  P K+ WKRP E+ +N  FI  G +R D+ QG+LGDCWLLAA++ L++   L+++V+P+DQ F  +Y G F F+ W++G W DVVVDDRLPT    LV+  S + NEFWSALLEKAYAK+ G+YEALKGG++ EAMEDFTGG+TE +++ S AP  +++IM K + R SLMGCSI++  P+  E K + GL++GHAYS+T V+    + G   R+ LVR+R+PWG +       S  S +W+ ++  E+ +  L   + GEFWM F++F + FTKLEIC+L+P++  +++      KW++ +  G W +  SAGGCRN+ +TF  NPQ+++++   D DE D+   G T+++ LMQK  R  R  G  L TIG+AIY+M  N   K  L K +F  TAS A+  ++INLREV  R  L  G+YVIVPSTF+   E+ F+LR+FSE+   S+       ++  D    + P+ + EE     + +  F+ I+G D +I+A EL+ + + +  K +  K  GFS ++CRSM+A+MDTD +GRL  EEFK LW  ++ WK +F ++D D+S + +S+E+R A+   GF+++ ++   I  RYA++   + FD YI
Sbjct:   52 SRNEAVKDAKRLKDFLELRDKYVR-KKVLFKDPLFPADDSSLYYNQKFPLKLVWKRPSEICKNPQFIVGGANRTDICQGDLGDCWLLAAIACLTLSETLLYRVVPADQSFSENYAGIFHFQFWRYGEWVDVVVDDRLPTSNNHLVFTRSGNKNEFWSALLEKAYAKLHGTYEALKGGNTLEAMEDFTGGVTEFYEI-SDAPREIYNIMKKALNRGSLMGCSIDSLVPSASETKTDTGLVRGHAYSVTAVEQGKQEDGSDTRIRLVRLRDPWGVA----PPPSRMSCDWSSLATSEQDQQRLKPVEAGEFWMGFEEFQQTFTKLEICNLTPDALQDDEL----LKWDVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLTEEDDDEPDHGEKGCTVVVALMQKGRRRERCTGGTLLTIGFAIYEMHGN---KQHLPKDFFLYTASKARCKSYINLREVTERFCLSPGEYVIVPSTFDPNNESDFILRVFSEKTSTSEL---SGAVIEAD--PCVLPKSEDEESDEEKQFRAMFQQIAGDDMQINAKELRSVFNKLLTKYKGLKTEGFSLDSCRSMIALMDTDGTGRLNLEEFKHLWSKIQQWKLIFSRYDRDKSSSISSFEMRNAVADAGFQLNPQLHDIIAMRYASEHLYLDFDSYI 692          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 304/765 (39.74%), Postives = 451/765 (58.95%), Query Frame = 1
Query:  403 FYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE---------------------------------------------ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKV--VDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAY-DKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQ-----------------------------------------PYDSKQIDEKTEIVAPDWKKEIPPEVKREEDAN--NVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            F   + +  + + LFEDP FPA+N S+Y+ +  P + +W RPKE+    + + +  +   + +G+LGDCW+LAA++ ++M   L+ +VIP+ Q F+ +Y G F F+ W+FG W DVVVDDRLPT   +LV++ S + NEFWSALLEKAYAKV GSYEALKGG+++EAMEDFTGG+TE F++  + P +L+ IM+K  +R SLMGCSI+                                             A  T  E++   GL++ HAYSIT +  V  +   V LVR+RNPWG+  EW G +SD S EWNEI+  E++RL L   +DGEFW++FQDF + FTKLEIC+LSP++  +++     +KW + +  G W +  SAGGCRN+ +TF  NPQ+++++   D D +DNE   + I+ LMQK  R  R++G  + TIG+AIY++ +     +  L K +F   AS A+  ++INLREV  R +LP G+YVIVPSTF   +E +FLLR+F+E+                                         P +S+  D   E   P   K   PE  +E D    + + +  FK ++G D E+ A +L  IL+ V  K ++ K +GFS E+CR+MVA+MDTD SG+LG+ +FK LWD L+ W+ +F+K+D D+SG+  SYE+R A+N  G++++N+++  I  R+A++   I FD++I  L+RL  +F  FKA  K   G       E++Q  +Y
Sbjct:   53 FEELRTLCLSHDVLFEDPDFPAHNNSIYFSQNAPMQFQWMRPKELCVPRSIVIEA-NHTHICEGDLGDCWVLAAIACMTMNEELLARVIPAGQSFEENYAGIFHFQFWRFGEWVDVVVDDRLPTFNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTEYFEM-KNPPKDLYKIMVKATSRRSLMGCSIDDGMCWRCGVPAPDSIGLVRSNMSPPILRHIQLTPIGIEDAKKRKIAMLTHAESRTPMGLVRNHAYSITGLDEVKHRSKIVQLVRLRNPWGH-VEWIGPWSDASKEWNEITPSEKQRLQLISAEDGEFWISFQDFCRNFTKLEICNLSPDALADDRT----NKWTVSVSEGRWVRGCSAGGCRNYPDTFWTNPQYRLQLYDEDDDPDDNELLCSFIVALMQKNRRKERRQGSTMLTIGFAIYEVTEELRGSREHLPKDFFLYNASRARCNSYINLREVTERFRLPPGEYVIVPSTFEAHQEGEFLLRVFAEKHNVSEEMDDIIGVKKKSKKKKNKPIVFISDRTKKGQQQPESPDESEPEDGNEEESEPKSNKLAEPENPKEPDLTPEDKQFKTIFKQLAGDDMEVGAADLHNILNKVITKHKDLKTSGFSLESCRTMVALMDTDLSGKLGYNDFKYLWDKLKFWQQIFRKYDSDKSGSMTSYEMRLAINEAGYQLNNQLYQIITLRHADENLNIGFDNFIACLIRLEAMFRAFKAFDKDGDGIIRLNVLEWLQLTMY 810          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 277/581 (47.68%), Postives = 388/581 (66.78%), Query Frame = 1
Query:  511 IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMF--RLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN---TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEK--TEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIG 2226
            ++W   +E+ QN  FI DG +R D+ QG LGDCWLLAA++SL++   L+ +V+P  Q+F   Y G F F  + W FG W DV +DDRLPT  G+LV++HS D  EFWSALLEKAY+K+ GSYEALKGGS +EAMEDFTGG+ E+ DL  +APP+L+ IM K   + S+MGCSI+  + ++ EA+   GL+KGHAYSIT V  VN +  +V L+R+RNPWG   EW GA+SD +PEW  +   ER RL     +DGEFWM+F DF+++FTK+EIC+L+P+  +E +   +   W + + +G W K  +AGGCRNF ETF  NPQF++K+ + D+  +E      + I+ LMQK M   RK+ +++ T+GYAIY++ D       + K +F   AS A+SP+FINLREV  R +LP G+YVIVPSTF   +EA FL+R+F+E+P  SK+ D+K   EI   D  K   P  + E+D    K +  F  ++G D EI   ELQ +L+ ++ K    +  GFS   CRS+VA+ D D SG+LG +EF++LW+ ++ W+ +F+K DED SGT +SYE++ ALN  G
Sbjct:    2 VKWGLSREIVQNPEFIVDGATRTDIKQGALGDCWLLAAIASLTLNDQLLAKVVPPGQNFRDGYAGIFHFQQKFWHFGEWMDVFIDDRLPTKNGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTGGVYELLDL-KTAPPDLFRIMCKARQKGSMMGCSIDVTNASESEARTSNGLVKGHAYSITGVDEVNYRGQKVKLLRIRNPWG-EVEWNGAWSDHAPEWKALDQGERNRLQQVMAEDGEFWMSFDDFMRHFTKMEICNLTPD-RVEREGDPR--YWTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRLKLHNEDDEADETGSKACSFIVALMQKNM---RKQQRNMLTMGYAIYKIPDQT---GPMPKEFFLYNASKARSPSFINLREVSQRFRLPAGEYVIVPSTFEPHQEADFLVRVFAEKPNRSKESDDKIGAEIDLNDVAK---PGTETEDDR---KFKTLFGRLAGEDMEISPKELQDMLNKITAKHGELESTGFSMHACRSIVALTDVDGSGKLGLQEFRILWNKIKKWQAIFRKHDEDLSGTMSSYEMKNALNAAG 565          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 496.123 bits (1276), Expect = 6.232e-165
Identity = 298/737 (40.43%), Postives = 420/737 (56.99%), Query Frame = 1
Query:  520 KRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPT-------------KVEAK-----------AEKGLIK--GHA-----------------------------YSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDK-SLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQ-----------------------------------PYDSKQIDEK---------TEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            + P+E+  N  FI +G +R D+ QG LGDCWLLAA++SL+++P L+ +V+P  Q F   Y G F F+ WQFG W DVV+DD LPT   +L +LHS D NEFWSALLEKAYAK+ GSYEALKGGS +EAMEDFTGG+ E ++L   APP+L+ IM KG+ +AS+MGCSI+   T             K+ A            AE+ L    GHA                             YSIT +  V  +   V LVR+RNPWG   EW GA+SD S EW  +   ER+RL     +DGEFWM+F DF + F+K+EIC+LSP++ L  ++G +   W +    G W +  +AGGCRN+  TF  NPQF +++ + D++ +++    + I+ LMQK MR +++   DL TIGYAIY++   A    + L   +F   +S A+S  FINLREV  R +LP G YVIVPST+   +EA FLLR++ E+                                   P   + +DE          +E V    +  +P EV   E   + +    FK ++G D EI   ELQ +L+ V+ K + FK +GFS   C+SMVA+MD+D SG+LG  EFK+LW+ +++W+ +F+K+DED+SGT +SYE+R ALN  GF ++N+++  I  RYA++   I F+DYI  +VRL  +F  F A  K  +G        ++Q  +Y
Sbjct:    1 RAPQEICYNPQFIVNGATRTDIKQGALGDCWLLAAIASLTLHPRLLARVVPEGQSFSDGYAGIFHFQFWQFGEWVDVVIDDLLPTQNNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTGGVFEFYNL-KKAPPDLYRIMRKGLEKASMMGCSIDEGSTFKYRSTPRAINMSKMTATFRAWSSGIRRFAERFLPSRLGHARLLASSGIEITSMFDLEARLPNGLVKGHAYSITGLDQVFFEGQDVRLVRIRNPWGE-VEWNGAWSDNSWEWRVVDVSERRRLEQVRAEDGEFWMSFSDFKRNFSKMEICNLSPDT-LRTQSGSR--HWTVTAHEGRWLRGCTAGGCRNYAGTFWTNPQFHLRLHEEDDDPDDDEVACSFIVALMQKNMRRQKR---DLLTIGYAIYEIPLKAPPGCTHLPGEFFVRNSSRARSHNFINLREVSDRFRLPPGHYVIVPSTYEPHQEADFLLRVYCEKMNRSRGETKHNSVSKGRPIFRGAFKQVSNLGGCGGPNCYRVVDEHIADEILKSNSERVGEAVQPSMPVEVV--ETDEDRRFTQVFKKLAGEDMEISPRELQDLLNKVTAKLKVFKSDGFSLYACQSMVALMDSDGSGKLGLPEFKLLWEKIKMWQAIFRKYDEDRSGTMSSYEMRAALNAAGFHLNNQMYQLITMRYADESMTIKFNDYITCMVRLEAMFRIFHALDKDKRGVIRLGLGLWLQLTMY 727          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 445.662 bits (1145), Expect = 8.175e-146
Identity = 255/657 (38.81%), Postives = 377/657 (57.38%), Query Frame = 1
Query:  376 KSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPP------QKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE--ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCR--NFIETFHLNPQFKVKVVDPDENDNENTGT-LIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR-ENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            ++ K     F   K+    +  LFEDP FPA+ +SL+ R  P         IEWKRP E+ ++  FI  G +R D+ QG L DCWLL+A++SL++YP L+ +V+P  Q F  DY G F+FR  Q+G W DV VDDRLPT +G LV++ S   NEFWSALLEKAYAK+ G YEAL  G   EA+ DFTGG+ E F + ++AP + WD + + + + +++ C IE  A   + E     GL++GHAYSIT V  +      V L+RVRNP+G   E+TG +SD S  WNE+ + ++KRL +  E DGEFW++ +DF K F  +EICH   E E+E+    +K+ W   + N  W K ++AGG R     + F LN QF + +++ D   +   G   ++ L QK  R  RK G D   IG  IY+          L  +  +      +SP FI  REV  R  LP G Y+I+P T + G+EA+FLLRIF E+    + +  + E V P + + + P       A N  ++ +F  ++G D  I AD+LQ ++ +  ++      + FS E+CR +VA+ D D SG+LG+EEF ++W+ +++    +K  D D+SGT +S E+  AL H  F+V   +   I+ R++     I+FD ++
Sbjct:   21 RNFKTKSKTFQEIKKECLQRKILFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFIVSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPMGQSFHEDYAGIFLFRFCQYGEWVDVHVDDRLPTKKGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGETFTM-NNAPRDYWDGISRAIKKGAIICCGIETLAASGRGEKVTPMGLVEGHAYSITGVIKLKFPGKTVQLIRVRNPYGK-VEYTGPWSDGSTTWNEVPEEDQKRLHVRAE-DGEFWISDKDFRKNFHLVEICHQGSEVEIEH----RKNLWICELHNSMWLKGLNAGGSRRHRVFKEFPLNYQFFLTLLEEDNVMDVCHGCHFLLSLTQKHRRKFRKIGIDFVPIGIYIYKA---VVPGKKLTPQQLRKEKPLVESPEFIARREVTMRMTLPPGNYIIIPCTESAGQEAQFLLRIFMEKAQQHQGLASQLE-VTPYFPRMVSP-----PPAENFDMEESFLQVAGKDKLIKADKLQALITLEIQKYTTVVVDKFSMESCRVLVALFDIDNSGQLGYEEFLLVWEFIKMTLKTYKMCDVDKSGTLSSTELPMALEHSRFKVGKLMQRLIMMRFSEPNLTISFDSFV 661          
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007888.1 (pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1 gene:ENSPMAG00000007039.1 transcript:ENSPMAT00000007888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 374.785 bits (961), Expect = 2.383e-120
Identity = 212/530 (40.00%), Postives = 301/530 (56.79%), Query Frame = 1
Query:  853 KVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVV--DPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDN--AYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPD--------WKKEIPPE----------------VKREEDANNV-----------KLQNAFKVISGADGEIDADELQQILD--VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIIT--FDDYI 2310
            ++ GSYEAL GGS++E  EDFTGG+ E  +L +  P NLW ++ +   R SLMGCSI        EA   + L+KGHAYS+T    V+ +   V LVR+RNPWG   EWTGA+SD +P+W  +SD +R RL ++ ++DGEFWM+F+DF++ F++LEIC+L+P++  ++  G     W      G W +  SAGGCRNFI       +F +K    D D +DNE   T I+ LMQKE R +R++G D+ T+GYAIY++ +      +  L K YFQ  +S A+S  FINLREV  R  LP G+Y++VPSTF   +EA F+LRIFSE+   +      T   +P             IP +                  R  DA              +    F  ++G D EI A ELQ IL+  VS        +GF  E CRSMV++MD D + +LG +EF  LW  ++ W+ +F ++D D +GT NS E+R AL   GFR++ ++   + TRYA+ +  IT  FD+Y+
Sbjct:    1 RLQGSYEALSGGSTTEGFEDFTGGVAESIEL-NKPPSNLWRMLQQATLRGSLMGCSINITSQADSEAITSRKLVKGHAYSLTGTTEVDYQGQMVRLVRIRNPWGQ-VEWTGAWSDNAPQWGYVSDEDRGRLQVS-QEDGEFWMSFEDFLRQFSRLEICNLTPDALDDDSLG----HWSANNFEGSWVRGCSAGGCRNFIVHLWEKWKFHLKHTEEDDDPHDNEAGCTFIVALMQKERRKKRRQGGDVLTVGYAIYEVPEQFVGQPQVKLKKDYFQYHSSKARSEVFINLREVSQRFTLPAGEYIVVPSTFEPNQEADFILRIFSEKQSVTVSARTTTSNTSPHSPTHTCTYTNTRIPHDGCSHTRERAHSRARTPTPRHSDAPTSFTSFKFSSTCPRFYKLFDRLAGEDQEISAKELQSILNRVVSKLHSTVTTDGFGLEACRSMVSLMDKDGTAKLGVKEFNFLWKKIKNWQQIFLEYDTDSTGTMNSMEMRLALEAAGFRLNEKLNQIVTTRYADGENGITIDFDNYV 523          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 314/673 (46.66%), Postives = 446/673 (66.27%), Query Frame = 1
Query:  415 KRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSD---QDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGR----VNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREE-DANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQ 2409
            +R +++    FED  F A ++S+++ + PP+  EWKRP ++ ++      G SR D+ QG LGDCWLLAA+++L+ + ALM++V+P D      DR+Y GA  F +WQ+G W DV++DDRLPT  G+LV++HS + NEFWSALLEKAYAK+ GSYE+LKGG + EA+EDFTGG+ E FDL  + P +L+ IM     R +LMGCSI A   ++EAK   GL+KGHAY++T  + V +K  R    V LVRVRNPWGN  EW GA+ D S EW  +SD E+K +GLTFEDDGEFWM+F DF K+FT LEIC L  +S +E  +      +E   E+G W++ ++AGGCRNFI+TFH NPQF++  +   ++D ++  T+II LMQK+ R  +K G +  TIG++IY++++    +  LD  +FQ  AS A+SP FIN REV GR+ LP G+YV++P+TFN  EE  F+LR++SE+ + + ++DEKTE  AP  ++ +  ++ RE+ D  N K +  F  +SG DGEIDA ELQQIL  + K  +     FS E  RS+++M D D SG+LGFEEFK  W  ++ W  +F+ FDED+SG  ++YE+R AL   GF +SN V  A+  RY+   G +  DD++ +L RL  +   F+ Q       A F  D+F++
Sbjct:   10 RRQVRSTGKPFEDDEFLAIDSSIFFSKRPPRPFEWKRPSDICEDPHMFVGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVPQDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPTYNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAESFDLNKNVPKDLFCIMQTAEKRHALMGCSIAAKANEIEAKLNNGLVKGHAYTVTGCRQVKAKTRRGDLDVELVRVRNPWGNEREWKGAWGDGSSEWQLLSDYEKKSIGLTFEDDGEFWMSFDDFKKHFTTLEICMLGADSAMEGSS----VGFESRSEHGMWRRGLTAGGCRNFIKTFHKNPQFRI-TLQDSDDDADDLCTVIIALMQKDRRKEKKHGINPLTIGFSIYKLEEEKDKQGNLDMEFFQYHASTARSPVFINSREVVGRYALPPGEYVVIPTTFNPNEEGNFVLRMYSEKAHKTCEVDEKTEF-APQHQRRV--QISREQHDTLNSKFKEFFDNLSGRDGEIDAKELQQILSTALK-NDLGGKPFSLEGARSIISMYDEDASGKLGFEEFKETWLQVKKWMKIFQVFDEDKSGEMDTYELRGALKEAGFTLSNSVLYAVSARYSTGDGKVNVDDFMEILTRLNILSAAFQKQAGQGGRRAAFDIDQFLE 673          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 300/657 (45.66%), Postives = 425/657 (64.69%), Query Frame = 1
Query:  370 VSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDR-DYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA---DPTKVEAKAEKGLIKGHAYSITDVK--SVNSKRGR--VNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQ--NAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            +S+     ++ F + +R L     LFED  FPA+N  L+ R    Q I WKRP E+ ++  FIA G S  DV QG + +CW +AA++ L+    L+H V P DQ F+   Y G F F  WQFG W +++VDD LPT  GRL +  S D +EFWSALLEKAYAK+ GSYEA+  G  SEA++D TGG+ E  DL  + P  L+++MMK   R SLMGCSIE       + E   E GLI  HAYSIT ++  +++S RGR  V+L+R+RNP  NS EW GA+SD+SPEWN +S  E++ L LTF+DDGEFWM+F DF+  FT+LEIC L+P+S  +N     + KW++  E G WQK V+AGGCRNFI +F+ NPQF+V + +PD++D+E   T+I+ LM+ +  S R +  D   IG+AIY+   +      LD+ +F+   + A + +F  LRE+  R++L  G+YV++PSTFN G+E  FLLRIFSE+P  + +ID++T++ +       P  V  ++DA ++  +  + F  ++G DGE+D  ELQ+IL  SF RE    N F+ E CRSM++M DTD+SG LG+ EF+ L   L  WK  F K+D D SG  N+YE+R ALN +G+++SN   ++++ RY NK+G I+FD +I
Sbjct:    1 MSRRALHKRERFASLQRQLLNSKRLFEDRDFPASNRVLFTRRRSVQLI-WKRPHEISKSPQFIARGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCPPDQSFEPGSYCGMFRFNFWQFGEWVEIIVDDYLPTYNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENVDL-QNPPHGLFNVMMKAYERQSLMGCSIEVKKYSSDQYEGTLENGLITRHAYSITGLRKATLSSLRGRPEVDLIRLRNPHANSSEWRGAWSDRSPEWNMLSSQEKRELNLTFDDDGEFWMSFDDFLNNFTRLEICMLTPDSMEQN----DRRKWDVQNEKGRWQKGVTAGGCRNFIASFYTNPQFRVCLKNPDDDDDE-LCTVIVSLMRVD-HSHRVKIPDRAPIGFAIYKAPSDMRKGDRLDRAFFEYNKAVAMTTSFSKLREISSRYRLHAGEYVVIPSTFNPGQEGDFLLRIFSERPQYASEIDQETKMTSG------PKVVITQDDAKSIDHEFWDVFHQMAGEDGEVDQYELQEILSKSFTRE-LNNNLFALEACRSMISMFDTDRSGALGYNEFRALMILLEKWKNHFHKYDRDHSGDMNAYELRDALNGLGYQLSNSAMSSLVLRYHNKRGTISFDTFI 642          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 354.369 bits (908), Expect = 3.493e-111
Identity = 204/524 (38.93%), Postives = 302/524 (57.63%), Query Frame = 1
Query:  400 WFYNQK-RMLKAK----NSLFEDPFFPANNTSLYY-REAPPQKIEWKRPKEMQQNVA--FIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSD--QDFD----RDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPP-------NLWDIMMKGVTRASLMGCSIEADP-TKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNL--------VRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKK--SKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKS--PTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDW 1869
            +F NQ+   LKA+      LF D  F    +SLYY R  PP+ +EWKRP E+          DG    DV QG+LG+CW +AA SSL++ P L+++VIP    Q++D     +Y G F FR ++ G W +VVVDD LPTV G+LVY+HSK+ NEFWSAL+EKAYAK+AG+YEAL  GS+++A+ DFTGG+ E   L +            L+  + +G    SLM  SI+ +   ++E + + GLIKGHAY +T VK V    G ++L        +R+RNPWG   EW G +SD+S EW ++   +RK++G+ FE+DGEFWM F DF + FT   +CH+       NKA I K   +W +   N  W +  +AGGC    +TF  NPQ+   + D   N+ E+    ++ LMQ++ R  + +G    TIG+ I ++++N         R +++ + F K+    FIN REV  R  L  G+Y++VPST+       F++RIF+ +  ++  +D+   + +  W
Sbjct:    6 YFANQRYSKLKAECEKNEQLFVDSVFKPETSSLYYSRSCPPEPVEWKRPSEICHPAVPHLFVDGADSHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKPENYQGIFRFRFYRQGEWTEVVVDDLLPTVNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISLSNGGYAEDQEKRLQLFKTLERGHKEKSLMSASIKINNRNEMEQRLDTGLIKGHAYGVTMVKKVTVGEGLLSLFNKKHFYMIRLRNPWGEK-EWNGRWSDESEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCTLCHVI------NKAMIHKVFKQWHIYKHNYNWTQGQNAGGCVQNQDTFLKNPQYAFSITD---NEGEDA---MVSLMQEDRRKDKSKGVGNLTIGFYIMKVEEN---------RKYRVHSMFPKAGDSIFINAREVMNRFFLAAGRYLVVPSTYEPHTPGHFMMRIFTRKRSNAMFLDQDHSVGSKIW 507          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 328.946 bits (842), Expect = 8.046e-102
Identity = 192/506 (37.94%), Postives = 265/506 (52.37%), Query Frame = 1
Query:  529 KEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSD----QDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQI--------------TASFA--KSPTFINLREVCG---------------------------------------RHKLPIGKYVIVP-------STFNQGEEAKFLLRIFSEQPYDSKQIDEKT 1848
            +E+     F  DG SR D+ QG LG+CWLLAA+S L+ +  L+ +++P        F   Y G  +F+LWQ+G W  V++DDRLPT +G+LV++HS + NEFW ALLEKAYAK+ GSYEALKGG + EA+EDFTGG++E+F L   AP NL+ IM +   R++LMGCSI                              S RG V L+R+RNPWG+  EWTGA+ D+SPEW E+S  E++ L L F+ DGEFWM+F+DF  +F KLE+C L  E+ ++       S+    +ENG W+K+VSAGGCRNF+ETFH NPQF++          E TG  +  +  + M     EG     IG+A+Y++ +    K L +   F +                 FA  K    +  R +CG                                         +  +G++ + P       STF Q  EA FLLRIFSE+   S  + E T
Sbjct:   11 QEICSEPRFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMPEGVYEADRFSPRYTGKVVFKLWQYGEWVTVIIDDRLPTYKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSEVFVL-EDAPANLFQIMQRAEKRSALMGCSINV--------------------------FLSTRGGVELIRIRNPWGDEKEWTGAWGDRSPEWQELSQDEKRSLDLEFDVDGEFWMSFEDFKSHFDKLEVCMLDVENAIDKTQISFNSR----LENGFWRKHVSAGGCRNFLETFHTNPQFRLVSRVMSRMICEGTGFALYKVSNRVMSREICEG-----IGFALYKVSNRVISKVLCEGTGFALYKVSNRVISRVICEGTGFALYKVSNRVISRVICGGIGFALYKIDDITKRKYGVSRLDKEYFQFNKSTERSTFINSREVVGRFELAPGEYVIVPSTFIQNAEADFLLRIFSEKAVSSSALTEST 480          
BLAST of Calpain-B vs. Ensembl Nematostella
Match: EDO37991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE78])

HSP 1 Score: 152.91 bits (385), Expect = 1.049e-38
Identity = 110/327 (33.64%), Postives = 164/327 (50.15%), Query Frame = 1
Query:  427 KAKNSLFEDPFFPANNTSLYY---REAPPQKIEWKRPKEM------QQNVAFIADGLSR-FDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPT-VRGRLVY--LHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDL-------GSSAPPN---LWDIMMKGVTRASLMGCSIEAD--PTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWN-EISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHL 1329
            K +   F D  FP    SLY        P+  +W RP E+      + N+ +      R  D++QG LGDCW L++++ L+  P L+ +++ + +   +   GA+  RL + G W  +++DD LP   RG+ VY   H + L   W  L+EKA AK+ GSYEAL  G S E +   TG   E   L       G++ P +   +W  ++   T   LMG S   D  P +       GL   HAYS+ DV+ V+  R    L+R+RNPWG    WTG +SD S  W  E+    R  L +    +G FWM+ +DF+KYF  +++C +
Sbjct:   38 KTQEIQFVDDSFPPVLKSLYINPRHSEHPRVADWLRPNEIDNFSTCRTNIPWAVFRNPRPSDIIQGVLGDCWFLSSLAVLAERPELLEKILITREVSPQ---GAYQVRLCKDGKWTVILIDDLLPCNQRGQPVYSWAHRRQL---WVPLIEKAMAKLHGSYEALTAGRSIEGLATLTGAPCESIALHESQNNSGNTEPIDKDLIWAQLISSRTAGFLMGASCGGDTQPEEEPGYNAVGLQTHHAYSVLDVRDVHGIR----LLRLRNPWGQY-SWTGDWSDASSLWTPEL----RHELMVHGAQEGVFWMSLEDFMKYFDSVDVCKI 349          
BLAST of Calpain-B vs. Ensembl Medaka
Match: zgc:55262 (calpain-1 catalytic subunit [Source:NCBI gene;Acc:101155642])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 291/632 (46.04%), Postives = 419/632 (66.30%), Query Frame = 1
Query:  442 LFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKS--LLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            LFED  FP   +SL + E  P+      + W RP E+ +   FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F + Y G F F+ WQFG W DVV+DDRLP   G+L+++HS +  EFWSALLEKAYAK+ G YEAL GGS+SE  EDFTGG+TEM+DL    PP+L+ I+ + V R SL+GCSI+    T  EA   K L+KGHAYS+T V  V  +     LVR+RNPWG   EWTG +SD S EW+ +    R RL     +DGEFWM F DF++ F+++EIC+L+ ++ L+N    +  KW   +  GEW++  +AGGCRN+  TF LNPQFK+ +  PD +   +  + ++GLMQK+ R +R+EG+D+ TIG+A+Y++ D     S   L + +F   AS A+S  FINLREV  R +LP G+Y++VPSTF   +EA F+LR+FSE+P DS+++D+  ++VA     ++P E+  +E   +   ++ FK ++G D EI   ELQ IL+ +  K ++ K +GF+ E CRSM+ +MDTD SG+LG +EF VLW+ ++ + T+F++FD D+SGT +SYE+R AL   GF+++N +F  II RY  +   + FD+++
Sbjct:   51 LFEDNLFPCAASSLGFNELGPRSSKTYGVRWMRPTELCKRPEFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQCFKQGYAGIFHFQFWQFGEWVDVVIDDRLPAKDGKLLFVHSVEGTEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYDL-IKPPPDLFGIISRAVERGSLLGCSIDITSSTDREAVTFKKLVKGHAYSLTGVDEVMYRGNLTRLVRMRNPWGE-MEWTGPWSDDSKEWSYVDSSVRDRLQ-NRSEDGEFWMAFSDFLREFSRVEICNLTADA-LDN---TQMKKWSSSLFQGEWRRGSTAGGCRNYPATFWLNPQFKISLQHPDVSGKPDC-SFLVGLMQKDRRKKRQEGKDMETIGFALYEVPDEFKGSSNVHLKRDFFLTHASSARSELFINLREVSSRLRLPAGEYIVVPSTFEPNKEADFVLRVFSEKPADSEELDD--DVVA-----DLPKEILLDESQIDAGFKSLFKQLAGPDMEISVTELQNILNKIISKHKDLKTDGFTPEACRSMINLMDTDGSGKLGLKEFHVLWEKIKRYLTIFRQFDLDKSGTMSSYEMRIALESAGFKLTNHLFQLIILRYTEEDMSVDFDNFV 667          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3b (calpain-3 [Source:NCBI gene;Acc:101169329])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 298/694 (42.94%), Postives = 429/694 (61.82%), Query Frame = 1
Query:  322 DPKQTDSESIYGSRFHVSKSLKESKDW--FYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTK-VEAKAEKGLIKGHAYSITDVKSVN--SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENT-GTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAP--------DWKKEIPPEVKR---------------EEDANNVKLQNAFKVISGADGEIDADELQQIL-DVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            D   T + SIY +    ++++K++K    F   +     K  LFEDP FPAN++SL+Y   P  KIEWKRP E+ +N  FI DG +R D+ QGELGDCWLLAA++ L++   L+++VIP +Q F  +Y G F F+ W++G W D+VVDDR+PT    LV+  S   NEFWSALLEKAYAK+ GSYEALKGG++ +AMEDFTGG+TE+F+L S AP  L+ IM K + R SLMGCSI+      +E++  +GL++GHAYSI  ++  +  S+ G++ L+R+RNPWG    W G +S  S EW+ +S  +R  L     +  EFWM+F DF K FTKLE+C+L+P++      G ++  W + I  G W +  SAGGCRNF +TF  NPQ+++++ + D+ + E    T+++ LMQK  R +R  G    TIG++IY++ K+       L K +F   AS AK   +INLREV  R +LP G+YVI+P+TF   EE +FLLR+FSE    S++ +   + + P           KEI  E  R               EE     + +  ++ I+G D EI A EL  I+ +V  K    K +GFS ETCRSM+A+MDTD SG+L  +EFK LW  ++ W+ +FK++D+D   + +S+E+R A+N  GF ++ +++  I  RYA+K   I FD YI
Sbjct:   35 DYSLTGANSIYSAILSRNEAVKDAKRLKTFLELRDKYVKKKVLFEDPLFPANDSSLFYSHKPSMKIEWKRPTEICENPQFIIDGANRTDICQGELGDCWLLAAIACLTLSEKLLYRVIPPEQSFTENYAGIFHFQFWRYGEWIDIVVDDRIPTCNNLLVFTKSFRENEFWSALLEKAYAKLHGSYEALKGGNTLDAMEDFTGGVTELFEL-SEAPKGLFIIMKKALERGSLMGCSIDVTTANDIESRTNQGLVRGHAYSIIALEECDQVSEDGKIRLIRLRNPWGWVL-WKGPWSVNSKEWSTVSTADRDNLKKQTLEMSEFWMSFDDFKKNFTKLEMCNLTPDA----LTGDERQSWTVSINEGRWVRGSSAGGCRNFPDTFWTNPQYRLRLYEEDDPEEEQVLCTVVVALMQKGRRMQRHAGAKFLTIGFSIYEVPKELQGQNQHLQKDFFLYNASKAKCKAYINLREVTERFRLPPGEYVILPTTFKAHEEGEFLLRVFSENKSTSEEAETSIDKIEPIVFVSDRARTNKEIEHEGIRGEKKKKPKRKPLQAVEETEEEKQFRVIYQKIAGEDMEICASELMAIMKNVLSKHSEIKSDGFSLETCRSMIALMDTDGSGKLNLQEFKHLWKKIKEWQLIFKRYDKDGKCSISSFEMRNAVNDAGFNLNKQLYDIIAMRYADKHLNIDFDSYI 722          
BLAST of Calpain-B vs. Ensembl Medaka
Match: zgc:55262 (calpain-1 catalytic subunit [Source:NCBI gene;Acc:101155642])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 286/632 (45.25%), Postives = 402/632 (63.61%), Query Frame = 1
Query:  442 LFEDPFFPANNTSLYYREAPPQK-----IEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIE-ADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKS--LLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            LFED  FP   +SL + E  P+      + W RP E+ +   FI DG +R D+ QG LGDCWLLAA++SL++   L+H+V+P  Q F + Y G F F+ WQFG W DVV+DDRLP   G+L+++HS +  EFWSALLEKAYAK+ G YEAL GGS+SE  EDFTGG+TEM+DL    PP+L+ I+ + V R SL+GCSI+    T  EA   K L+KGHAYS+T V  V  +     LVR+RNPWG   EWTG +SD S EW+ +    R RL     +DGEFWM F DF++ F+++EIC+L+ ++ L+N    +  KW   +  GEW++  +AGGCRN+  TF LNPQFK+ +  PD +   +  + ++GLMQK+ R +R+EG+D+ TIG+A+Y++ D     S   L + +F   AS A+S  FINLREV  R +LP G+Y++VPSTF   +EA F+LR+FSE+P DS  +    +IV             R  D            +   D EI   ELQ IL+ +  K ++ K +GF+ E CRSM+ +MDTD SG+LG +EF VLW+ ++ + T+F++FD D+SGT +SYE+R AL   GF+++N +F  II RY  +   + FD+++
Sbjct:   51 LFEDNLFPCAASSLGFNELGPRSSKTYGVRWMRPTELCKRPEFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQCFKQGYAGIFHFQFWQFGEWVDVVIDDRLPAKDGKLLFVHSVEGTEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYDL-IKPPPDLFGIISRAVERGSLLGCSIDITSSTDREAVTFKKLVKGHAYSLTGVDEVMYRGNLTRLVRMRNPWGEM-EWTGPWSDDSKEWSYVDSSVRDRLQ-NRSEDGEFWMAFSDFLREFSRVEICNLTADA-LDN---TQMKKWSSSLFQGEWRRGSTAGGCRNYPATFWLNPQFKISLQHPDVSGKPDC-SFLVGLMQKDRRKKRQEGKDMETIGFALYEVPDEFKGSSNVHLKRDFFLTHASSARSELFINLREVSSRLRLPAGEYIVVPSTFEPNKEADFVLRVFSEKPADSDCLCLLLDIV-------------RVTDL----------CLCQQDMEISVTELQNILNKIISKHKDLKTDGFTPEACRSMINLMDTDGSGKLGLKEFHVLWEKIKRYLTIFRQFDLDKSGTMSSYEMRIALESAGFKLTNHLFQLIILRYTEEDMSVDFDNFV 651          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 295/657 (44.90%), Postives = 430/657 (65.45%), Query Frame = 1
Query:  370 VSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREA-----PPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIP-PEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYI 2310
            V+K L  +   F   ++    +  LFED  FPA   SL ++E        + I WKRPKE+  N  FI  G SR D+ QG+LGDCWLLAA++ L++   L+ +V+P +Q F   Y G F F+ W++G W DVVVDDR+PT+  +LV+  S + NEFWSALLEKAYAK+ GSYEALKGG+++EAMEDFTGG+TE +++   AP  L+  M K + R SLMGCSI++  P + E +   GL+KGHAYS+T V     K  +V LVR+RNPWG   EW G +SD S EW  +S  E+++L     +DGEFWM+F+DF K +TK+EIC+L+P++ LE+    K  KW + +  G W +  SAGGCRN+ +TF  NPQ+++++++ D++ ++N    T ++ LMQK  R  RK G +LFTIG++IY+M  N   K  L K +F + +S A+S ++INLREV  R +L  G+YVIVPST+   +E +F+LR+FSE+   S++I+ + E   P     +P P    EE   +   +  F+ I+G D EI A++L+ +L+ V  +R++    GFS E+CRSM+A+MD D +GRL  +EF+ LW+ ++ W+ +FK ++ DQSG  NSYE+R A+N  GFR++N+++  I  RYAN+   I FD +I
Sbjct:   26 VTKPLHFNGQDFSTLRQECLQRKGLFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM-KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDE--QKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDT-LEDD---KIHKWTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEMHGN---KQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIENRIEADHP-----VPAPASVGEESEEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDLNTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYANENMNIDFDSFI 666          
BLAST of Calpain-B vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 305/698 (43.70%), Postives = 450/698 (64.47%), Query Frame = 1
Query:  370 VSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREA-----PPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEA-DPTKVEAKAEKGLIKGHAYSITDV---KSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNEN--TGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQM-KDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIP-PEVKREEDANNVKLQNAFKVISGADGEIDADELQQILD-VSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            V+K L  +   F   ++    +  LFED  FPA   SL ++E        + I WKRPKE+  N  FI  G SR D+ QG+LGDCWLLAA++ L++   L+ +V+P +Q F   Y G F F+ W++G W DVVVDDR+PT+  +LV+  S + NEFWSALLEKAYAK+ GSYEALKGG+++EAMEDFTGG+TE +++   AP  L+  M K + R SLMGCSI++  P + E +   GL+KGHAYS+T V   +    K  +V LVR+RNPWG   EW G +SD S EW  +S  E+++L     +DGEFWM+F+DF K +TK+EIC+L+P++ LE+    K  KW + +  G W +  SAGGCRN+ +TF  NPQ+++++++ D++ ++N    T ++ LMQK  R  RK G +LFTIG++IY++ K+   +K  L K +F + +S A+S ++INLREV  R +L  G+YVIVPST+   +E +F+LR+FSE+   S++I+ + E   P     +P P    EE   +   +  F+ I+G D EI A++L+ +L+ V  +R++    GFS E+CRSM+A+MD D +GRL  +EF+ LW+ ++ W+ +FK ++ DQSG  NSYE+R A+N  GFR++N+++  I  RYAN+   I FD +I  LVRL  +F  F+A  +   G       E++Q  +Y
Sbjct:   26 VTKPLHFNGQDFSTLRQECLQRKGLFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM-KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPSQQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDT-LEDD---KIHKWTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIENRIEADHP-----VPAPASVGEESEEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDLNTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYANENMNIDFDSFISCLVRLEAMFRAFQAFDQDGDGTIRLSVLEWLQLTMY 712          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000067761.1 (SMESG000067761.1)

HSP 1 Score: 1477.61 bits (3824), Expect = 0.000e+0
Identity = 725/729 (99.45%), Postives = 728/729 (99.86%), Query Frame = 1
Query:  238 MPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            MPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALM+QVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR+ FKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYILLLVRLRTVFLT+KAQQKTSKGEAIFPQDEFMQCVLYM
Sbjct:    1 MPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMYQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRD-FKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYILLLVRLRTVFLTYKAQQKTSKGEAIFPQDEFMQCVLYM 728          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 419/688 (60.90%), Postives = 535/688 (77.76%), Query Frame = 1
Query:  379 SLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDR-DYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPES-ELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            S+  S+D + N K  L+ K  L+EDP FPA N SLY+ + PP+KI+WKRP E+ QN  FI++G SRFDV QGELGDCWLLAAV+ LS++  L +QV+PSDQ+F +  Y G F FR W+FG W +V+VDDRLPT   +LVY+HS D NEFWSALLEKAYAK++GSYE+LKGGS+SEA+EDFTGG+TE FD+    P NL+DIM K  +R SLMGCSIEADP K EA+   GLI GHAYSITDVK VN     K G++ L+R+RNPWGN  EW G++SDKSPEWN IS  +R  +GLTF+DDGEFWM++QDF+K F K+EICHL P+S E +   G KKS+WEMCIENGEW+K ++AGGCRNF++TF  NPQF+VKVVDPDE+D+EN GT+IIGLMQK+MR RRKEG + +TIGYAIYQ+KD   ++  LD  YF+   S AK+P+FINLREVCGRHKLP G YVIVPSTF   +EA FL+RIFSE+P +S ++DE+T ++  + +K + P     +DA  + L+ +F  I+G D EIDA ELQ IL+ +FK++ FKF+GFS ET +SMVAMMD DQSG+LGF+EFKVLW DLRLWK  FKKFD+D+SG FNSYE+R  LN +GFR+SN++  +++ R+ANK+G++ FDDYIL  VRL+T+F T+K+Q   SK  A+F QD F+QC++Y+
Sbjct:   94 SVGPSQD-YNNVKNSLRGK--LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE--NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTEPEKVVSP----ADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKD-FKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 771          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 420/699 (60.09%), Postives = 535/699 (76.54%), Query Frame = 1
Query:  379 SLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDR-DYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPES-ELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR-----------ENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            S+  S+D + N K  L+ K  L+EDP FPA N SLY+ + PP+KI+WKRP E+ QN  FI++G SRFDV QGELGDCWLLAAV+ LS++  L +QV+PSDQ+F +  Y G F FR W+FG W +V+VDDRLPT   +LVY+HS D NEFWSALLEKAYAK++GSYE+LKGGS+SEA+EDFTGG+TE FD+    P NL+DIM K  +R SLMGCSIEADP K EA+   GLI GHAYSITDVK VN     K G++ L+R+RNPWGN  EW G++SDKSPEWN IS  +R  +GLTF+DDGEFWM++QDF+K F K+EICHL P+S E +   G KKS+WEMCIENGEW+K ++AGGCRNF++TF  NPQF+VKVVDPDE+D+EN GT+IIGLMQK+MR RRKEG + +TIGYAIYQ+KD   ++  LD  YF+   S AK+P+FINLREVCGRHKLP G YVIVPSTF   +EA FL+RIFSE+P +S ++DE+T ++  + +K + P     +DA  + L+ +F  I+G D EIDA ELQ IL+ +FK+            NFKF+GFS ET +SMVAMMD DQSG+LGF+EFKVLW DLRLWK  FKKFD+D+SG FNSYE+R  LN +GFR+SN++  +++ R+ANK+G++ FDDYIL  VRL+T+F T+K+Q   SK  A+F QD F+QC++Y+
Sbjct:   94 SVGPSQD-YNNVKNSLRGK--LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE--NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTEPEKVVSP----ADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 783          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 421/707 (59.55%), Postives = 535/707 (75.67%), Query Frame = 1
Query:  379 SLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDR-DYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVN----SKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPES-ELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIP------PE--VKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKR-----------ENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLYM 2424
            S+  S+D + N K  L+ K  L+EDP FPA N SLY+ + PP+KI+WKRP E+ QN  FI++G SRFDV QGELGDCWLLAAV+ LS++  L +QV+PSDQ+F +  Y G F FR W+FG W +V+VDDRLPT   +LVY+HS D NEFWSALLEKAYAK++GSYE+LKGGS+SEA+EDFTGG+TE FD+    P NL+DIM K  +R SLMGCSIEADP K EA+   GLI GHAYSITDVK VN     K G++ L+R+RNPWGN  EW G++SDKSPEWN IS  +R  +GLTF+DDGEFWM++QDF+K F K+EICHL P+S E +   G KKS+WEMCIENGEW+K ++AGGCRNF++TF  NPQF+VKVVDPDE+D+EN GT+IIGLMQK+MR RRKEG + +TIGYAIYQ+KD   ++  LD  YF+   S AK+P+FINLREVCGRHKLP G YVIVPSTF   +EA FL+RIFSE+P +S ++DE+T ++  +    +       PE  V   +DA  + L+ +F  I+G D EIDA ELQ IL+ +FK+            NFKF+GFS ET +SMVAMMD DQSG+LGF+EFKVLW DLRLWK  FKKFD+D+SG FNSYE+R  LN +GFR+SN++  +++ R+ANK+G++ FDDYIL  VRL+T+F T+K+Q   SK  A+F QD F+QC++Y+
Sbjct:   94 SVGPSQD-YNNVKNSLRGK--LYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDE--NQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTESNPVVSNTATPVPEKVVSPADDAQIMALRQSFNQIAGQDLEIDAYELQDILNTAFKKGVTRAGMEVNPANFKFDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKEGLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 795          
BLAST of Calpain-B vs. Planmine SMEST
Match: SMESG000017238.1 (SMESG000017238.1)

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 373/685 (54.45%), Postives = 468/685 (68.32%), Query Frame = 1
Query:  415 KRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDFDRD-YVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPN------LWDIMMKGVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVN-----LVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSP----ESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPPEVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGFSRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTFNSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYIXXXXXXXXXXXXXKAQQKTSKGEAIFPQDEFMQCVLY 2421
            K  L AK +L+ED  FPAN  S+Y+        +WKRP E+  +  F   G SRFDV QGELGDCWLLAAV+SLSM   L  QV P+DQ F +  Y GAF F  W +G W ++++DDRLPT   RLV++HS+D NEFWSALLEKAYAK+ GSYE LKGGSSSEAMEDFTGGITE+ DL      N      L+ IM++  ++ SLMGCSI+A+P   EAK   GLI GHAYSIT VK +++K    N     LVR+RNPWG S EW G + D S  W+ ISD ER  LGL F++DGEFWM+F DFV  F KLEICHL P    ES L+N     K  WE  ++ G W+K  SAGGC NF ETF  NPQF++ V DPD++D +N GT+IIGL+QK MRS +  G DLF IGY +Y++   + D   LDK +F+     A SP FIN+REVCGRH+LP G Y I+PSTF   +EA FLLRIFSE+    K+IDE +++   D K  + P    E +    +L++AFK ++G D EIDA EL+ +LD +F+RE F F  F+ +TCRSMVAMMD D SGRLGFEEF+V+W DL+LWKTVFKK D+D SG+ +SYE+R  LN IGFRVSN++FT ++ R+A K G I FDD++   VRL+TVF TFKAQ+K +   AI  QD F+Q  +Y
Sbjct:   96 KEKLVAKGTLYEDEDFPANGESIYFTSNKGGNFQWKRPHEICSDPQFFVGGASRFDVCQGELGDCWLLAAVASLSMQTMLFSQVAPNDQSFAKGKYCGAFHFNFWHYGEWKEIIIDDRLPTRNNRLVFMHSRDSNEFWSALLEKAYAKLCGSYELLKGGSSSEAMEDFTGGITEIIDLKGDNRKNNESKEKLFQIMIQSHSKMSLMGCSIDANPKVTEAKLGNGLIMGHAYSITAVKQISAKVPGYNGDIIKLVRIRNPWGQS-EWNGEWGDSSDSWHHISDKERGVLGLNFDNDGEFWMSFNDFVNNFEKLEICHLGPQSVGESLLKNS---NKRTWESSVQQGAWKKGASAGGCLNFQETFWSNPQFRIVVTDPDKDDTDNMGTVIIGLLQKNMRSIKNRGNDLFPIGYVLYKLP--STDCGPLDKVFFRTNRKVAMSPAFINMREVCGRHRLPPGSYAIIPSTFEVNQEADFLLRIFSERANCGKEIDETSKM---DDKNLVLPVPVNESEIE--QLRSAFKAVAGDDMEIDASELKDVLDSAFRREAF-FKEFTIDTCRSMVAMMDIDLSGRLGFEEFQVMWLDLKLWKTVFKKEDKDGSGSLSSYELRTLLNAIGFRVSNKIFTNLVVRFATKDGTIEFDDFVHCCVRLKTVFQTFKAQKKDAHNNAIIDQDTFIQSSIY 768          
The following BLAST results are available for this feature:
BLAST of Calpain-B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN90.000e+045.77calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486][more]
CAPN30.000e+044.69calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN30.000e+043.22calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN10.000e+044.84calpain 1 [Source:HGNC Symbol;Acc:HGNC:1476][more]
CAPN10.000e+044.84calpain 1 [Source:HGNC Symbol;Acc:HGNC:1476][more]
back to top
BLAST of Calpain-B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clp-11.064e-15647.86Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-11.064e-15647.86Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-11.064e-15647.86Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-13.886e-15447.86Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-14.764e-15447.86Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
back to top
BLAST of Calpain-B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpB0.000e+046.87gene:FBgn0025866 transcript:FBtr0076343[more]
CalpB0.000e+046.87gene:FBgn0025866 transcript:FBtr0304675[more]
CalpA2.156e-2346.91gene:FBgn0012051 transcript:FBtr0340532[more]
CalpA1.936e-2348.43gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA1.936e-2348.43gene:FBgn0012051 transcript:FBtr0086529[more]
back to top
BLAST of Calpain-B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:552620.000e+046.52zgc:55262 [Source:ZFIN;Acc:ZDB-GENE-040426-2814][more]
capn90.000e+046.55calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn3b0.000e+045.45calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
si:dkeyp-50d11.20.000e+045.02si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-... [more]
capn3b0.000e+045.19calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
back to top
BLAST of Calpain-B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tgfbrap10.000e+048.27transforming growth factor beta receptor associate... [more]
tgfbrap10.000e+049.36transforming growth factor beta receptor associate... [more]
tgfbrap10.000e+047.85transforming growth factor beta receptor associate... [more]
CAPN30.000e+042.96calpain 3 [Source:NCBI gene;Acc:100497532][more]
capn10.000e+044.35calpain 1, (mu/I) large subunit [Source:NCBI gene;... [more]
back to top
BLAST of Calpain-B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn90.000e+045.68calpain 9 [Source:MGI Symbol;Acc:MGI:1920897][more]
Capn10.000e+045.02calpain 1 [Source:MGI Symbol;Acc:MGI:88263][more]
Capn10.000e+045.02calpain 1 [Source:MGI Symbol;Acc:MGI:88263][more]
Capn10.000e+045.02calpain 1 [Source:MGI Symbol;Acc:MGI:88263][more]
Capn30.000e+044.33calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
back to top
BLAST of Calpain-B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VT65|CANB_DROME0.000e+046.87Calpain-B OS=Drosophila melanogaster OX=7227 GN=Ca... [more]
sp|O35920|CAN9_RAT0.000e+045.95Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 P... [more]
sp|Q9D805|CAN9_MOUSE0.000e+045.68Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 S... [more]
sp|O14815|CAN9_HUMAN0.000e+045.77Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV... [more]
sp|P97571|CAN1_RAT0.000e+045.02Calpain-1 catalytic subunit OS=Rattus norvegicus O... [more]
back to top
BLAST of Calpain-B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HRD30.000e+057.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EIH10.000e+057.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5J4NR820.000e+052.07Calpain, invertebrate OS=Paragonimus westermani OX... [more]
A0A4S2LND80.000e+053.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LFH50.000e+053.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Calpain-B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:552620.000e+047.43calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
zgc:552620.000e+045.72calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
si:dkeyp-50d11.20.000e+044.94si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-... [more]
capn1a0.000e+044.16calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
capn3b0.000e+043.10calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
back to top
BLAST of Calpain-B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3a0.000e+039.74calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
capn90.000e+047.68calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
ENSPMAT00000003998.16.232e-16540.43pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
capn1a8.175e-14638.81calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
ENSPMAT00000007888.12.383e-12040.00pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1... [more]
back to top
BLAST of Calpain-B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain-B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401930.000e+046.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486330.000e+045.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348603.493e-11138.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485368.046e-10237.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379911.049e-3833.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain-B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:552620.000e+046.04calpain-1 catalytic subunit [Source:NCBI gene;Acc:... [more]
capn3b0.000e+042.94calpain-3 [Source:NCBI gene;Acc:101169329][more]
zgc:552620.000e+045.25calpain-1 catalytic subunit [Source:NCBI gene;Acc:... [more]
capn3a0.000e+044.90calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a0.000e+043.70calpain-3 [Source:NCBI gene;Acc:101157263][more]
back to top
BLAST of Calpain-B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067761.10.000e+099.45SMESG000067761.1[more]
SMESG000039299.10.000e+060.90SMESG000039299.1[more]
SMESG000039299.10.000e+060.09SMESG000039299.1[more]
SMESG000039299.10.000e+059.55SMESG000039299.1[more]
SMESG000017238.10.000e+054.45SMESG000017238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000946 ID=SMED30000946|Name=Calpain-B|organism=Schmidtea mediterranea sexual|type=transcript|length=2590bp
TTTTTTTATAAGGACATTTTTTCTTGTTATGCAACTTTATTGAAATTATT
AATATGGTTTGTTGTTTAAATATTCCATTTGTCTGATTTGACCTTGAATG
TAACGAGAATCTGTTTAAATAGATTATTTAAATAAATTATCTGAATATTT
CATAAGCATAATATCAATAGGAATTAAGATTTAATAAATAAATAAATTTT
ATTTTGAATTGTATTCTCACCAATCGGATTTCGAGAAATGCCGCGATTTA
ATGATTCGTCGAATACAAACGAATCCGTCGGTTCGAGATATTCAATCAAC
AGGTTCACTCCGCTCTCACCTGACCCAAAACAGACTGATTCAGAATCAAT
TTATGGGTCTCGATTTCACGTTTCAAAGAGTCTCAAAGAAAGTAAAGACT
GGTTTTACAATCAGAAAAGAATGCTCAAAGCCAAAAATTCTCTCTTTGAA
GATCCGTTTTTCCCGGCCAACAATACCTCACTGTATTATCGAGAGGCCCC
CCCACAGAAAATCGAATGGAAAAGGCCAAAGGAGATGCAGCAGAACGTGG
CATTCATCGCAGACGGCCTTAGTCGATTTGACGTGGTTCAAGGAGAACTT
GGCGATTGCTGGCTGTTGGCCGCTGTGTCATCATTATCAATGTACCCAGC
ACTGATGCATCAGGTGATCCCATCAGATCAGGATTTTGATCGTGATTATG
TAGGGGCCTTCATGTTCCGTCTATGGCAATTCGGTACCTGGTATGATGTG
GTCGTGGATGATCGGTTGCCAACTGTTAGAGGCCGCTTAGTTTATTTGCA
TTCTAAGGATCTAAATGAATTTTGGTCAGCTCTTTTAGAAAAAGCTTATG
CAAAAGTAGCAGGTTCTTATGAAGCATTGAAAGGTGGAAGTAGCTCAGAA
GCTATGGAAGACTTTACTGGAGGTATTACAGAAATGTTTGACCTTGGGTC
ATCAGCTCCTCCTAATCTTTGGGATATAATGATGAAGGGAGTAACTAGGG
CTTCATTAATGGGTTGTTCAATAGAAGCTGATCCAACCAAAGTCGAAGCA
AAAGCTGAAAAAGGATTAATCAAAGGCCATGCATATTCAATAACCGATGT
CAAATCTGTTAATTCTAAAAGAGGGCGTGTGAATCTAGTTCGCGTAAGAA
ATCCGTGGGGAAATAGCTGTGAATGGACAGGTGCTTACTCTGACAAATCT
CCAGAATGGAATGAAATCTCTGATGTGGAACGCAAGCGCCTTGGATTAAC
ATTTGAAGATGACGGAGAGTTTTGGATGAATTTTCAAGATTTTGTCAAAT
ATTTCACGAAACTGGAAATTTGCCATCTTTCGCCGGAGTCTGAGTTAGAA
AATAAAGCTGGAATAAAGAAAAGCAAATGGGAAATGTGTATAGAAAACGG
AGAATGGCAAAAGAATGTTTCAGCAGGTGGTTGCCGAAACTTTATTGAAA
CCTTTCACCTAAATCCGCAATTCAAAGTAAAGGTGGTAGATCCTGACGAA
AACGACAATGAAAATACGGGTACCTTGATTATTGGTCTAATGCAAAAAGA
AATGCGAAGTCGCCGGAAAGAAGGACAGGATTTGTTTACAATTGGTTACG
CGATTTATCAGATGAAAGACAACGCGTACGATAAATCCTTGCTTGATAAG
AGATATTTTCAAATTACTGCCTCATTTGCAAAATCTCCAACGTTCATTAA
CCTACGAGAGGTATGCGGAAGACATAAGCTTCCCATTGGAAAGTATGTCA
TTGTGCCATCGACATTTAATCAAGGAGAAGAAGCGAAATTCTTACTAAGA
ATTTTCTCTGAACAGCCATATGATTCCAAACAAATTGATGAGAAAACCGA
AATTGTGGCTCCAGACTGGAAAAAAGAAATACCTCCAGAAGTAAAAAGAG
AAGAAGATGCAAATAATGTAAAACTTCAAAATGCTTTCAAGGTGATATCG
GGCGCAGACGGTGAAATTGATGCGGACGAACTCCAACAAATTCTCGATGT
GTCATTTAAAAGAGAAAATTTCAAATTCAATGGATTTTCCAGAGAGACCT
GCCGCAGCATGGTTGCCATGATGGATACTGATCAATCTGGCCGATTAGGG
TTTGAGGAATTCAAAGTCCTGTGGGATGACTTACGTTTATGGAAAACCGT
TTTTAAAAAGTTTGATGAAGATCAAAGTGGTACATTTAATTCTTATGAAA
TTCGTCAAGCTCTCAATCATATCGGATTCCGAGTCAGTAACAGAGTGTTT
ACTGCGATCATAACTAGATATGCTAACAAGCAAGGGATAATCACCTTTGA
TGATTACATCCTTTTATTAGTTCGACTTCGAACGGTTTTCCTCACTTTTA
AAGCTCAGCAGAAGACCAGTAAAGGAGAAGCGATATTTCCCCAGGATGAG
TTCATGCAGTGCGTGCTATATATGTGACACCAAATTCTTAGTTTATTTTA
TCAATTTTACAGCTTTTCACATTCCATAGCAAACTTCAAACTTGGTCTTT
GATATTTTTTAGAAAACTTATTTTTTATTTCTTTAAATTTGCCTCGCTAA
AAAGGTTTGATAATAAATTAATTTTTTAATTTTAAAAAAA
back to top

protein sequence of SMED30000946-orf-1

>SMED30000946-orf-1 ID=SMED30000946-orf-1|Name=SMED30000946-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=730bp
MPRFNDSSNTNESVGSRYSINRFTPLSPDPKQTDSESIYGSRFHVSKSLK
ESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEM
QQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMHQVIPSDQDF
DRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALL
EKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMK
GVTRASLMGCSIEADPTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNL
VRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQ
DFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCR
NFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLF
TIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPI
GKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAPDWKKEIPP
EVKREEDANNVKLQNAFKVISGADGEIDADELQQILDVSFKRENFKFNGF
SRETCRSMVAMMDTDQSGRLGFEEFKVLWDDLRLWKTVFKKFDEDQSGTF
NSYEIRQALNHIGFRVSNRVFTAIITRYANKQGIITFDDYILLLVRLRTV
FLTFKAQQKTSKGEAIFPQDEFMQCVLYM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033883C2_III
IPR036213Calpain_III_sf
IPR038765Papain-like_cys_pep_sf
IPR022684Calpain_cysteine_protease
IPR002048EF_hand_dom
IPR022683Calpain_III
IPR001300Peptidase_C2_calpain_cat
IPR022682Calpain_domain_III
IPR011992EF-hand-dom_pair
IPR000169Pept_cys_AS
Vocabulary: molecular function
TermDefinition
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 54..77
score: 31.53
coord: 395..412
score: 64.07
coord: 154..179
score: 61.79
coord: 94..116
score: 46.23
coord: 184..207
score: 71.39
coord: 118..134
score: 69.41
coord: 341..362
score: 65.15
coord: 497..525
score: 54.6
coord: 209..236
score: 66.55
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 52..373
e-value: 5.8E-164
score: 560.7
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 70..363
e-value: 3.0E-126
score: 420.4
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 69..365
score: 76.801
IPR001300Peptidase C2, calpain, catalytic domainCDDcd00044CysPccoord: 61..363
e-value: 1.79972E-131
score: 389.769
IPR022683Peptidase C2, calpain, domain IIISMARTSM007202calcoord: 380..531
e-value: 4.1E-60
score: 215.7
IPR002048EF-hand domainSMARTSM00054efh_1coord: 634..662
e-value: 2.0
score: 15.4
coord: 562..589
e-value: 120.0
score: 1.0
coord: 604..632
e-value: 0.63
score: 19.1
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 630..665
score: 11.25
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 600..626
score: 7.121
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 574..592
score: 6.48
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 229..374
e-value: 9.5E-53
score: 179.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.380coord: 380..534
e-value: 5.5E-53
score: 181.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 564..729
e-value: 3.2E-48
score: 165.7
NoneNo IPR availablePFAMPF13833EF-hand_8coord: 574..631
e-value: 4.1E-11
score: 42.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..37
NoneNo IPR availablePANTHERPTHR10183:SF396CALPAIN-A-RELATEDcoord: 55..695
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 55..695
NoneNo IPR availableCDDcd16196EFh_PEF_CalpA_Bcoord: 562..729
e-value: 5.80244E-78
score: 245.189
IPR022682Peptidase C2, calpain, large subunit, domain IIIPFAMPF01067Calpain_IIIcoord: 388..527
e-value: 3.5E-44
score: 150.5
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 118..129
IPR033883Calpain subdomain IIICDDcd00214Calpain_IIIcoord: 380..533
e-value: 7.35657E-53
score: 177.491
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 562..726
IPR036213Calpain large subunit, domain III superfamilySUPERFAMILYSSF49758Calpain large subunit, middle domain (domain III)coord: 381..534
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 45..367