SMED30000934

Overview
NameSMED30000934
Smed IDSMED30000934
Length (bp)1859
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000934 (SMED30000934) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000934 (SMED30000934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000934 (SMED30000934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000934 (SMED30000934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 3 cellSMED30000934h1SMcG0013307 SmedASXL_018064SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30000934h1SMcG0013307 SmedASXL_018064SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30000934h1SMcG0013307 SmedASXL_018063SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000934h1SMcG0013307 SmedASXL_018063SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30000934 SmedASXL_077684SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000934 SmedASXL_077684SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30000934h1SMcG0013307 dd_Smed_v4_17804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000934h1SMcG0013307 dd_Smed_v4_17804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000934h1SMcG0013307 dd_Smed_v4_11835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000934h1SMcG0013307 dd_Smed_v4_11835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000934h1SMcG0013307 dd_Smed_v6_11835_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30000934h1SMcG0013307 dd_Smed_v6_11835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30000934h1SMcG0013313 dd_Smed_v6_11835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000934 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000034:245340..247131 -6872
v31.002387:38154..39747 -6364
Homology
BLAST of SMED30000934 vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 183.726 bits (465), Expect = 1.785e-50
Identity = 126/459 (27.45%), Postives = 225/459 (49.02%), Query Frame = -1
Query:  123 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1493
            T+++ +  IGFGRFH  L +++     +  ++I++++ + PV+ C W+L    + +  T++F  Y  +S+L G  +D+YGR   L+       Y + +++ +P+  W    +  VG  +        +  E+ P KYR + + ++ +    G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L   F Y+ +IL    +      C    +    V    +  +     C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N + +Y +E++PT++R  GMG   +  RIG  ++P  ++ V+   S+L    +   V   C   +F LP ET+ R L++
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAP-FISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of SMED30000934 vs. Ensembl Human
Match: SVOP (SV2 related protein [Source:HGNC Symbol;Acc:HGNC:25417])

HSP 1 Score: 174.481 bits (441), Expect = 9.007e-47
Identity = 125/468 (26.71%), Postives = 227/468 (48.50%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++F+   + S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     +L   ++P  GWR L+++SAV  ++  V    +PES RY +L+  +   +  +  +A  N A     + I   QE    +  ++DL  P++  TT+L+ FI   N F+Y+ ++L+   +      C         + S +   A++  C   C  LS E+Y ++L +  +E   +   + +I  +GRKKT+ +   + +    LL  C+    L +LLFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  +++ + S+ +   +  G        S  LP ET+ R L+E++  
Sbjct:   70 VEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE---DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------GISSRKK--AVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQESSHR 523          
BLAST of SMED30000934 vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 131.339 bits (329), Expect = 4.270e-33
Identity = 95/329 (28.88%), Postives = 159/329 (48.33%), Query Frame = -1
Query:  123 EWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1103
            E+ P KYR + + ++ +    G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L   F Y+ +IL    +      C    +    V    +  +     C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N + +Y +E++PT++R  GMG   +  RIG  ++P  ++ V+   S+L    +   V   C   +F LP ET+ R L++
Sbjct:   11 EFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAP-FISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of SMED30000934 vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 131.339 bits (329), Expect = 4.270e-33
Identity = 95/329 (28.88%), Postives = 159/329 (48.33%), Query Frame = -1
Query:  123 EWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1103
            E+ P KYR + + ++ +    G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L   F Y+ +IL    +      C    +    V    +  +     C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N + +Y +E++PT++R  GMG   +  RIG  ++P  ++ V+   S+L    +   V   C   +F LP ET+ R L++
Sbjct:   11 EFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAP-FISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of SMED30000934 vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 124.405 bits (311), Expect = 2.146e-30
Identity = 88/301 (29.24%), Postives = 146/301 (48.50%), Query Frame = -1
Query:  123 LGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1019
            L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L   F Y+ +IL    +      C    +    V    +  +     C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N + +Y +E++PT++R  GMG   +  RIG  ++P  ++ V+   S+L    +   V   C   +F LP ET+ R L++
Sbjct:   71 LASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAP-FISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 370          
BLAST of SMED30000934 vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 172.17 bits (435), Expect = 1.720e-46
Identity = 123/467 (26.34%), Postives = 219/467 (46.90%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAET-----IKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSML----IGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T+D  +  +GFGRF   L I+         ++++++S + P L+C W ++++   +  T +F      S   G+  D++GR   L F   +      +S +SP+ Y L  F+   G  IG +     L+ E+ P   R   + +     + G     LL Y ++  FGWR LM +S++   I  V    +PES R+ + +      L  +   A+ NR +      +   +    ++ +I +L+ P+   TTIL+  I  +  F+Y+ ++L   ++      C  +   FS      N T ++   C  L+  +Y ++L +  AE   +   +++I + GRKKT+ +   + A   FLL FCL+   + +L+F+ R   S       +Y  E++PT++R  G+G CSA  RIG  ++P I  +   K   L     G+  ILG+       S  LP ET+ R + ++
Sbjct:   68 TVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDEC--HGGLFS------NGTQME--VCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEKSLSLPIGIYGTAAILGL-----IASLSLPIETKGRQMMDS 519          
BLAST of SMED30000934 vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 172.17 bits (435), Expect = 1.720e-46
Identity = 123/467 (26.34%), Postives = 219/467 (46.90%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAET-----IKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSML----IGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T+D  +  +GFGRF   L I+         ++++++S + P L+C W ++++   +  T +F      S   G+  D++GR   L F   +      +S +SP+ Y L  F+   G  IG +     L+ E+ P   R   + +     + G     LL Y ++  FGWR LM +S++   I  V    +PES R+ + +      L  +   A+ NR +      +   +    ++ +I +L+ P+   TTIL+  I  +  F+Y+ ++L   ++      C  +   FS      N T ++   C  L+  +Y ++L +  AE   +   +++I + GRKKT+ +   + A   FLL FCL+   + +L+F+ R   S       +Y  E++PT++R  G+G CSA  RIG  ++P I  +   K   L     G+  ILG+       S  LP ET+ R + ++
Sbjct:   68 TVDEAVEALGFGRFQLKLSILTGMAWMADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSVTLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDEC--HGGLFS------NGTQME--VCQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQVASEKSLSLPIGIYGTAAILGL-----IASLSLPIETKGRQMMDS 519          
BLAST of SMED30000934 vs. Ensembl Celegans
Match: hmit-1.1 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXR3])

HSP 1 Score: 61.6178 bits (148), Expect = 1.150e-9
Identity = 43/164 (26.22%), Postives = 78/164 (47.56%), Query Frame = -1
Query:  813 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFF-EWSPAKYRIFFIGIAALTLSFGCFLGTLLG----YVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQE 1289
            SL+ G  SD  GR   ++  + +      + A S N   L + +  +GI+IG    I P++  E +P   R   +   AL +SFG  +  + G    Y+     GWR++   +AV ++I  V  + +PE+PR+L  N  +++   V+  V   ++     ++ E
Sbjct:   82 SLMSGTSSDYIGRRKVILGASAIFTIGALVCAASVNKIMLLVGRVLLGIAIGFASMIVPVYLGETAPTHVRGMLVAAFALMISFGQVVANITGGAFSYIDPYNVGWRLMFAFAAVPSIIQFVCFMFLPETPRWLYENGFETETREVLEKVYNGDKEWVEYEMAE 245          
BLAST of SMED30000934 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 61.2326 bits (147), Expect = 1.414e-9
Identity = 89/375 (23.73%), Postives = 156/375 (41.60%), Query Frame = -1
Query:  240 FTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTI-FPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA---------ETIKDIQEPPVTKP-----NIKDLIH-PNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYII---LISFIGRKKTITIFLFLIATGIFLLNFCLNSLQ--LNILLFIIR-GISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNI 1298
            F  + L G  +DK+GR  +      +LI     S+ + +I    + +FF G++   L  I F +  E+     RI F G+   +L FG  +  LLG V +    WR L            ++   +PESPR+ +     +D  + +  +AK N           +++K+ Q     K      N+ DL   PN    T++V++I ++N   Y                               N   ++ S    L +++Y + +I+ + EL   P Y +   L+   GR+ T+   + +   G     F  +     +    FI + G+ S    +I ++A E++PT VR  GMG+ S     G+ ++P IVN+
Sbjct:  149 FIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRI-FSGLMT-SLFFGAAMA-LLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIY-------------------------------NGLTLNVS---NLPVDDYWSFIINGAVEL---PGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPWLVASASFIGKFGVGS-GFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNL 482          
BLAST of SMED30000934 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 61.2326 bits (147), Expect = 1.414e-9
Identity = 89/375 (23.73%), Postives = 156/375 (41.60%), Query Frame = -1
Query:  240 FTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTI-FPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA---------ETIKDIQEPPVTKP-----NIKDLIH-PNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYII---LISFIGRKKTITIFLFLIATGIFLLNFCLNSLQ--LNILLFIIR-GISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNI 1298
            F  + L G  +DK+GR  +      +LI     S+ + +I    + +FF G++   L  I F +  E+     RI F G+   +L FG  +  LLG V +    WR L            ++   +PESPR+ +     +D  + +  +AK N           +++K+ Q     K      N+ DL   PN    T++V++I ++N   Y                               N   ++ S    L +++Y + +I+ + EL   P Y +   L+   GR+ T+   + +   G     F  +     +    FI + G+ S    +I ++A E++PT VR  GMG+ S     G+ ++P IVN+
Sbjct:  149 FIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRI-FSGLMT-SLFFGAAMA-LLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIY-------------------------------NGLTLNVS---NLPVDDYWSFIINGAVEL---PGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPWLVASASFIGKFGVGS-GFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNL 482          
BLAST of SMED30000934 vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0343347)

HSP 1 Score: 141.354 bits (355), Expect = 6.805e-36
Identity = 113/454 (24.89%), Postives = 208/454 (45.81%), Query Frame = -1
Query:  144 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD---IQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSM-LIGSMIILGVNFTCFCVSFLLPYET 1493
            T+   +N  GFG FH  L +++        +++ I+S LGP L C W +         T++F+     S    + S++YGR +AL     LL+  + +S+V+P+  WL   +  VG +IG +     L+ E+ P K++   + +     + G     +L  V+ P +GWR L+ +SA   +I T+    + ES RY   N      ++V+  +A  N+   +       + P    + + L+ P+   TTIL+ F+ L + F Y+ ++LV   +    ++           +SH N        C+     ++ ++L    +E   I   I ++   G+KKTI +    +     +L    +    ++ LFI RG  S     I +Y  EI+P ++R  G+  CS   R+G  ++P +  +++    +  + +  I+G+  +  CV   LP ET
Sbjct:   41 TVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNK-----------ESHPNE-------CVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTYAIVGLLASIACV--FLPRET 474          
BLAST of SMED30000934 vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0072197)

HSP 1 Score: 141.354 bits (355), Expect = 6.805e-36
Identity = 113/454 (24.89%), Postives = 208/454 (45.81%), Query Frame = -1
Query:  144 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD---IQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSM-LIGSMIILGVNFTCFCVSFLLPYET 1493
            T+   +N  GFG FH  L +++        +++ I+S LGP L C W +         T++F+     S    + S++YGR +AL     LL+  + +S+V+P+  WL   +  VG +IG +     L+ E+ P K++   + +     + G     +L  V+ P +GWR L+ +SA   +I T+    + ES RY   N      ++V+  +A  N+   +       + P    + + L+ P+   TTIL+ F+ L + F Y+ ++LV   +    ++           +SH N        C+     ++ ++L    +E   I   I ++   G+KKTI +    +     +L    +    ++ LFI RG  S     I +Y  EI+P ++R  G+  CS   R+G  ++P +  +++    +  + +  I+G+  +  CV   LP ET
Sbjct:   41 TVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNK-----------ESHPNE-------CVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTYAIVGLLASIACV--FLPRET 474          
BLAST of SMED30000934 vs. Ensembl Fly
Match: CG8654 (gene:FBgn0034479 transcript:FBtr0086340)

HSP 1 Score: 91.6633 bits (226), Expect = 3.045e-19
Identity = 111/417 (26.62%), Postives = 178/417 (42.69%), Query Frame = -1
Query:  111 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA--ETIKDIQEP---------PVTKPNIKDLIHPNYLS-TTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLIS-ASAELIFIP---FYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGI----SSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYK---YSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1289
            S+L G F+D+YGR  A + C  + + +  +  VSP  ++  LF+F V ++  G + T F L  E    K R     +  +  + G     L  Y I     WR       + +++  +++  +PESPR+L         ++++  +AK N+A  ETI+   E          PV K  + DL    Y+   TI ++   LV    Y+                           + Q  +A+              N+ IS A A  + IP      ++  ++GRKKT+ +     A G+ LL  CL S Q   +      I    +S+    + +Y  E+FPT VR  G+G+CS  GRIG  ++P IV++  Y      ++ G   IL +  T F     LP ETR   L ET ++
Sbjct:  123 SILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIRE---WRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAYGALAARQPVKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYY--------------------------GTAQYVSALGG------------NIFISNAIAAGVGIPGTCLCALMTKYLGRKKTLLLSNGCSALGLILLA-CL-STQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIF-----LP-ETRGTPLPETLED 490          
BLAST of SMED30000934 vs. Ensembl Fly
Match: CG8654 (gene:FBgn0034479 transcript:FBtr0305676)

HSP 1 Score: 91.6633 bits (226), Expect = 3.045e-19
Identity = 111/417 (26.62%), Postives = 178/417 (42.69%), Query Frame = -1
Query:  111 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA--ETIKDIQEP---------PVTKPNIKDLIHPNYLS-TTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLIS-ASAELIFIP---FYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGI----SSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYK---YSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1289
            S+L G F+D+YGR  A + C  + + +  +  VSP  ++  LF+F V ++  G + T F L  E    K R     +  +  + G     L  Y I     WR       + +++  +++  +PESPR+L         ++++  +AK N+A  ETI+   E          PV K  + DL    Y+   TI ++   LV    Y+                           + Q  +A+              N+ IS A A  + IP      ++  ++GRKKT+ +     A G+ LL  CL S Q   +      I    +S+    + +Y  E+FPT VR  G+G+CS  GRIG  ++P IV++  Y      ++ G   IL +  T F     LP ETR   L ET ++
Sbjct:  123 SILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIRE---WRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAYGALAARQPVKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYY--------------------------GTAQYVSALGG------------NIFISNAIAAGVGIPGTCLCALMTKYLGRKKTLLLSNGCSALGLILLA-CL-STQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIF-----LP-ETRGTPLPETLED 490          
BLAST of SMED30000934 vs. Ensembl Fly
Match: CG8654 (gene:FBgn0034479 transcript:FBtr0342667)

HSP 1 Score: 91.6633 bits (226), Expect = 3.045e-19
Identity = 111/417 (26.62%), Postives = 178/417 (42.69%), Query Frame = -1
Query:  111 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA--ETIKDIQEP---------PVTKPNIKDLIHPNYLS-TTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLIS-ASAELIFIP---FYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGI----SSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYK---YSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1289
            S+L G F+D+YGR  A + C  + + +  +  VSP  ++  LF+F V ++  G + T F L  E    K R     +  +  + G     L  Y I     WR       + +++  +++  +PESPR+L         ++++  +AK N+A  ETI+   E          PV K  + DL    Y+   TI ++   LV    Y+                           + Q  +A+              N+ IS A A  + IP      ++  ++GRKKT+ +     A G+ LL  CL S Q   +      I    +S+    + +Y  E+FPT VR  G+G+CS  GRIG  ++P IV++  Y      ++ G   IL +  T F     LP ETR   L ET ++
Sbjct:  123 SILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIRE---WRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAYGALAARQPVKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYY--------------------------GTAQYVSALGG------------NIFISNAIAAGVGIPGTCLCALMTKYLGRKKTLLLSNGCSALGLILLA-CL-STQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIF-----LP-ETRGTPLPETLED 490          
BLAST of SMED30000934 vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 195.667 bits (496), Expect = 6.894e-55
Identity = 132/463 (28.51%), Postives = 236/463 (50.97%), Query Frame = -1
Query:  129 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV-----SFLLPYETRDRNL 1493
            T++  +  IGFGRFH  L +++     +  ++I++++ + P + C W L    + + +T++F  +    +L G  +DKYGR   +        Y +F+++ S +  W    +  VG  +      F L  E+ PAKYR + + +A++    G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V  F+Y+  +L    +      C+ + +    ++  Q     +  C C+  + ++Y+ +LIS   E+  IP  IIL++ +GRK ++ I L L A    L+N C   L   ILLF++R + SMN N++ +Y +E++PTSVR  GMG C++  RIG  ++P I  +++ K      S+I+    F   C+      F LP ETR R L
Sbjct:   50 TVEEAVESIGFGRFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIKHIQE----EMLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK------SVILALSPFATACIICAIGVFFLPIETRGRAL 502          
BLAST of SMED30000934 vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 195.667 bits (496), Expect = 7.253e-55
Identity = 133/467 (28.48%), Postives = 237/467 (50.75%), Query Frame = -1
Query:  117 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV-----SFLLPYETRDRNLRETA 1493
            T++  +  IGFG FH  L +++     +  ++I++++ + P + C W L    + + +T++F  +    +L G  +DKYGR   +        Y +F+++ S +  W    +  VG  +      F L  E+ PAKYR + + +A++    G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V  F+Y+  +L    +      C+ + +    ++  Q  T     C C+  + ++Y+ +LIS   E+  IP  IIL++ +GRK ++ I L L A    L+N C   L   ILLF++R + SMN N++ +Y +E++PTSVR  GMG C++  RIG  ++P I  +++ K      S+I+    F   C+      F LP ETR R L + A
Sbjct:   50 TVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIKHIQEETL----CYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK------SVILALSPFATACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of SMED30000934 vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 195.667 bits (496), Expect = 7.253e-55
Identity = 133/467 (28.48%), Postives = 237/467 (50.75%), Query Frame = -1
Query:  117 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV-----SFLLPYETRDRNLRETA 1493
            T++  +  IGFG FH  L +++     +  ++I++++ + P + C W L    + + +T++F  +    +L G  +DKYGR   +        Y +F+++ S +  W    +  VG  +      F L  E+ PAKYR + + +A++    G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V  F+Y+  +L    +      C+ + +    ++  Q  T     C C+  + ++Y+ +LIS   E+  IP  IIL++ +GRK ++ I L L A    L+N C   L   ILLF++R + SMN N++ +Y +E++PTSVR  GMG C++  RIG  ++P I  +++ K      S+I+    F   C+      F LP ETR R L + A
Sbjct:   50 TVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIKHIQEETL----CYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK------SVILALSPFATACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of SMED30000934 vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 159.844 bits (403), Expect = 9.998e-42
Identity = 120/474 (25.32%), Postives = 215/474 (45.36%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCME---LSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFC------VSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG F + L I+   +     ++++I+S L P L C W L +  + +  +++FI     S L G  SDKYGR T L       ++   +SA +P   W+   +  VG  IG       L+ E+ P + R   I +  +  + G     LL  +++P  GWR L+ +S +   I       +PES RY +L   +   L  +  +A  N       + I   QE    +  I+DL  P++  TT+L+ FI   N F+Y+ ++L+   +      C                + ++  C +E   L+ ++YK++L +  +E   +   +  I  +GR+KT+ +  F+ +  I  L  C+    L + +FI R   +       +Y  E++PT+ R  G+G  S   R+G  ++P +  +       ++ S + L ++  C C       S  LP ET  R L+E++  
Sbjct:   69 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQE---DRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTELFQEGGVC-----------GGAKGSKMEPGCSLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQV-------MLESSVYLTLSVYCCCCLLAAIASCALPIETTGRGLQESSHR 521          
BLAST of SMED30000934 vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 159.073 bits (401), Expect = 1.795e-41
Identity = 120/474 (25.32%), Postives = 215/474 (45.36%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCME---LSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFC------VSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG F + L I+   +     ++++I+S L P L C W L +  + +  +++FI     S L G  SDKYGR T L       ++   +SA +P   W+   +  VG  IG       L+ E+ P + R   I +  +  + G     LL  +++P  GWR L+ +S +   I       +PES RY +L   +   L  +  +A  N       + I   QE    +  I+DL  P++  TT+L+ FI   N F+Y+ ++L+   +      C                + ++  C +E   L+ ++YK++L +  +E   +   +  I  +GR+KT+ +  F+ +  I  L  C+    L + +FI R   +       +Y  E++PT+ R  G+G  S   R+G  ++P +  +       ++ S + L ++  C C       S  LP ET  R L+E++  
Sbjct:   59 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQE---DRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTELFQEGGVC-----------GGAKGSKMEPGCSLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQV-------MLESSVYLTLSVYCCCCLLAAIASCALPIETTGRGLQESSHR 511          
BLAST of SMED30000934 vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 176.022 bits (445), Expect = 2.078e-47
Identity = 127/472 (26.91%), Postives = 222/472 (47.03%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIV----IYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++FI     S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N F+Y+ ++L+   +      C              +  A+   C   C  L++E+Y ++L +  +E   +   + +I  +GRKKT+ I   + +    LL  C+    L + LFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  ++    IY   ++     +L    +CF     LP ET+ R L+E++  
Sbjct:   64 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC-------------SSKKAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYLTVLVYSGCCVLAALASCF-----LPIETKGRGLQESSHR 514          
BLAST of SMED30000934 vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 176.792 bits (447), Expect = 2.530e-47
Identity = 126/468 (26.92%), Postives = 222/468 (47.44%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++FI     S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N F+Y+ ++L+                   T +  Q   A+   C   C  L++E+Y ++L +  +E   +   + +I  +GRKKT+ I   + +    LL  C+    L + LFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  +++ + S+ +  ++  G        S  LP ET+ R L+E++  
Sbjct:  116 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLL-------------------TTELFQAGDAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSIYLTVLVYSGCCVLAALASCFLPIETKGRGLQESSHR 560          
BLAST of SMED30000934 vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 175.252 bits (443), Expect = 4.992e-47
Identity = 128/472 (27.12%), Postives = 223/472 (47.25%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIV----IYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++FI     S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N F+Y+ ++L+   +      C  +  R           A+   C   C  L++E+Y ++L +  +E   +   + +I  +GRKKT+ I   + +    LL  C+    L + LFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  ++    IY   ++     +L    +CF     LP ET+ R L+E++  
Sbjct:   69 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSISNQR----------KAVKPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYLTVLVYSGCCVLAALASCF-----LPIETKGRGLQESSHR 522          
BLAST of SMED30000934 vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 174.866 bits (442), Expect = 6.941e-47
Identity = 127/469 (27.08%), Postives = 222/469 (47.33%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIV----IYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++FI     S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     LL   ++P  GWR L+++SA+   +  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N F+Y+ ++L+   +      C       S ++S           C  L++E+Y ++L +  +E   +   + +I  +GRKKT+ I   + +    LL  C+    L + LFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  ++    IY   ++     +L    +CF     LP ET+ R L+E++  
Sbjct:   70 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC------SSKLKSKTMCRPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYLTVLVYSGCCVLAALASCF-----LPIETKGRGLQESSHR 524          
BLAST of SMED30000934 vs. Ensembl Xenopus
Match: ubr7 (ubiquitin protein ligase E3 component n-recognin 7 (putative) [Source:Xenbase;Acc:XB-GENE-964580])

HSP 1 Score: 148.673 bits (374), Expect = 3.550e-38
Identity = 124/464 (26.72%), Postives = 216/464 (46.55%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWN-RAETIKDIQEPPVTKP-NIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIF--LLNFCLNSLQLNILLFII--RGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T+++ +  IGFGRFH  L +++        ++I++++ +   + C W L    + +   ++F  Y  +S+++G  +D+YGR   L        + + +++ +P+  W    +  VG  +        +  E+ P K+R + + ++ L    G  L   LG V+IP  GWR L+  +++  +IL +    IPES RY +        +  +  +A  N  A     I+EP   K  ++ DL    YL T++ +  I L   F Y+  IL    +      C     +   ++      +     C  LS  +Y  MLIS   E+   PF I+ I+F+GR+ T+ I   +  TGIF  LLN C++ L +   L+ I  R +     +L      +++PT +R  GMG   +  RIG AM+   ++ V+   S+     +   V F C   +F LP ETR R L+ +
Sbjct:   18 TVEDAVETIGFGRFHIMLFLIMGSTGIAEAMEIMLLAIVSSSIRCEWHLEGWQVALVTMMVFFGYMIFSIVLGLLADRYGRLKILTISFMWGAFFSLLTSFAPSYIWFVFLRCMVGCGVSGHAQGLIIKTEFLPKKFRGYMLPLSQLFWLTGSLLIIGLGSVLIPTLGWRWLIRFASIPGIILILVFKFIPESARYHVSVGKDQAAMDTLRWIANINCSAMPEGTIKEPKAEKTGSVCDLFDRKYLRTSLQIWVIWLGISFAYYGAILASSELLERNLLC--GSGQSDAIERDMPEESKSPCHCNMLSPSDYTTMLISTVGEIALNPFNILGINFLGRRWTLGI--TMATTGIFFLLLNICMSRLGIISFLYDIYFRSLRKCFHSLF-----QVYPTVMRAMGMGTSGSICRIG-AMAAPFISQVLLSVSVTGAFCLFASVCFVCALSAFTLPIETRGRALQAS 471          
BLAST of SMED30000934 vs. Ensembl Mouse
Match: Svopl (SV2 related protein homolog (rat)-like [Source:MGI Symbol;Acc:MGI:2444335])

HSP 1 Score: 178.333 bits (451), Expect = 1.134e-48
Identity = 128/461 (27.77%), Postives = 228/461 (49.46%), Query Frame = -1
Query:  123 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVTKPN-IKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRC-LQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1493
            T+++ +  IGFGRFH  L +++     +  ++I++++ + PV+ C W+L    +    T++F  Y   S+L G  +D+YGR   L+       Y + +++ SP+  W    +  VG  +        +  E+ P KYR + + ++ +    G  L   +  V+IP  GWR L+ I+++  +IL +    IPES R+ +        L  +  +AK NR+   +  + EP + K     DL+   YL TT+ +  I L   F Y+ +IL    +      C  ++ +    V++  +S      C C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N I +Y +E++PT +R  GMG   +  RIG  ++P  ++ V+   S L    +   V   C   +F LP ET+ R L++
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVEPILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVILASAELLERDLVCGSKSESEPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAP-FISQVLMSASFLGALCLFSSVCVVCAISAFTLPIETKGRALQQ 492          
BLAST of SMED30000934 vs. Ensembl Mouse
Match: Svop (SV2 related protein [Source:MGI Symbol;Acc:MGI:1915916])

HSP 1 Score: 167.933 bits (424), Expect = 1.653e-44
Identity = 127/468 (27.14%), Postives = 227/468 (48.50%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFGRF + L ++         ++++I+S L P L C W+L +  + +  +++FI   + S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     LL   ++P  GWR L+++SA   ++  V    +PES RY +L+  +   +  +  +A  N A     + I   QE    +  ++DL  P++  TT+L+ FI   N F+Y+ ++L+   +      C        ++ S +   A++  C   C  LS E+Y ++L +  +E   +   + +I  +GRKKT+ +   + +    LL  C+    L +LLFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  +++ + S+ +   +  G        S  LP ET+ R L+E++  
Sbjct:   70 VEDAVEAIGFGRFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPSLGWRWLLLLSAAPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE---DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------SISSRKK--AVEAKCSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAGVASCFLPIETKGRALQESSHR 523          
BLAST of SMED30000934 vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 84.3445 bits (207), Expect = 6.941e-17
Identity = 99/401 (24.69%), Postives = 170/401 (42.39%), Query Frame = -1
Query:  111 GRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLI-------HPNYLS--TTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIAT--GIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1277
            G  SD++GR   L+      +    MSA S N       +   G ++ G  + + PL  EW   ++R     I+    + G  L TL+GY+I     WR L++ + +  V   + +  +PES R+L+      +  + ++I AK N     + I E  +++  +  +I        P+YL    T  +  +SL       C              C+  W  F    S+   T +D S    L L  Y+  L+  + E+        L+  +GR+ T    L   A   GI LL        +  L+ I +  S        ++ SE++PT +R  GMG  +  GR+G +++P +V  ++    +L+  +   G++F   C   LLP ET+   L ET ++
Sbjct:   37 GYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLI---RSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNG----RPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSL-------C--------------CMMMW--FGVNFSYYGLT-LDASG---LGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVV--LLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPETIQD 400          
BLAST of SMED30000934 vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 84.7297 bits (208), Expect = 9.645e-17
Identity = 98/405 (24.20%), Postives = 172/405 (42.47%), Query Frame = -1
Query:  111 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLI-------HPNYLS--TTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIAT--GIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1289
            +++ G  SD++GR   L+      +    MSA S N       +   G ++ G  + + PL  EW   ++R     I+    + G  L TL+GY+I     WR L++ + +  V   + +  +PES R+L+      +  + ++I AK N     + I E  +++  +  +I        P+YL    T  +  +SL                      C+  W  F    S+   T +D S    L L  Y+  L+  + E+        L+  +GR+ T    L   A   GI LL        +  L+ I +  S        ++ SE++PT +R  GMG  +  GR+G +++P +V  ++    +L+  +   G++F   C   LLP ET+   L ET ++
Sbjct:  157 AVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLI---RSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNG----RPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLC---------------------CMMMW--FGVNFSYYGLT-LDASG---LGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVV--LLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPETIQD 524          
BLAST of SMED30000934 vs. Ensembl Mouse
Match: Slc22a15 (solute carrier family 22 (organic anion/cation transporter), member 15 [Source:MGI Symbol;Acc:MGI:3607704])

HSP 1 Score: 70.8626 bits (172), Expect = 2.127e-12
Identity = 100/376 (26.60%), Postives = 155/376 (41.22%), Query Frame = -1
Query:  219 GRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGI-SIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVI---SAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIK---DLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILIS--FIGRKKTITIFLFLIA--------------TGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSM 1277
            G+ SD++GR    +    L I     +  SP+  +  + +F VG+ + G+ L  F L  E     Y      I  L  + G     LLGY I     WR L V+      L  +L++F   IPESPR+L      S+    +  +AK NR                +K    L HP   S     SF+ L  Y       L++  I          W   S V      +A D      L    Y N+ +S   E+   P  I LI+  + GRK+T+  FL L                TG+F +   +NS  L++L  +     S   N++ +Y SE++PT +R  G+G CS   R+G  ++P + ++   ++S+
Sbjct:  130 GQLSDRFGRRKVYLTGFALDILFAVANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIRS---WRTLAVLVNLQGTLVFLLSLF---IPESPRWLYSQGRLSEAEEALYFIAKRNR---------------KLKCTFSLTHPANRSYRATGSFLDLFRYRILLGHTLILMFI----------WFVCSLVYYGLTLSAGD------LGGSIYANLALSGLIEIPSYPLCIYLINQRWFGRKRTLAAFLCLGGLACLIVMFLPEKKDTGVFAV---VNSHSLSLLGKLT---ISAAFNIVYIYTSELYPTVIRNVGLGACSMFSRVGGIIAPFVPSLKEVQWSL 462          
BLAST of SMED30000934 vs. UniProt/SwissProt
Match: sp|Q1LVS8|SVOPL_DANRE (Putative transporter SVOPL OS=Danio rerio OX=7955 GN=svopl PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 5.476e-54
Identity = 133/467 (28.48%), Postives = 237/467 (50.75%), Query Frame = -1
Query:  117 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVT-KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV-----SFLLPYETRDRNLRETA 1493
            T++  +  IGFG FH  L +++     +  ++I++++ + P + C W L    + + +T++F  +    +L G  +DKYGR   +        Y +F+++ S +  W    +  VG  +      F L  E+ PAKYR + + +A++    G  L  +LG  ++P  GWR ++  S + +++L    + IPES R+ +        +  +  +AK N     + +++EP VT + N   LI   +  T++L+ +   V  F+Y+  +L    +      C+ + +    ++  Q  T     C C+  + ++Y+ +LIS   E+  IP  IIL++ +GRK ++ I L L A    L+N C   L   ILLF++R + SMN N++ +Y +E++PTSVR  GMG C++  RIG  ++P I  +++ K      S+I+    F   C+      F LP ETR R L + A
Sbjct:   50 TVEEAVESIGFGCFHILLFVIMGSANIVEAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQGFVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRRTSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQIKHIQEETL----CYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSK------SVILALSPFATACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of SMED30000934 vs. UniProt/SwissProt
Match: sp|Q8N434|SVOPL_HUMAN (Putative transporter SVOPL OS=Homo sapiens OX=9606 GN=SVOPL PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 8.573e-50
Identity = 126/459 (27.45%), Postives = 225/459 (49.02%), Query Frame = -1
Query:  123 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPV--TKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1493
            T+++ +  IGFGRFH  L +++     +  ++I++++ + PV+ C W+L    + +  T++F  Y  +S+L G  +D+YGR   L+       Y + +++ +P+  W    +  VG  +        +  E+ P KYR + + ++ +    G  L   L  VIIP  GWR L+ ++++  +IL V    IPES R+ +        L  +  VAK NR+   +     PV   +    DL+   YL TT+ +  I L   F Y+ +IL    +      C    +    V    +  +     C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N + +Y +E++PT++R  GMG   +  RIG  ++P  ++ V+   S+L    +   V   C   +F LP ET+ R L++
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAP-FISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of SMED30000934 vs. UniProt/SwissProt
Match: sp|Q6PDF3|SVOPL_MOUSE (Putative transporter SVOPL OS=Mus musculus OX=10090 GN=Svopl PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 7.932e-48
Identity = 128/461 (27.77%), Postives = 228/461 (49.46%), Query Frame = -1
Query:  123 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIK-DIQEPPVTKPN-IKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRC-LQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1493
            T+++ +  IGFGRFH  L +++     +  ++I++++ + PV+ C W+L    +    T++F  Y   S+L G  +D+YGR   L+       Y + +++ SP+  W    +  VG  +        +  E+ P KYR + + ++ +    G  L   +  V+IP  GWR L+ I+++  +IL +    IPES R+ +        L  +  +AK NR+   +  + EP + K     DL+   YL TT+ +  I L   F Y+ +IL    +      C  ++ +    V++  +S      C C   +  +Y+ M+IS   E+   P  I+ I+F+GR+ +++I +   A    LLN C +S  L   LF++R + + N N I +Y +E++PT +R  GMG   +  RIG  ++P  ++ V+   S L    +   V   C   +F LP ET+ R L++
Sbjct:   33 TVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVEPILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVILASAELLERDLVCGSKSESEPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAP-FISQVLMSASFLGALCLFSSVCVVCAISAFTLPIETKGRALQQ 492          
BLAST of SMED30000934 vs. UniProt/SwissProt
Match: sp|Q2XWK0|SVOP_XENLA (Synaptic vesicle 2-related protein OS=Xenopus laevis OX=8355 GN=svop PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 5.654e-47
Identity = 127/472 (26.91%), Postives = 226/472 (47.88%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIV----IYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++FI     S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     LL   ++P  GWR L+++SA+  ++  +    +PES RY +L+  +   L  +  +A  N A     + I   QE    +  I+DL  P +  TT+L+ FI   N F+Y+ ++L+   +      C        ++ + +   A+   C   C  L++E+Y ++L +  +E   +   + +I  +GRKKT+ I   + +    LL  C+    L + LFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  ++    IY   ++     +L    +CF     LP ET+ R L+E++  
Sbjct:   70 VEDAVEAIGFGKFQWKLSMLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVIWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKSRAKCILLIEIFWALGTVFEVLLAIFVMPTLGWRWLLILSALPLMLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQE---DRGKIRDLFSPQFRCTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------SISNQRK--AVKPKCSLACEYLTVEDYTDLLWTTLSEFPGLLVTLWIIDRVGRKKTMAICFIIFSFSALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYLTVLVYSGCCVLAAVASCF-----LPIETKGRGLQESSHR 523          
BLAST of SMED30000934 vs. UniProt/SwissProt
Match: sp|Q1JP63|SVOP_BOVIN (Synaptic vesicle 2-related protein OS=Bos taurus OX=9913 GN=SVOP PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.573e-46
Identity = 125/468 (26.71%), Postives = 228/468 (48.72%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-----ETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG+F + L ++         ++++I+S L P L C W+L +  + +  +++F+   + S L G  SD+YGR T L       +Y   +SA +P   W+ + +  VG  IG +     L+ E+ P K R   I +  +  + G     +L   ++P  GWR L+++SAV  ++  V    +PES RY +L+  +   +  +  +A  N A     + I   QE    +  ++DL  P++  TT+L+ FI   N F+Y+ ++L+   +      C        ++ S +   A++  C   C  LS E+Y ++L +  +E   +   + +I  +GRKKT+ +   + +    LL  C+    L +LLFI R   S       +Y  E++PT+ R  G+G CS   R+G  ++P I  +++ + S+ +   +  G        S  LP ET+ R L+E++  
Sbjct:   70 VEDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQE---DRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------SISSRKK--AVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFICVGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVML-ESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQESSHR 523          
BLAST of SMED30000934 vs. TrEMBL
Match: A0A1I8G7A7 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 5.165e-56
Identity = 135/466 (28.97%), Postives = 233/466 (50.00%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVT------KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIF--LLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T++  + ++GFGRF   +L +    +    ++++++S LGP L C W+L +  +    T++F      +   G  SDK GR +      CL+ Y   + + SP+ +WL   +  VG +IG   + F L  E+ P ++R   + +  L    G     LL Y+++P  GWR L+  S++   +  + L  +PES R+L+ +    +   V++ +A+ NR   ++    P V       +  +K L HP Y  T+ ++  +     F+Y+ I+LV   I      C        TV  +   + +D+SCC  L  ++Y  MLIS+  E + IP  ++ I  +GR+ T+ I   L  TG+F  L   C+        LF+IR  S+   N I +Y +E++PT +R  G+GICSA  R+G   +P +  +++   S+L+  +I L V+ +C  +  LLP ET  R L  +
Sbjct:   89 TVEEAVEKLGFGRFQIKILCITGIMSAADAMEMLLLSVLGPALRCDWRLTSTEVAGITTVVFAGMLLGAPGWGAVSDKRGRWSVFALSLCLMAYFGLLCSFSPDYFWLVSLRGVVGFNIGGAASSFTLLSEYLPQQHRAKVLILYNLFWGLGSTFEILLAYLVLPTLGWRYLVAFSSLPLFLFMLTLGHLPESARFLLASGRAEEAAAVIDQIARENRRPAMEG--RPAVATVSESDRGQLKALFHPFYRRTSFILFSLWFGVAFSYYGIVLVSTEIFRFHQDCFSTAQSV-TVAHNTTESVVDNSCCRGLQSDDYTAMLISSLGEFVIIPVNMLTIDALGRRATLGINYLL--TGVFFGLTYLCVPKAATTAFLFLIRAHSAGIFNTIYIYTTEVYPTVIRSLGLGICSAMARLGSMTTPFVAQVIMPDVSVLLAFIIYLMVDLSCAGLCVLLPIETSGRALAHS 549          
BLAST of SMED30000934 vs. TrEMBL
Match: A0A0X3PAK1 (MFS domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR164745 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.485e-55
Identity = 134/467 (28.69%), Postives = 241/467 (51.61%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRA-ETIKDIQEPPVTKPNIKDLIH---PNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTA-----IDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T++  +   G G F   ++ +         ++++++S LGP L C W L    + +  TI+F+ Y   + L G+FSDKYGR T L+    L+ Y   ++ +SP   W+ + +  VG +IG   + + L  E+ P  +R   +  A L  + G  +   L ++I+PRFGWR L+  S++   +    L+ +PES RYL       +  +++N +AK N+  E    +     T+ ++ +++H     YL T++L+  I     FTY+  ILV   I     +C     +   +  H N TA     +D SCC+EL  E+Y +ML+S+  E   +P  I++++ +GR+ ++     L+A     +N C+ S    + LFI+R +SS  INL+ +Y +E++PT++R  G+G+ S+  R G   +P +  +++ + S+L        ++  C   S  LP ET+ R ++ +
Sbjct:   17 TVEEAIETYGLGFFQLRVVGISGILQAADAMELLLLSVLGPTLRCTWNLTPSEVALITTIVFVGYLLGAPLWGKFSDKYGRKTCLLTVLSLIAYFGLLTTLSPTYIWVLVLRGIVGFNIGGGSSSYALMAEYLPLHHRATVLLAAQLFWAIGGSVEIGLSFLILPRFGWRWLIFASSLPLALFLGLLLLLPESVRYLTAANRLEEAQQIVNNIAKMNKKVEMEGSLVSSESTESSLGNIMHLFAKRYLCTSLLLPIIWFGAAFTYYGSILVSSDIFRFHSQCFGV--KADPIDHHGNLTAGLTPVVDTSCCVELQTEDYTSMLVSSLGEFAILPLNIVMVNVLGRRLSLAGVYLLLAIFFIAINACVPSTVTIVFLFILRALSSSTINLVYLYTTEVYPTTIRSLGLGLFSSISRFGAMSTPYVAQVLMPEVSVLAALGTYSAMSVLCAIASGCLPIETKGRAMQHS 481          
BLAST of SMED30000934 vs. TrEMBL
Match: A0A267H6X2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015095g2 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.396e-55
Identity = 134/466 (28.76%), Postives = 234/466 (50.21%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVT------KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIF--LLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T++  + ++GFGRF   +L +    +    ++++++S LGP L C W+L +  +    T++F      +   G  SDK GR +      CL+ Y   + + +P+ +WL   +  VG +IG   + F L  E+ P ++R   + +  L    G     LL Y+++P  GWR L+  S++   +  + L  +PES R+L+ +    +   V++ +A+ NR   ++ +  P V       +  +K L HP Y  T+ ++  +     F+Y+ I+LV   I      C        TV  +   + +D+SCC  L  ++Y  MLIS+  E + IP  ++ I  +GR+ T+ I   L  TG+F  L   C+        LF+IR  S+   N I +Y +E++PT +R  G+GICSA  R+G   +P +  +++   S+L+  +I L V+ +C  +  LLP ET  R L  +
Sbjct:  104 TVEEAVEKLGFGRFQIKILCITGIMSAADAMEMLLLSVLGPALRCDWRLTSTEVAGITTVVFAGMLLGAPGWGAVSDKRGRWSVFALSLCLMAYFGLLCSFAPDYFWLVSLRGVVGFNIGGAASSFTLLSEYLPQQHRAKVLILYNLFWGLGSTFEILLAYLVLPTLGWRYLVAFSSLPLFLFMLTLGHLPESARFLLASGRAEEAAAVIDQIARENRRPAMEGL--PAVATVSESDRGQLKALFHPFYRRTSFILFSLWFGVAFSYYGIVLVSTEIFRFHQDCFSTAQSV-TVAHNTTESVVDNSCCRGLQSDDYTAMLISSLGEFVIIPVNMLTIDALGRRATLGINYLL--TGVFFGLTYLCVPKAATTAFLFLIRAHSAGIFNTIYIYTTEVYPTVIRSLGLGICSAMARLGSMTTPFVAQVIMPDVSVLLAFIIYLMVDLSCAGLCVLLPIETSGRALAHS 564          
BLAST of SMED30000934 vs. TrEMBL
Match: A0A267H7E7 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022663g2 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.811e-55
Identity = 135/466 (28.97%), Postives = 233/466 (50.00%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVT------KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIF--LLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRET 1493
            T++  + ++GFGRF   +L +    +    ++++++S LGP L C W+L +  +    T++F      +   G  SDK GR +      CL+ Y   + + SP+ +WL   +  VG +IG   + F L  E+ P ++R   + +  L    G     LL Y+++P  GWR L+  S++   +  + L  +PES R+L+ +    +   V++ +A+ NR   ++    P V       +  +K L HP Y  T+ ++  +     F+Y+ I+LV   I      C        TV  +   + +D+SCC  L  ++Y  MLIS+  E + IP  ++ I  +GR+ T+ I   L  TG+F  L   C+        LF+IR  S+   N I +Y +E++PT +R  G+GICSA  R+G   +P +  +++   S+L+  +I L V+ +C  +  LLP ET  R L  +
Sbjct:  112 TVEEAVEKLGFGRFQIKILCITGIMSAADAMEMLLLSVLGPALRCDWRLTSTEVAGITTVVFAGMLLGAPGWGAVSDKRGRWSVFALSLCLMAYFGLLCSFSPDYFWLVSLRGVVGFNIGGAASSFTLLSEYLPQQHRAKVLILYNLFWGLGSTFEILLAYLVLPTLGWRYLVAFSSLPLFLFMLTLGHLPESARFLLASGRAEEAAAVIDQIARENRRPAMEG--RPAVATVSESDRGQLKALFHPFYRRTSFILFSLWFGVAFSYYGIVLVSTEIFRFHQDCFSTAQSV-TVAHNTTESVVDNSCCRGLQSDDYTAMLISSLGEFVIIPVNMLTIDALGRRATLGINYLL--TGVFFGLTYLCVPKAATTAFLFLIRAHSAGIFNTIYIYTTEVYPTVIRSLGLGICSAMARLGSMTTPFVAQVIMPDVSVLLAFIIYLMVDLSCAGLCVLLPIETSGRALAHS 572          
BLAST of SMED30000934 vs. TrEMBL
Match: A0A177BET0 (Putative transporter SVOPL OS=Intoshia linei OX=1819745 GN=A3Q56_00019 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.809e-55
Identity = 140/465 (30.11%), Postives = 243/465 (52.26%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD---IQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDD--SC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGV-NFTCFCVSFLLPYETRDRNLRET 1493
            T+++ +  IGFG+F  +L+ V    +    L+++++S L P L C +KL  + +    TI+F+  F+ S L G  SDKYGR   +   +  ++Y    +A SPN YW+ + +  VG + G  +  F L  E+ P+KYR   + I +L  + G      +  +IIPR+GWR+L+ +SA+  ++ +V +  +PES R+L+ +   +    V+N +A +   +T+     I    + KPN+ DL   +YL T++ V FI  +  F+Y+ +IL    I    H            + H  ++ + +   C C  LS  +Y +M+I+   E + IPF +  I ++GRK T+ I   +      L+    N + L   +F++R  +S   N I +Y  E++PT VR  G+GI S+  RIG  ++P  V+ V+  YS L  ++ + GV    C   +F L +ET  + +++T
Sbjct:   47 TVEDAVEHIGFGKFQLWLIFVCGLFSATDALEMLLLSVLSPALRCDFKLTEVQVAFITTIVFVGMFSGSFLWGTISDKYGRLITMFVSSIWILYFGIGTAFSPNYYWMLILRGIVGFAFGGAIQSFTLISEYLPSKYRAKVLIIYSLMWAVGSLFEIGMASIIIPRWGWRVLVAVSALPMLLTSVCVWTLPESARFLVASGRHNQAYNVLNYIA-YKNGKTLPSKNLISLVQIKKPNVMDLFRGDYLRTSLQVWFIWFLVAFSYYGMILGQSEILEFKH----------ITRVHTETSPVHEISQCHCNSLSSSDYNSMVIATLGEFVAIPFNLFTIDWLGRKYTLMINFLIAGLAFLLILVSSNKMVLTFFVFLVRAFTSGLFNCIYIYTIEVYPTIVRSSGLGIGSSMARIGAMLTP-FVSQVLLNYS-LTAAISLYGVLCILCAVNAFYLKHETSGKKMKQT 498          
BLAST of SMED30000934 vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 161.384 bits (407), Expect = 2.306e-42
Identity = 121/474 (25.53%), Postives = 216/474 (45.57%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFC------VSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG F + L I+   +     ++++I+S L P L C W+L +  + +  +++FI     S L G  SDKYGR T L       ++   +S+ +P   W+   +  VG  IG       L+ E+ P + R   I +  +  + G     LL  +++P  GWR L+ +S +   I  +    +PES RY +L+  +   L  +  +A  N+      + I   QE    +  IKDL  P++  TTIL+ FI   N F+Y+ ++L+   +      C                +  +  C   C  L+ ++YK++L +  +E   +   +  I  +GR+KT+ +     +  I  L  C+    L +L+FI R   +       +Y  E++PT+ R  G+G  S   R+G  ++P +  +       ++ S + L ++  C C       S  LP ET  R L+E++  
Sbjct:   71 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQE---ERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGAC-----------GDTKGSKAEPRCNLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFLFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQV-------MLESSVYLTLSVYCCCCLLAAVASCALPIETTGRGLQESSHR 523          
BLAST of SMED30000934 vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 158.688 bits (400), Expect = 2.154e-41
Identity = 121/474 (25.53%), Postives = 215/474 (45.36%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC---CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFC------VSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG F + L I+   +     ++++I+S L P L C W+L +  + +  +++FI     S L G  SDKYGR T L       ++   +S+ +P   W+   +  VG  IG       L+ E+ P + R   I +  +  + G     LL  +++P  GWR L+ +S +   I  +    +PES RY +L+  +   L  +  +A  N+      + I   QE    +  IKDL  P++  TTIL+ FI   N F+Y+ ++L+   +      C                   +  C   C  L+ ++YK++L +  +E   +   +  I  +GR+KT+ +     +  I  L  C+    L +L+FI R   +       +Y  E++PT+ R  G+G  S   R+G  ++P +  +       ++ S + L ++  C C       S  LP ET  R L+E++  
Sbjct:   73 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQE---ERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGAC--------------GGIKAEPRCNLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFLFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQV-------MLESSVYLTLSVYCCCCLLAAVASCALPIETTGRGLQESSHR 522          
BLAST of SMED30000934 vs. Ensembl Cavefish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 156.762 bits (395), Expect = 3.549e-41
Identity = 123/458 (26.86%), Postives = 226/458 (49.34%), Query Frame = -1
Query:  129 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV--SFLLPYETRDRNL 1493
            +++  +  IGFGRFH  L I++     +  ++I++++ + P + C W+L    + + +T++F+ +    +L G  +DKYGR   +        Y + +++ +P+  W    +  VG  +      F L  E+ PAK+R F + +A++    G  L  +LG  ++P  GWR ++  S + ++IL          PR+ IL          +N+            I+   +    +K +I   Y  + +++ F++    FTY+  +L    +      C+ + +    ++ +Q     +  C C+  ++ +Y+ +LIS   E+  IP  I L++ +GRK ++ I L L A    L+N C       +LLF++R + SMN N++ +Y +E++PTSVR  GMG C++  RIG  ++P I  +++ K  +L  S   L     C C   + LLP ETR R L
Sbjct:   33 SVEEAVESIGFGRFHVLLFIIMGSANIVEAMEIMLLAVVSPEIRCEWRLEDWQVALVSTMVFLGFMICGVLCGYVADKYGRWKVVFGGFVWAAYFSLLTSFAPSYGWFIFLRSMVGCGVAATSQGFVLKTEFIPAKHRAFLLPLASIFWMVGSLLIIILGMTVVPTLGWRWMIRFSIIPSLILIGLF---QVKPRWWILEY--------LNLF-----------IELLLIIVLEVK-IILSRYRYSILVLKFVA---SFTYYGSVLSSSELLEKNLLCVVDADAEHGIKHNQE----EALCYCIPFNMADYQTLLISCLGEVALIPLNIGLLNVVGRKLSMIILLLLSAVFFMLVNVCTTMFGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTSVRSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVLLALSPFSLA---CCLCAVGTALLPIETRGRAL 457          
BLAST of SMED30000934 vs. Ensembl Cavefish
Match: slc22a5 (solute carrier family 22 member 4-like [Source:NCBI gene;Acc:103026458])

HSP 1 Score: 83.5741 bits (205), Expect = 1.742e-16
Identity = 113/386 (29.27%), Postives = 174/386 (45.08%), Query Frame = -1
Query:  198 YFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLT--LFQFFVG-ISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFG-----WRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYII---LISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGIS----SMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIY-KY--SMLIGSMII 1301
            Y   SL+ G+ SD++GR   L     L + S  + A S +  WL   +  FFVG   I + +T F L  E      R+ F        + G FL   +GY+++P        WR L+ + +VLTV+       IPESPR+LI      +   ++   AK N+  +  DI   P+    I     P    + I V   S + + T+ C++L + I          N   F    S   S  I D          + N  +SA AE   +P YII   L+    R+  ++ FL +   G FLL   L   +L+ L   +        +M+  ++ +Y +EI+PT +R  GMG+CS+A RIG   +P I+ +  Y KY   +L+GS+ I
Sbjct:  151 YLLGSLVSGQLSDRFGRKKVLF--ASLALESVIIFAQSFSQSWLVFCILYFFVGAFQISLYITAFVLGTEVLSTSLRVLFT-------TLGAFLHYCVGYMVLPWIAFVIRDWRTLLRVLSVLTVVYIPLWWFIPESPRWLISQGRVKEAEAIIKDAAKKNKV-SAPDIIFRPLEGNKIP---APARKYSLIDVVKTSNIRFTTFMCLLLWMAI----------NIGYFGL--SLNTSNLIGDP---------FLNCFLSAVAE---VPAYIIATLLLKSCPRRPLLSGFLSI--GGGFLLLIQLIPERLHTLAVALEMAGKFGFTMSFTVVYIYTAEIYPTVLRNLGMGMCSSAARIGSITAPYIIFLGTYSKYLPYILMGSLTI 497          
BLAST of SMED30000934 vs. Ensembl Cavefish
Match: slc22a15 (solute carrier family 22 member 15 [Source:NCBI gene;Acc:103028435])

HSP 1 Score: 75.0998 bits (183), Expect = 6.896e-14
Identity = 100/408 (24.51%), Postives = 171/408 (41.91%), Query Frame = -1
Query:  111 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGI-SIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAE--TIKDIQEPPVTKPNIKDLIHPNYL---STTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFI-----GRKKTITIFLFLIA----TGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1289
            ++L G  SD+ GR    +      +   + +A++PN     L +  VG+ + G+ L  F L  E+    Y      +  +T + G  L  +LGY I     WR L   +    V+L +F I +PESPR+L      +   RV+   A  N     T+K  + P  +   +     P  L   + ++L     ++ Y  Y C                      S V       A +D     LS+  Y          L+ +P Y + I FI     GR+K++  FL L        +FL     +    + L  + + + S   N++ +Y SE++PT +R  G+G+CS + R+G  ++P + ++ +   SM      ++GV  T   +  LLP ET ++ + ET + 
Sbjct:  102 NVLFGPLSDRIGRKPVFLTTLFFELLFAYGTALAPNYELFALSRLLVGMMNGGMALICFILSQEYVGKSYWALTGTLTNMTFAVGIALFAVLGYYIRQ---WRNLATAANCPGVLLFLFCITLPESPRWLFSRGRTNQAERVLQSFAVRNGKGRITLKLRRTPGSSGSEVPS---PGLLVLATHSVLRCRTVVLMYVWYAC----------------------SLVYYGLTMNASEDKGNRYLSVAMYG---------LVELPAYPLCIYFINKTWAGRRKSLASFLILAGLCCLISMFLPVQSGSWASGSSLALLGKLMVSAAFNIVYVYTSELYPTVIRNAGLGVCSMSCRVGGILAPFVPSMKVLHASMPFTVFCLIGV--TAGALGLLLP-ETLNKPVAETLEE 469          
BLAST of SMED30000934 vs. Ensembl Sea Lamprey
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 201.06 bits (510), Expect = 8.004e-58
Identity = 138/480 (28.75%), Postives = 238/480 (49.58%), Query Frame = -1
Query:  123 RSALHS-SAK*NIL*EMETIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD-IQEPPVTK-PNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASE--IFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRE 1544
            RSAL S  A  N+  +  +++  +  +GFGRFH  LL ++        ++I+++S + P + C W+L    + +  T++F  +   S   G  +D+YGR   L+       Y + +S+ SP   W    +F +G  IG     F L  E+ P+  R   + ++ +    G  L  +L Y+I+P  GW  L+ IS + + +L +    IPES RY +        L  +  +AK N+    +  + EPP  +  NI DL+   YL TT+    I      TY+ +ILV   +      C  +    + ++ H   +  +  C C +   E+YK +L+S+  E + IPF  + I  +GR++++ + + L     +LLN C   + L +LLF +R ++S N N+I +Y  E  ++PT++R  G+G CS+  RIG  ++P +   VI   S+ +   +   V   C  ++F LP ET  R ++E
Sbjct:   15 RSALMSLPAAQNVEPKTFSVEQAVEHMGFGRFHILLLFIMGSTTIAESMEIMLLSVISPTIQCEWRLQQWQVALVTTMVFFGFMLSSGPCGFLADRYGRWKVLLLVTIWSSYWSGISSFSPTYGWFVFLRFLMGCGIGGQSQGFVLMSEFMPSTARGRVLPMSQVFWVLGSLLEVVLAYLILPTLGWAWLIRISTIPSFVLLIAFKFIPESARYQVSAAKPDKALLTLAKIAKMNKTTLPQGTLVEPPAERRGNIWDLLDRQYLRTTLQTWPIWFGTTLTYYGLILVSSELLERNQMCGDD--SVTAIEEHIAFSEQESPCFCKQFKSEDYKTLLLSSFGEFLAIPFTTLTIDTLGRRRSMALSMILCGLLYYLLNICTTRMGLTVLLFFLRAVASTNFNIIYIYTVEVKVYPTNIRSLGLGSCSSTARIGAMIAPFVAQ-VILDISIPLALCLFGTVCVICSVLAFTLPIETMGREMKE 491          
BLAST of SMED30000934 vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 62.003 bits (149), Expect = 1.169e-10
Identity = 46/150 (30.67%), Postives = 73/150 (48.67%), Query Frame = -1
Query:  849 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILM--VISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAK 1289
            SL+ G  SD+YGR  AL+    L   +   +A +P+    T  +F +G+S+ GI++    L  EW    +R F         S G     LL Y++    GW+ L   V S +   ILT +   IPESPR+L++     +  R +++ A+
Sbjct:  155 SLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWLDQGHRTFAGTSGGFAWSTGNMALGLLAYLLR---GWQQLQLVVTSPIYFCILTWWF--IPESPRWLLVRGRAREAHRNLSLCAR 299          
BLAST of SMED30000934 vs. Ensembl Sea Lamprey
Match: si:dkey-190l8.2 (si:dkey-190l8.2 [Source:ZFIN;Acc:ZDB-GENE-030131-9103])

HSP 1 Score: 51.9878 bits (123), Expect = 2.538e-7
Identity = 44/155 (28.39%), Postives = 70/155 (45.16%), Query Frame = -1
Query:  828 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETI 1289
            S+ +G  SD+YGR   L+ C      + F+ A  PN     L +   G +  GI+L  F L  EW     R +   I AL  S G  +  L G   I +  W  L + + V  +++ +    +PESPR+L L K  ++   ++   +  NR   +
Sbjct:   33 SIAMGIASDRYGRRPVLLGCVASQGAAEFVIAFLPNFPTYLLGRLLTGTTASGIMLCSFSLGVEWCGPALRAWPPIILALAFSVG--MMALAGVAKISQ-NWPQLHLATGVPQLMVLLLFWSLPESPRWLFLKKRTTEARNLLRQASIINRRSEV 184          
BLAST of SMED30000934 vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 50.447 bits (119), Expect = 1.074e-6
Identity = 80/359 (22.28%), Postives = 138/359 (38.44%), Query Frame = -1
Query:  255 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGI-SIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQE--PPVTK-------PNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTV-QSHQNSTA-IDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQ-LNILLFIIRGIS-SMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSP 1289
            ++L+G  SD+YGR  +L+    +      + A +PN       +   GI ++G   T+F    E+  +  R     +  +  SFG  + + + Y +     WR L +   +  V+L  +   +PESPR+LI    K     V+  +A  N  E   +I++    VT+       P+I DL+    +    +V  I                            W     V Q    ST  I D          Y   L+   AE+      I LI  +GR+  + +   L            + +  LNI L  +  +  +M   ++ +  +E++PT +R   M  CS+   IG  ++P
Sbjct:  171 AILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLRT---WRYLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEKAGNPSIADLMRSAKIRKYTVVLMIY---------------------------WFVVGVVYQGLAMSTGNIGDDV--------YLAFLMGGLAEIPGALMVIALIDRVGRRLPMCVAPGLSGLACLATALVPHDIGWLNITLVTLGRLGLTMAYEMVTLVNNELYPTHLRNMAMSTCSSLSGIGGIVAP 491          
BLAST of SMED30000934 vs. Ensembl Sea Lamprey
Match: SLC2A9 (solute carrier family 2 member 9 [Source:HGNC Symbol;Acc:HGNC:13446])

HSP 1 Score: 48.521 bits (114), Expect = 3.287e-6
Identity = 39/137 (28.47%), Postives = 66/137 (48.18%), Query Frame = -1
Query:  786 WLTLF--QFFVGISIGILLTIFPLFF-EWSPAKYRIFFIGIAALTLSFGCFLGTLLG--YVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKG--KSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIK 1175
            W  LF  +F VGI  GI L++ P++  E SP   R     ++A+ +  G F G +L    V+     W IL  I  V  ++    L  +PESPRYL+L +   K+    +  ++ + +    + +IQ   + + +I 
Sbjct:   81 WEMLFLGRFVVGIDAGISLSVLPMYLAEISPKNLRGSTGQVSAIFICLGVFTGQVLNLKEVLGQESHWSILFGILVVPPLVQLATLPFMPESPRYLLLERQDVKAAEKALQRLLGRQDVQREMVEIQAEGIAQAHIS 217          
BLAST of SMED30000934 vs. Ensembl Yeast
Match: CIN10 (Putative transporter; member of the sugar porter family; non-essential gene; overexpression results in elevated colony sectoring, an indicator of chromosomal instability [Source:SGD;Acc:S000002795])

HSP 1 Score: 57.7658 bits (138), Expect = 3.144e-9
Identity = 47/155 (30.32%), Postives = 76/155 (49.03%), Query Frame = -1
Query:  864 FTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFF-EWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRF-----GWRILMVISAVLTVILTVFLIPIPESPRYLILNKGK----SDCLRVM 1298
            F  S+L    +D+YGR   L  C  + I +    A++  + +L   +  VGI++G+     PLF  E SP++ R F + +  + ++     G L+ YVI          WR L  +SA+  ++    L  IPESPR+ I +KG      D LR++
Sbjct:   94 FFGSILAFPLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCVPLFLSEISPSRIRGFMLTLNIIAITG----GQLVSYVIASLMKEIDNSWRYLFALSAIPAILFLSILDFIPESPRWSI-SKGDILYTRDSLRML 243          
BLAST of SMED30000934 vs. Ensembl Yeast
Match: ITR1 (Myo-inositol transporter; member of the sugar transporter superfamily; expression is repressed by inositol and choline via Opi1p and derepressed via Ino2p and Ino4p; relative distribution to the vacuole increases upon DNA replication stress; ITR1 has a paralog, ITR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002905])

HSP 1 Score: 52.7582 bits (125), Expect = 1.038e-7
Identity = 49/172 (28.49%), Postives = 83/172 (48.26%), Query Frame = -1
Query:  798 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYW-LTLFQFFVGISIGILLTIFPLFF-EWSPAKYRIFFIGIAALTL------SFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTK 1289
            S+  G  +D +GR   L+  N + +    +  VS + +W + + +  +G  +GI   I PLF  E +P   R     I +L L      ++GC  G  L YV     GWRIL+ +S + T +    L  +P++PRY ++   K D  R   ++ K +  +T ++I E  V +
Sbjct:  143 SIFAGTAADIFGRKRCLMGSNLMFVIGAILQ-VSAHTFWQMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGC--GAGLNYV---NNGWRILVGLSLIPTAVQFTCLCFLPDTPRYYVM---KGDLARATEVL-KRSYTDTSEEIIERKVEE 304          
BLAST of SMED30000934 vs. Ensembl Yeast
Match: ITR2 (Myo-inositol transporter; member of the sugar transporter superfamily; expressed constitutively; ITR2 has a paralog, ITR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005463])

HSP 1 Score: 51.9878 bits (123), Expect = 2.041e-7
Identity = 47/171 (27.49%), Postives = 81/171 (47.37%), Query Frame = -1
Query:  798 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFF-EWSPAKYRIFFIGIAALTL------SFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTK 1289
            S+  G  +D +GR   L+F N + +    +   +   + +   +  +G  +GI   I PLF  E +P   R     I +L L      ++GC  G  L +V   + GWRIL+ +S + TV+   F   +P++PRY ++   K D L+   +V K +   T  +I +  V +
Sbjct:  166 SVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGC--GAGLNHV---KNGWRILVGLSLIPTVLQFSFFCFLPDTPRYYVM---KGD-LKRAKMVLKRSYVNTEDEIIDQKVEE 327          
BLAST of SMED30000934 vs. Ensembl Yeast
Match: YBR241C_mRNA (Putative transporter, member of the sugar porter family; green fluorescent protein (GFP)-fusion protein localizes to the vacuolar membrane; YBR241C is not an essential gene; YBR241C has a paralog, VPS73, that arose from the whole genome duplication [Source:SGD;Acc:S000000445])

HSP 1 Score: 51.6026 bits (122), Expect = 2.482e-7
Identity = 37/170 (21.76%), Postives = 79/170 (46.47%), Query Frame = -1
Query:  783 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFF-EWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKD 1289
            S   G ++++YGR    +  + + + S+ +   S +   L   +F VG+S G  + I PLF  E +P ++R     +  ++++ G  L   L       + WR L+   +V+ V   +  + + ESPR+L+ +   S+    +  +      +  ++IQ+   +  + +D
Sbjct:  102 SYYAGNWANRYGRKYVSMGASAMCMVSSLLLFFSNSYLQLLFGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILLTQTLALKYADSYNWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTYQQAKQEIQDWQRSHGHNRD 271          
BLAST of SMED30000934 vs. Ensembl Yeast
Match: HXT2 (High-affinity glucose transporter of the major facilitator superfamily; expression is induced by low levels of glucose and repressed by high levels of glucose [Source:SGD;Acc:S000004613])

HSP 1 Score: 48.9062 bits (115), Expect = 1.928e-6
Identity = 42/165 (25.45%), Postives = 74/165 (44.85%), Query Frame = -1
Query:  822 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVG-----ISIGILLTIFP-LFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIP---RFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKD 1289
             L +GR  D YGR   L+ C  L+     +  ++ +  W   +Q+F+G     + +G +  + P L  E +P   R   +    L ++ G FLG    Y          WR+ + ++    + +   ++ +PESPR+L+      D  R +   AK N+  TI+D
Sbjct:  121 GLTLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKW---YQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL---AKSNKV-TIED 277          
BLAST of SMED30000934 vs. Ensembl Nematostella
Match: EDO41352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N1])

HSP 1 Score: 144.821 bits (364), Expect = 1.938e-37
Identity = 114/477 (23.90%), Postives = 223/477 (46.75%), Query Frame = -1
Query:  126 LHSSAK*NIL*EMETIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAET----IKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDD-SC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASE-IFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLR 1535
            LH S       ++ ++ + ++ IGFG F   ++++L   +    L+++++S L P + C ++++A       T++FI     S   G  +D +GR   ++  +  + Y   +SA SP+ YW+ + +  VG+ IG       L  E+ P+KYR   + I +   + G      +  +++P +GWR L+ + ++   +  +    +PES R+ + +  +   L  ++ +A+ N+A      +KD  +    +  I DL+ P    TT+++ F+     FTY+ ++             L     F +  +      + D  C C  L+ ++Y +M+ +  AE+  +   I+L+  +GR++T+ +   L AT   LL  C     +   +F  RG  S     I +Y  E + P      G+G CSA  RIG  ++P I  +++ + S+     +      +C  ++  LP ET+ R +R
Sbjct:    6 LHFSVSLECGEDVYSVSDAVDHIGFGWFQIKIMLLLGYFSAADALEMMLLSILAPTIRCIFRISAWKEAWITTVVFIGMMVGSSTWGWIADNFGRKFVIVLVSIWIAYFGLLSAFSPHYYWIIVLRMVVGLGIGGAPQSATLMSEFLPSKYRAMCMCIQSPWWTLGSLFTICVAMLVMPVYGWRYLLALLSLPMFLFLLLSPFLPESCRFQLASGDRDKALATLHRMARANKATLPTGFLKDANQ-NAKRGRILDLLKPELRRTTLMLWFLWFNVAFTYYGVV-------------LMTSELFQSDSAGGGKCEVKDPHCGCKLLTTKDYTDMMWTTLAEIPIVLVNIVLLERLGRRRTLALLYGLTATFYMLLFICTKREWMVAFIFGARGCISGVFTAIYIYTPEVVLPYRGATLGLGTCSAVARIGAMITPFICQVLL-RASVDFALGVYAATGLSCVVIALCLPIETKGRLMR 467          
BLAST of SMED30000934 vs. Ensembl Nematostella
Match: EDO39287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ0])

HSP 1 Score: 136.732 bits (343), Expect = 6.247e-35
Identity = 123/440 (27.95%), Postives = 209/440 (47.50%), Query Frame = -1
Query:  126 GLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIP---IPESPRYLILNKGKSDCLRVMNIVAKWNRAE-TIKDIQ--EPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFT----YFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNS---LQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLR 1406
             ++I ++S L P + C W L+ + + +  T++FI +   S  +G   D +GR   LI  +  + Y+  +SA SP+  WL   +  VG  +G       L  E+SP K+R   +    +  + G F+ +L+G V +P  GWR  +V    +T  L VFLI    IPE   +LI +  K +  +V+  +A+  +AE  I ++Q     V    + DL+ P Y  TT+L+ +       +    Y+ ++L+   I      C  +  +F T               + LS  ++  +L + SAEL  +   + +   +GRK  +T +  + +     L  C  S   L  N  LFIIRG+      ++I Y SE++PT+ R  G+G+ +  GRIG  ++P +++ V+   SM     ++L     C    + LP ETR R L+
Sbjct:    4 AMEITMLSILVPYVKCEWDLSIVQVAMITTVVFIMFLVGSPTLGWMGDNFGRKPMLIVSSVAVAYAGLLSAFSPSYPWLLFLRGIVGFGLGGKCLNAALLVEYSPIKHRGATVMSLGVAWAIGSFMTSLVGMVFVPWLGWRSFVV---AITFPLVVFLILSKWIPEFSHFLITSGEKDEARKVLQEMARIQKAELPIGELQGLSHEVALGRVGDLLTPEYRLTTLLLIYFYYFYLLSYRGIYYGLVLLTTQIMTSGSHCPGS-VKFKT-----------KLYTILLSTNDFTTLLWTTSAELPAMILTLAMADKVGRKTLLTTYFVIASICYCFLFICAGSRVFLAFN--LFIIRGLLLAGNEVLICYTSEVYPTAFRATGLGLMNGIGRIGGVIAP-LISQVLADSSMNAAIGVLLLFTALCTVTCYFLPIETRQRELQ 425          
BLAST of SMED30000934 vs. Ensembl Nematostella
Match: EDO39285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI8])

HSP 1 Score: 107.071 bits (266), Expect = 1.193e-24
Identity = 75/299 (25.08%), Postives = 138/299 (46.15%), Query Frame = -1
Query:  126 VIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAE----TIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLR 1010
             ++P  GWR L+ I  +  ++       +PES R+L+    +   ++V+  + + N+ +     +KD  +    +  + DL   +   TTIL+  I     F Y+ I+L             Q  +      S    ++  D  C  L +E+Y +M+ +  AE   +   + +I  +GRK T  +   + A   FLL  C + L + I +FI+RG  S       +Y  E++PT  R  G+G CS   R+G  ++P +  +++ K S+ +   +  G++  C   S +LP ET+ R ++
Sbjct:  196 AVMPTLGWRWLLAILCLPLLLFLAMSKWLPESCRFLLAAGEREGAIQVLRDMCEMNKKQMPQGELKDASQN-AKRGRVADLFLKDQWKTTILLWIIWFNLAFAYYGIVLTTT-------ELFQTISTEGKCASSGKHSSKADCGCQLLGVEDYVDMMWTTLAEFPGVIITMFIIDKLGRKYTAALEFVITAVFFFLLIICTDRLTMTIFIFIVRGAISGAFQTFYVYTPEVYPTVTRALGLGCCSGIARVGAMITPFVAQVLL-KESVALSMGVYGGMSVICIIASLMLPIETKGREMQ 485          
BLAST of SMED30000934 vs. Ensembl Nematostella
Match: EDO27505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T928])

HSP 1 Score: 72.0182 bits (175), Expect = 3.441e-15
Identity = 39/124 (31.45%), Postives = 65/124 (52.42%), Query Frame = -1
Query:  135 LISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDR 506
            +I  +GRK T  +   + A   FLL  C + L + I +FI+RG  S       +Y  E++PT  R  G+G CS   R+G  ++P +  +++ K S+ +   +  G++  C   S +LP ET+ R
Sbjct:    7 IIDKLGRKYTAALEFVITAVFFFLLIICTDRLTMTIFIFIVRGAISGAFQTFYVYTPEVYPTVTRALGLGCCSGIARVGAMITPFVAQVLL-KESVALSMGVYGGMSVICIIASLMLPIETKGR 129          
BLAST of SMED30000934 vs. Ensembl Nematostella
Match: EDO39286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI9])

HSP 1 Score: 72.7886 bits (177), Expect = 1.339e-14
Identity = 60/226 (26.55%), Postives = 104/226 (46.02%), Query Frame = -1
Query:  126 KPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNF-CLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLR 800
            +  I DL +P Y  TT+L+S        +Y+ + L+   +      C     +             ++  C  L   ++  +L + SAEL  +   I +I  + RK  +TI+ F IA+  F   F C   +   + L+IIRGI+     +++ Y  E++PT+ R  G+G    AGRIG  ++P +++ V+   S+     ++      C    + LP ETR R L+
Sbjct:    1 RGRIVDLFNPEYRVTTLLLSLTWFSVILSYYGMALLTTQMMTSGSNCPAFVRK-------------EECGCRLLRKRDFITLLWTTSAELPAMILTIFIIDKVRRKSLLTIY-FAIASIFFCFLFICTGRIVSTLNLYIIRGITLAASEVLVCYTGEVYPTAFRATGLGYALGAGRIGGLITP-LISQVLAASSLNAAIGVLFFFTALCTVTCYFLPIETRQRELQ 211          
BLAST of SMED30000934 vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 199.904 bits (507), Expect = 1.710e-56
Identity = 129/471 (27.39%), Postives = 241/471 (51.17%), Query Frame = -1
Query:  117 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKD------LIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV-----SFLLPYETRDRNLRETA 1493
            T+++ +  IGFGRFH  L +++     +  ++I++++ + P + C WKL+   + + +TI+F+ +    +L G  +D++GR   +        Y + +++ +P+  W    +  VG  +  +   F L  E+ PAKYR   + +A +    G  L  +LG +++P  GWR ++ IS   +++L      IPES RY +        L+ +  +A+ NRA     + E  + +P +++      L+ P++  T++L+ +   V  F Y+  +L    +      C+ N  R   V+ H++   +   C C+     +Y+ +LIS   E+  +P  I L++  GRK ++++   L A    +LN C   L   +LLF++R + SMN N++ +Y +E++PT  R  GMG C++  RIG  ++P I  +++ K      S+++    F   CV     +FLLP ETR R L + +
Sbjct:   51 TVEDAVEEIGFGRFHVLLFVIMGSANVVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQGFVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRA----GLPEGRLVEPAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCVTNAEREHQVK-HRHQGGV---CYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSK------SVVLALSPFAVACVICALGNFLLPIETRGRALLQNS 507          
BLAST of SMED30000934 vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 196.438 bits (498), Expect = 3.637e-55
Identity = 127/470 (27.02%), Postives = 239/470 (50.85%), Query Frame = -1
Query:  120 TIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKD------LIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSC-CMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV-----SFLLPYETRDRNLRET 1493
            T+++ +  IGFGRFH  L +++     +  ++I++++ + P + C WKL+   + + +TI+F+ +    +L G  +D++GR   +        Y + +++ +P+  W    +  VG  +  +   F L  E+ PAKYR   + +A +    G  L  +LG +++P  GWR ++ IS   +++L      IPES RY +        L+ +  +A+ NRA     + E  + +P +++      L+ P++  T++L+ +   V  F Y+  +L    +      C+ N  R   V+ H++   +   C C+     +Y+ +LIS   E+  +P  I L++  GRK ++++   L A    +LN C   L   +LLF++R + SMN N++ +Y +E++PT  R  GMG C++  RIG  ++P I  +++ K      S+++    F   CV     +FLLP ETR    ++ 
Sbjct:   54 TVEDAVEEIGFGRFHVLLFVIMGSANVVEAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQGFVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRA----GLPEGRLVEPAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCVTNAEREHQVK-HRHQGGV---CYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSK------SVVLALSPFAVACVICALGNFLLPIETRGHAGKDA 509          
BLAST of SMED30000934 vs. Ensembl Medaka
Match: svopb (synaptic vesicle 2-related protein [Source:NCBI gene;Acc:101161175])

HSP 1 Score: 190.274 bits (482), Expect = 1.202e-52
Identity = 133/467 (28.48%), Postives = 221/467 (47.32%), Query Frame = -1
Query:  117 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQE--PPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCME---LSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCV----SFLLPYETRDRNLRETA 1490
            +D+ L  IGFG F + + ++         ++++I+S LGP L C W L +  + +  +++FI     S + G  SDKYGR   L  C C  +Y   +SA +P   WL + + FVG  IG       L+ E+ P K R   I +     + G     LL   ++P  GWR L+ +SA+   +   F   +PESPR+ +L   +   +  +  +AK N     +          +  +KDL  P Y  TT+L+ F+   N F+Y+ I+L+   +      C           +      I+  C +E   LS ++YK++L +  AE   +   ++ I ++GRKK++ +  F+ +  I  L  C+  + L I +FI R   S    ++ +Y  E++PT  R   MG  SA  RIG  ++P +  +++ +        + LGV   C  V    S LLP ET  R L+E++
Sbjct:   73 VDDALEAIGFGVFQWKISLITGLAWVADAMEMMILSILGPELHCDWSLPSYQVALITSVVFIGMGFGSPVWGNVSDKYGRKVGLTVCMCWTLYYGILSAFAPIYGWLLVLRGFVGFGIGGAPQSVTLYTEFLPVKARGICIVLIGAFWAIGAVFEVLLALWVMPTLGWRWLLGLSALPMAVFVCFCFWLPESPRFDVLAGRREKAMATLVRIAKDNGKAMPQGTLTIYKQTNRGQLKDLFSPQYWKTTLLLWFLWFANAFSYYGIVLLTTELFQAGDLC-----------AETQGAKIEPRCSLECKYLSSDDYKDLLWTTLAEFPGLLVILLAIDYMGRKKSMALCFFMFSLCILPLFACIGRIALTIFIFICRAFISGGYQVVFVYTPEVYPTETRALAMGTSSAIARIGALITPFVAQVLLRR-----SVYVTLGVYCACGLVAGIASLLLPIETLGRGLQESS 523          
BLAST of SMED30000934 vs. Ensembl Medaka
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:101156331])

HSP 1 Score: 158.303 bits (399), Expect = 2.762e-41
Identity = 118/471 (25.05%), Postives = 217/471 (46.07%), Query Frame = -1
Query:  111 IDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNR-----AETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFC------VSFLLPYETRDRNLRETAKN 1490
            +++ +  IGFG F + L I+   +     ++++I+S L P L C W+L ++ + +  + +FI     S L G  SDKYGR T L       ++   +SA +P   W+ + +  VG  IG       L+ E+ P + R   I +  +  + G     LL  +++P  GWR L+ +S +   I  +    +PES RY +L   +   L  +  +A  N       + I   QE    +  IKDL   ++  TT+L+ FI   N F+Y+ ++L+   +      C +N                 +  C  L+ ++YK++L +  +E   +   +  I  +GR++T+ +   + +  +  L  C+  + + +L+FI R   +       +Y  E++PT+ R  G+G  S   R+G  ++P +  +++ +YS      + L ++  C C       S  LP ET  R L+E +  
Sbjct:   68 VEDAVEAIGFGTFQWKLSILTGLSWMADAMEMMILSILAPQLHCEWRLPSLEVALLTSAVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTMFYGILSAFAPIYGWILVLRALVGFGIGGAPQSVTLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLGLSTIPLFIFAILCFWLPESARYDVLTGNQDKALATLKRIATENGVPMPLGKLIAARQE---DRGKIKDLFSSHFRCTTVLLWFIWFANAFSYYGLVLLTTELFQEGGACGRNKQELRC-----------NLECKYLTSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRRTMALCFLIFSLALIPLYGCVGRVSMMVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-EYS------VYLALSVYCCCCLLAAVASCALPIETTGRGLQEASHR 517          
BLAST of SMED30000934 vs. Ensembl Medaka
Match: ENSORLT00000022564.2 (solute carrier family 22 member 6 [Source:NCBI gene;Acc:101166767])

HSP 1 Score: 78.9518 bits (193), Expect = 4.524e-15
Identity = 88/366 (24.04%), Postives = 154/366 (42.08%), Query Frame = -1
Query:  255 SLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQ---------EPPVTKPNIK--DLIH-PNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSM--------NINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSP 1289
            +L+ G  +DKYGR   ++    +       +A +PN Y  T  +F VG SI G+++  F L  EW+  K R+    I      FG  L   L Y+I     WR L +  +    +  +++  +P+S R+L+ N    + L V+   A+ N     KDI+         +  V K      DL+  P     +++V ++  VN   Y+ +                             S  I D       +  Y   +I     L+ +P   I +  + R + I+   FL   G    + CL ++ +   LFI++ + +M        ++++I +Y++E+FPT +R  G+GI S   R G  ++P
Sbjct:  141 ALVFGNLADKYGRRIIILISLAIQAVFGTAAAFAPNFYVYTALRFMVGTSISGVIMNAFVLGTEWTGLKQRMLAGIITDYFFGFGYILLAGLAYLI---RDWRKLQLAISAPGFLFIIYIWVLPKSARWLMANNRVEEALEVIEKAAQMNGKPISKDIEMCQQVYKADQNSVLKKKHSFIDLVRTPTMRKNSLIVFYLWFVNVLVYYGL-----------------------------SLNISD-----FGMNIYLTQMIFG---LVEMPARTITLFTLNRSRKISQLAFLAVGG----SACLLTIFIPSRLFIVKTVLAMIGKFGITASLSIIYVYSAEVFPTVIRQNGIGIGSMCARTGGVLAP 462          
BLAST of SMED30000934 vs. Planmine SMEST
Match: SMESG000011499.1 (SMESG000011499.1)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 403/466 (86.48%), Postives = 434/466 (93.13%), Query Frame = -1
Query:  102 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN*NK 1499
            METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLNAINIFIFNTIIFISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNY TY+ I+L+IPIIANIPHRCLQNWNRFSTVQ HQ +  +DDSCCM++++ NY +MLIS S E+IFIPFYIILISFIGRKKTI IFLF+I  GI  LNFCLN LQLNILLF+IRGIS+ +INLII+Y +EIFPTSVR FGMGIC A GR+G A++P + N++I+KYS+L G+MII  +N  CFCVSFLLPYET+D+NL +TA+  NK
Sbjct:    1 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLNAINIFIFNTIIFISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTAEERNK 466          
BLAST of SMED30000934 vs. Planmine SMEST
Match: SMESG000000077.1 (SMESG000000077.1)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 373/464 (80.39%), Postives = 412/464 (88.79%), Query Frame = -1
Query:  111 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGI-SIGILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 1499
            M++IDN LN+IGFGRFHFY ++V++C +GIF  Q++ ++ LGP LSC+WK+NA  +F FNTIIF      SL +G+FSDKYGR T LI  NCL  Y  F+SA+S +IYWLT+FQF +GI S+GI +T    FFEW P KYRI +I +    + FGC + TLLGYVIIPRFGWR+ ++I+A+L + L +FLIP+PES RYL+LNKGKSDCLRV+NIVAKWNRAETIKDIQEPPVTK NIKDL+HPNYL TTILVSFISLVNYFTYFCIILVIPIIANIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN
Sbjct:    1 MDSIDNALNKIGFGRFHFYFVVVMACQSGIFDFQLVTITLLGPALSCYWKINATEVFTFNTIIFSGMIIGSLTLGKFSDKYGRKTVLILSNCLFSYCIFLSAISQDIYWLTVFQFIIGIFSVGIPITTSAFFFEWCPMKYRIVYIAVNTTIIGFGCQIETLLGYVIIPRFGWRVFILITAILIIFLALFLIPVPESARYLMLNKGKSDCLRVINIVAKWNRAETIKDIQEPPVTKSNIKDLMHPNYLLTTILVSFISLVNYFTYFCIILVIPIIANIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN 464          
BLAST of SMED30000934 vs. Planmine SMEST
Match: SMESG000000110.1 (SMESG000000110.1)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 372/467 (79.66%), Postives = 413/467 (88.44%), Query Frame = -1
Query:  102 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN*NK 1499
            METIDNCLNRIGFGRFHFYLLIVLS NAGIFGLQI IMSFLGPVLSC+WKLNAINIFIFNT +FI     SLLIGRF DKYGR  ALI  NC+ IYSNF+ A SPNIYWLTLF  F+GIS+ GI L +FPL+FEWSPAKYRI FIGIAA T+SFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGK DCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNY TY+ I+L+IPIIANIPHRCLQNWNRFSTVQ HQ +  +DDSCCM++++ NY +MLIS SAE+IFIPFYIILISFIGRKKTI IFLF+I  GI  LNFCLN LQLNILLF+IRGIS++N NLI++YA EI+PTSVR FGMGICSA GR+G A++P + N+VI+KYS L+G+MII  +N  CFCV+FLLPYET+D+NL +TA+  NK
Sbjct:    1 METIDNCLNRIGFGRFHFYLLIVLSSNAGIFGLQITIMSFLGPVLSCYWKLNAINIFIFNTTMFIGKIIGSLLIGRFCDKYGRKLALIISNCIFIYSNFVCAASPNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIAAFTMSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKFDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSAEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISNLNFNLIMIYAPEIYPTSVRSFGMGICSAVGRVGGALAPLLANVVIFKYSFLVGTMIIFVLNLICFCVTFLLPYETKDQNLHQTAEERNK 467          
BLAST of SMED30000934 vs. Planmine SMEST
Match: SMESG000000287.1 (SMESG000000287.1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 356/466 (76.39%), Postives = 408/466 (87.55%), Query Frame = -1
Query:  105 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN*N 1499
            MET+D+ L++IGFGRFHFYLL+ L+ + GIFGLQI IMSFLGPVLSC+WKLNAINI IFNT +FI     SLLIGRFSDKYGR  ALI  NC+ IYSNF+ A S NIYWLTLF  F+GIS+ GI L +FPL+FEWSPAKYRI FIGIA+L  SFGCFLGTLLGYVIIPRFGWRILMVISA+LTVILTVFLIPIPESPRYL+LNKGKSDCLRVMNIVAKWNRAETIKDIQEPP+TKPNIKDLIHPNYLSTTILVSFISLVNY TY+ I+L+IPIIANIPHRCLQNWN+FSTVQ HQ +  +DDSCCM++++ NY +MLIS SAE+IFIPFYIILISFIGRKKTI IFLF+I  GI  LNFCLN LQLNILLF+IRGISS+N NLI++YA EI+PTSVR FGMGIC+A GR+G A++P + N+VI+K+S L+G+MII  +N  CFCV+FLLPYETRD+NL +TA+  N
Sbjct:    1 METLDSSLDKIGFGRFHFYLLLSLASDGGIFGLQITIMSFLGPVLSCYWKLNAINILIFNTTMFIGKIIGSLLIGRFSDKYGRKLALIISNCIFIYSNFVCAASSNIYWLTLFHLFIGISVVGIPLAVFPLYFEWSPAKYRIIFIGIASLFASFGCFLGTLLGYVIIPRFGWRILMVISAILTVILTVFLIPIPESPRYLLLNKGKSDCLRVMNIVAKWNRAETIKDIQEPPITKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNQFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSAEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISSLNYNLIMIYAPEIYPTSVRSFGMGICNAVGRVGGALAPLLANVVIFKFSFLVGTMIIFVLNLICFCVTFLLPYETRDQNLHQTAEERN 466          
BLAST of SMED30000934 vs. Planmine SMEST
Match: SMESG000069049.1 (SMESG000069049.1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 287/467 (61.46%), Postives = 364/467 (77.94%), Query Frame = -1
Query:  102 METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWKLXXXXXXXXXXXXXISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISI-GILLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYFTYFCXXXXXXXXXXIPHRCLQNWNRFSTVQSHQNSTAIDDSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIATGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGMGICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPYETRDRNLRETAKN*NK 1499
            M TI+  LN+IGFG+FH  L+ +L+ ++GIFG QI  ++ LGPVLSC+WKLN   +FIFNT++F      SL +G+ SDK+GR   LI  NC+ IY + M+ +SPNIYWL +FQF +G+ I GI +TIFP FFEWSP KYR+ FIGI+      G  +G LLGY IIPRFGWRI ++   +LT+ L+VF+  IPESPRYL+LNKG+ DCLR MNIVAKWNRAE+IKDI EPPVTK NIKDLIHPNY STT+ +SFISL  Y  Y+ I+L IPIIAN+PHRCLQNW++FS VQ+ +N+  +DDSCCM+L +ENYKNMLIS SAE+I +P Y+ LI+ IGRKKT+++ +F+I  G+ LLN CLN LQLNILLFIIRGIS++N NLI +YASEIFPTSVR  GMGI S  GRIG  +SP I  I+I+KYS L+G+MI+ G +F CFC+SFLLPYET +++L++TA + NK
Sbjct:    1 MNTIETALNQIGFGKFHITLIAILAGHSGIFGFQISCVTLLGPVLSCYWKLNVKEVFIFNTVMFTGMIFGSLFLGKLSDKFGRKPVLIMSNCVCIYCSLMAIISPNIYWLAIFQFMIGVFIVGIPITIFPFFFEWSPIKYRVVFIGISMCAFGIGGLIGNLLGYAIIPRFGWRIFILACPLLTIFLSVFIFQIPESPRYLLLNKGRFDCLRAMNIVAKWNRAESIKDIYEPPVTKSNIKDLIHPNYFSTTLFISFISLAVYLIYYSIVLAIPIIANVPHRCLQNWSQFSNVQNLKNNRIVDDSCCMKLDIENYKNMLISTSAEIISVPLYLFLITVIGRKKTLSVLIFIIMIGVSLLNLCLNLLQLNILLFIIRGISNLNFNLITIYASEIFPTSVRSSGMGITSGCGRIGGVLSPLIATIIIFKYSFLMGTMILFGFSFVCFCMSFLLPYETVNQDLQQTAADRNK 467          
The following BLAST results are available for this feature:
BLAST of SMED30000934 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOPL1.785e-5027.45SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOP9.007e-4726.71SV2 related protein [Source:HGNC Symbol;Acc:HGNC:2... [more]
SVOPL4.270e-3328.88SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL4.270e-3328.88SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL2.146e-3029.24SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
back to top
BLAST of SMED30000934 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svop-11.720e-4626.34Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
svop-11.720e-4626.34Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
hmit-1.11.150e-926.22H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
oct-11.414e-923.73Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
oct-11.414e-923.73Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43246.805e-3624.89gene:FBgn0034956 transcript:FBtr0343347[more]
CG43246.805e-3624.89gene:FBgn0034956 transcript:FBtr0072197[more]
CG86543.045e-1926.62gene:FBgn0034479 transcript:FBtr0086340[more]
CG86543.045e-1926.62gene:FBgn0034479 transcript:FBtr0305676[more]
CG86543.045e-1926.62gene:FBgn0034479 transcript:FBtr0342667[more]
back to top
BLAST of SMED30000934 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl6.894e-5528.51SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl7.253e-5528.48SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl7.253e-5528.48SVOP-like [Source:NCBI gene;Acc:492766][more]
svopa9.998e-4225.32SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
svopa1.795e-4125.32SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOP2.078e-4726.91SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP2.530e-4726.92SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP4.992e-4727.12SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP6.941e-4727.08SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
ubr73.550e-3826.72ubiquitin protein ligase E3 component n-recognin 7... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svopl1.134e-4827.77SV2 related protein homolog (rat)-like [Source:MGI... [more]
Svop1.653e-4427.14SV2 related protein [Source:MGI Symbol;Acc:MGI:191... [more]
Slc22a76.941e-1724.69solute carrier family 22 (organic anion transporte... [more]
Slc22a79.645e-1724.20solute carrier family 22 (organic anion transporte... [more]
Slc22a152.127e-1226.60solute carrier family 22 (organic anion/cation tra... [more]
back to top
BLAST of SMED30000934 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1LVS8|SVOPL_DANRE5.476e-5428.48Putative transporter SVOPL OS=Danio rerio OX=7955 ... [more]
sp|Q8N434|SVOPL_HUMAN8.573e-5027.45Putative transporter SVOPL OS=Homo sapiens OX=9606... [more]
sp|Q6PDF3|SVOPL_MOUSE7.932e-4827.77Putative transporter SVOPL OS=Mus musculus OX=1009... [more]
sp|Q2XWK0|SVOP_XENLA5.654e-4726.91Synaptic vesicle 2-related protein OS=Xenopus laev... [more]
sp|Q1JP63|SVOP_BOVIN1.573e-4626.71Synaptic vesicle 2-related protein OS=Bos taurus O... [more]
back to top
BLAST of SMED30000934 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G7A75.165e-5628.97MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A0X3PAK11.485e-5528.69MFS domain-containing protein OS=Schistocephalus s... [more]
A0A267H6X23.396e-5528.76MFS domain-containing protein (Fragment) OS=Macros... [more]
A0A267H7E73.811e-5528.97MFS domain-containing protein (Fragment) OS=Macros... [more]
A0A177BET04.809e-5530.11Putative transporter SVOPL OS=Intoshia linei OX=18... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa2.306e-4225.53SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopa2.154e-4125.53SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopl3.549e-4126.86SVOP-like [Source:NCBI gene;Acc:492766][more]
slc22a51.742e-1629.27solute carrier family 22 member 4-like [Source:NCB... [more]
slc22a156.896e-1424.51solute carrier family 22 member 15 [Source:NCBI ge... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl8.004e-5828.75SVOP-like [Source:NCBI gene;Acc:492766][more]
SLC22A71.169e-1030.67solute carrier family 22 member 7 [Source:HGNC Sym... [more]
si:dkey-190l8.22.538e-728.39si:dkey-190l8.2 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
oct21.074e-622.28organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
SLC2A93.287e-628.47solute carrier family 2 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CIN103.144e-930.32Putative transporter; member of the sugar porter f... [more]
ITR11.038e-728.49Myo-inositol transporter; member of the sugar tran... [more]
ITR22.041e-727.49Myo-inositol transporter; member of the sugar tran... [more]
YBR241C_mRNA2.482e-721.76Putative transporter, member of the sugar porter f... [more]
HXT21.928e-625.45High-affinity glucose transporter of the major fac... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413521.938e-3723.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392876.247e-3527.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392851.193e-2425.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275053.441e-1531.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392861.339e-1426.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30000934 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl1.710e-5627.39SVOP like [Source:NCBI gene;Acc:101157836][more]
svopl3.637e-5527.02SVOP like [Source:NCBI gene;Acc:101157836][more]
svopb1.202e-5228.48synaptic vesicle 2-related protein [Source:NCBI ge... [more]
svopa2.762e-4125.05SV2 related protein [Source:NCBI gene;Acc:10115633... [more]
ENSORLT00000022564.24.524e-1524.04solute carrier family 22 member 6 [Source:NCBI gen... [more]
back to top
BLAST of SMED30000934 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011499.10.000e+086.48SMESG000011499.1[more]
SMESG000000077.10.000e+080.39SMESG000000077.1[more]
SMESG000000110.10.000e+079.66SMESG000000110.1[more]
SMESG000000287.10.000e+076.39SMESG000000287.1[more]
SMESG000069049.10.000e+061.46SMESG000069049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000934 ID=SMED30000934|Name=SMED30000934|organism=Schmidtea mediterranea sexual|type=transcript|length=1859bp
CAGAGATATTTGACTGATATAGAATTTTACAAAGTTAACTGATTCAGCAG
CTTTTGTGTAATAACTTTACTAAATCATCTAAACAAGATAAAAAATATAA
ATTTATTTTAATTTTTGGCGGTTTCACGTAGATTTCGATCTCTGGTTTCA
TACGGTAGCAGAAAACTCACACAAAAGCATGTAAAGTTAACTCCCAATAT
GATCATTGAACCAATTAACATAGAATACTTATAAATAACTATATTCACTA
TTGATGGAGACATGGCCATACCAATTCTACCAGCTGCGCTGCAAATTCCC
ATTCCAAACCCCCGAACTGACGTCGGAAATATTTCAGATGCGTACATAAT
GATCAGGTTGATATTCATACTAGATATTCCTCTAATAATAAATAGCAAAA
TATTCAACTGCAAAGAATTCAAACAAAAATTTAGAAGAAAAATTCCAGTA
GCAATGAGAAATAAAAATATTGTAATTGTTTTCTTTCGGCCAATGAAACT
GATGAGAATTATATAAAATGGAATGAAAATCAGTTCTGCGGAAGCTGATA
TAAGCATATTTTTGTAATTTTCTAAACTCAGTTCCATGCAGCAAGAATCA
TCGATCGCAGTGCTATTTTGATGGCTTTGGACGGTGGAGAATCGATTCCA
ATTCTGCAGACATCTGTGAGGAATATTTGCAATTATCGGAATCACTAAAA
TGATGCAGAAGTAAGTAAAATAATTCACCAATGAAATGAATGAAACAAGA
ATTGTTGTTGATAAATAATTCGGATGTATCAAATCTTTGATATTGGGTTT
GGTGACTGGCGGTTCTTGAATATCTTTGATCGTTTCGGCTCGGTTCCATT
TAGCAACGATGTTCATTACTCTCAAACAATCGGATTTGCCTTTATTTAAT
ATCAAATATCTCGGTGACTCTGGAATTGGAATTAGAAATACTGTTAGAAT
GACTGTTAAAACTGCAGATATCACCATGAGAATCCTCCATCCGAATCTTG
GAATAATTACATATCCAAGAAGAGTTCCTAAAAAGCACCCAAAACTCAAA
GTCAAAGCAGCTATTCCAATGAAAAAAATTCTATATTTTGCTGGAGACCA
CTCAAAAAATAATGGAAAAATTGTCAACAAAATGCCAATAGAAATCCCAA
CAAAAAATTGAAAGAGCGTCAACCAATAAATATTCGGAGAGACCGCAGAC
ATGAAATTGGAATAAATTAATAAGCAATTACAAAAGATCAATGCGGTATT
TCTGCCGTATTTATCGCTAAACCTTCCAATCAATAAGCTCCAGGTGAAAT
AACTAATAAATATTATTGTGTTGAAAATAAATATATTTATGGCATTCAGT
TTCCAAAAGCAACTGAGGACCGGCCCCAGAAAAGACATAATAATAATTTG
CAATCCAAAAATCCCAGCATTGCACGATAAAACTATAAGCAAATAGAAAT
GAAATCTTCCAAATCCGATTCGATTTAAGCAATTGTCAATTGTTTCCATT
TCTCATAAAATGTTTTATTTTGCGGAGGAATGCAATGCACTCCGCAAACA
ACGCATTCAATGCTGCAAATATACGTGCTAAAAATCGTCGTATCAACTGA
TGAGAAATTATCAGTAAATGACAGAAAATAAGTGACGCACTTGTCAAATT
CGTGTCAATATGTAATTTTATCAATGAAAAACATTTTTTAAATATGTTTC
CAGTTTCCTAGTTGAAATTCATGAATTCTATTGAAATGAAACGTATAGAA
TATTATTTGTCTTCAATTTGTACGCACACTCGTAAATGATTATAATATCA
ATGTGCTGATAACGACCTTTTCAAGTGATGTAAATTAATTGGTGGATCCA
AAGGTGGAG
back to top

protein sequence of SMED30000934-orf-1

>SMED30000934-orf-1 ID=SMED30000934-orf-1|Name=SMED30000934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MFITLKQSDLPLFNIKYLGDSGIGIRNTVRMTVKTADITMRILHPNLGII
TYPRRVPKKHPKLKVKAAIPMKKILYFAGDHSKNNGKIVNKMPIEIPTKN
*
back to top

protein sequence of SMED30000934-orf-2

>SMED30000934-orf-2 ID=SMED30000934-orf-2|Name=SMED30000934-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
METIDNCLNRIGFGRFHFYLLIVLSCNAGIFGLQIIIMSFLGPVLSCFWK
LNAINIFIFNTIIFISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFM
SAVSPNIYWLTLFQFFVGISIGILLTIFPLFFEWSPAKYRIFFIGIAALT
LSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLI
LNKGKSDCLRVMNIVAKWNRAETIKDIQEPPVTKPNIKDLIHPNYLSTTI
LVSFISLVNYFTYFCIILVIPIIANIPHRCLQNWNRFSTVQSHQNSTAID
DSCCMELSLENYKNMLISASAELIFIPFYIILISFIGRKKTITIFLFLIA
TGIFLLNFCLNSLQLNILLFIIRGISSMNINLIIMYASEIFPTSVRGFGM
GICSAAGRIGMAMSPSIVNIVIYKYSMLIGSMIILGVNFTCFCVSFLLPY
ETRDRNLRETAKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 1..166
e-value: 3.2E-13
score: 51.3
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 2..165
NoneNo IPR availablePANTHERPTHR24064:SF457TRANSPORTER SVOPL-RELATEDcoord: 2..165
NoneNo IPR availableCDDcd17442MFS_SVOPLcoord: 74..165
e-value: 5.17814E-6
score: 43.2567
NoneNo IPR availableCDDcd17358MFS_GLUT6_8_Class3_likecoord: 2..91
e-value: 0.0023863
score: 35.2436
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.604
NoneNo IPR availableTMHMMTMhelixcoord: 77..99
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 141..163