RNA-binding protein Nova-1

Overview
NameRNA-binding protein Nova-1
Smed IDSMED30000921
Length (bp)1621
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein Nova-1 (SMED30000921) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein Nova-1 (SMED30000921) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein Nova-1 (SMED30000921) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein Nova-1 (SMED30000921) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000921

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000921SMESG000066554.1 Contig50561newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000921SMESG000066554.1 Contig50561uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30000921SMESG000066554.1 dd_Smed_v6_8705_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000921SMESG000066554.1 dd_Smed_v4_679_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein Nova-1 vs. Ensembl Human
Match: NOVA2 (NOVA alternative splicing regulator 2 [Source:HGNC Symbol;Acc:HGNC:7887])

HSP 1 Score: 131.724 bits (330), Expect = 2.135e-32
Identity = 78/214 (36.45%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQT-------------MNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPS 732
            ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCL+QG  +++  +  +IA ++ E   + T             MN +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V + G  +Q ++A   I+ K+ ED +  S  NI+Y ++  P +   S+  G P  +P+
Sbjct:   26 NTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRA--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVAN--SNPTGSPYASPA 235          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Human
Match: NOVA1 (NOVA alternative splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:7886])

HSP 1 Score: 125.561 bits (314), Expect = 2.627e-30
Identity = 78/190 (41.05%), Postives = 116/190 (61.05%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R   +Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   52 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDR--IKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 239          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Human
Match: NOVA1 (NOVA alternative splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:7886])

HSP 1 Score: 117.087 bits (292), Expect = 8.387e-29
Identity = 80/220 (36.36%), Postives = 117/220 (53.18%), Query Frame = 1
Query:  133 SNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQ----------------------RQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            S       LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:    3 SEEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 222          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Human
Match: NOVA1 (NOVA alternative splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:7886])

HSP 1 Score: 117.857 bits (294), Expect = 1.409e-27
Identity = 79/212 (37.26%), Postives = 116/212 (54.72%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQ----------------------RQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   52 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 263          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Human
Match: NOVA1 (NOVA alternative splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:7886])

HSP 1 Score: 93.2041 bits (230), Expect = 1.638e-21
Identity = 64/172 (37.21%), Postives = 93/172 (54.07%), Query Frame = 1
Query:  118 HSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQR----------------------QTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPK 528
            H +  S       LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K
Sbjct:    2 HPMHRSREDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQK 173          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Celegans
Match: nova-1 (NOVA kh (KH) homology domain homolog [Source:UniProtKB/TrEMBL;Acc:Q9GRY9])

HSP 1 Score: 91.6633 bits (226), Expect = 1.265e-19
Identity = 60/171 (35.09%), Postives = 105/171 (61.40%), Query Frame = 1
Query:  145 DNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTM-----NQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNN---RQFLERYVLIMGN-SDQCYEATRKIINKIVED 630
            D++ +K+LIPS   GA+IGKGGE +   + D   +V++SK +E +PGT+ER+CL++G  ++I+ +I+ I ++I E    Q       ++N     + KI++PN+SAG++IGK G  I +I++  G  IQV PK+ +   +  LER V +  + +    +A  +++ K+  D
Sbjct:   40 DHLSIKILIPSNAVGAIIGKGGEAMRNLKNDNNCRVQMSKNSETYPGTSERICLVKGRLNNIMAVIESIQDKIREKCADQGGSDAFDHKNTSRGAEIKIVMPNTSAGMVIGKSGANIKDIREQFGCQIQVYPKAGSVEAKTSLERVVTVAHDEASALLQAASRVLEKVASD 210          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Celegans
Match: nova-1 (NOVA kh (KH) homology domain homolog [Source:UniProtKB/TrEMBL;Acc:Q9GRY9])

HSP 1 Score: 91.6633 bits (226), Expect = 1.265e-19
Identity = 60/171 (35.09%), Postives = 105/171 (61.40%), Query Frame = 1
Query:  145 DNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTM-----NQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNN---RQFLERYVLIMGN-SDQCYEATRKIINKIVED 630
            D++ +K+LIPS   GA+IGKGGE +   + D   +V++SK +E +PGT+ER+CL++G  ++I+ +I+ I ++I E    Q       ++N     + KI++PN+SAG++IGK G  I +I++  G  IQV PK+ +   +  LER V +  + +    +A  +++ K+  D
Sbjct:   40 DHLSIKILIPSNAVGAIIGKGGEAMRNLKNDNNCRVQMSKNSETYPGTSERICLVKGRLNNIMAVIESIQDKIREKCADQGGSDAFDHKNTSRGAEIKIVMPNTSAGMVIGKSGANIKDIREQFGCQIQVYPKAGSVEAKTSLERVVTVAHDEASALLQAASRVLEKVASD 210          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Celegans
Match: nova-1 (NOVA kh (KH) homology domain homolog [Source:UniProtKB/TrEMBL;Acc:Q9GRY9])

HSP 1 Score: 91.6633 bits (226), Expect = 1.265e-19
Identity = 60/171 (35.09%), Postives = 105/171 (61.40%), Query Frame = 1
Query:  145 DNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTM-----NQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNN---RQFLERYVLIMGN-SDQCYEATRKIINKIVED 630
            D++ +K+LIPS   GA+IGKGGE +   + D   +V++SK +E +PGT+ER+CL++G  ++I+ +I+ I ++I E    Q       ++N     + KI++PN+SAG++IGK G  I +I++  G  IQV PK+ +   +  LER V +  + +    +A  +++ K+  D
Sbjct:   40 DHLSIKILIPSNAVGAIIGKGGEAMRNLKNDNNCRVQMSKNSETYPGTSERICLVKGRLNNIMAVIESIQDKIREKCADQGGSDAFDHKNTSRGAEIKIVMPNTSAGMVIGKSGANIKDIREQFGCQIQVYPKAGSVEAKTSLERVVTVAHDEASALLQAASRVLEKVASD 210          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Celegans
Match: fubl-2 (FUBp (FUBP) Like [Source:UniProtKB/TrEMBL;Acc:Q23487])

HSP 1 Score: 57.3806 bits (137), Expect = 1.671e-8
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 1
Query:  400 REYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKI 609
            +E Q + ++I+P  SAG++IGK GE I  +   TG  IQ  P +N     +R  +IMG  DQ Y AT +I
Sbjct:  236 QEAQAKGEVIVPRLSAGMIIGKGGEMIKRLAAETGTKIQFKPDTNPNSE-DRIAVIMGTRDQIYRATERI 304          

HSP 2 Score: 49.2914 bits (116), Expect = 6.086e-6
Identity = 50/163 (30.67%), Postives = 83/163 (50.92%), Query Frame = 1
Query:  160 KVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINM---IDYIANRIAETN----DSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVE 627
            +V++P +  G +IGKGGE I +   +TGTK++  KP +  P + +R+ +I G +D I      I  I NR  + N    D  +       Q    + +P    GL+IGK GE I +I++ TGA   ++P +  +   E+   I G+  Q + A+  +  K+ E
Sbjct:  243 EVIVPRLSAGMIIGKGGEMIKRLAAETGTKIQF-KP-DTNPNSEDRIAVIMGTRDQIYRATERITEIVNRAIKNNGAPQDRGSAGTVLPGQSIFYMHVPAGKCGLVIGKGGENIKQIERETGATCGLAPAAEQKNEDEKVFEIKGSQLQIHHASHLVRIKVGE 403          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Celegans
Match: fubl-2 (FUBp (FUBP) Like [Source:UniProtKB/TrEMBL;Acc:Q23487])

HSP 1 Score: 57.3806 bits (137), Expect = 1.872e-8
Identity = 30/80 (37.50%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  400 REYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRK---IINKIVED 630
            +E Q + ++I+P  SAG++IGK GE I  +   TG  IQ  P +N     +R  +IMG  DQ Y AT +   I+N+ +++
Sbjct:  189 QEAQAKGEVIVPRLSAGMIIGKGGEMIKRLAAETGTKIQFKPDTNPNSE-DRIAVIMGTRDQIYRATERITEIVNRAIKN 267          

HSP 2 Score: 48.9062 bits (115), Expect = 7.223e-6
Identity = 50/163 (30.67%), Postives = 83/163 (50.92%), Query Frame = 1
Query:  160 KVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINM---IDYIANRIAETN----DSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVE 627
            +V++P +  G +IGKGGE I +   +TGTK++  KP+   P + +R+ +I G +D I      I  I NR  + N    D  +       Q    + +P    GL+IGK GE I +I++ TGA   ++P +  +   E+   I G+  Q + A+  +  K+ E
Sbjct:  196 EVIVPRLSAGMIIGKGGEMIKRLAAETGTKIQF-KPDTN-PNSEDRIAVIMGTRDQIYRATERITEIVNRAIKNNGAPQDRGSAGTVLPGQSIFYMHVPAGKCGLVIGKGGENIKQIERETGATCGLAPAAEQKNEDEKVFEIKGSQLQIHHASHLVRIKVGE 356          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Fly
Match: ps (gene:FBgn0261552 transcript:FBtr0082037)

HSP 1 Score: 140.969 bits (354), Expect = 4.889e-36
Identity = 81/206 (39.32%), Postives = 132/206 (64.08%), Query Frame = 1
Query:  154 HLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETND------SQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSF 753
            H+K+L+P++  GA+IGKGGE I   QKDTG +VK+SK ++F+PGTTERVCLI G  ++I+ ++++I ++I E  D           Q +E  +Q KI++PNS+AG++IGK G  I +IK+ +G+++Q+S K  +    ER + I+G+ +    A + I++KIVED +  +  N++Y D+  P +     NF  P G+P   + N+ 
Sbjct:   34 HMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVA-----NFN-PTGSPYATNQNAI 233          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Fly
Match: ps (gene:FBgn0261552 transcript:FBtr0334303)

HSP 1 Score: 140.969 bits (354), Expect = 8.666e-36
Identity = 81/206 (39.32%), Postives = 132/206 (64.08%), Query Frame = 1
Query:  154 HLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETND------SQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSF 753
            H+K+L+P++  GA+IGKGGE I   QKDTG +VK+SK ++F+PGTTERVCLI G  ++I+ ++++I ++I E  D           Q +E  +Q KI++PNS+AG++IGK G  I +IK+ +G+++Q+S K  +    ER + I+G+ +    A + I++KIVED +  +  N++Y D+  P +     NF  P G+P   + N+ 
Sbjct:   12 HMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVA-----NFN-PTGSPYATNQNAI 211          

HSP 2 Score: 55.0694 bits (131), Expect = 1.265e-7
Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 1135 TRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRA 1371
            ++ +EV E  IGAILG  GRS+VE+Q V+  N+++S K          R VTITG    +++A  LI  KI  E+ +RA
Sbjct:  430 SKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQIS-KKGIFAPGTRNRIVTITGQPSAIAKAQYLIEQKINEEETKRA 507          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Fly
Match: ps (gene:FBgn0261552 transcript:FBtr0111032)

HSP 1 Score: 140.969 bits (354), Expect = 9.783e-36
Identity = 82/213 (38.50%), Postives = 135/213 (63.38%), Query Frame = 1
Query:  133 SNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETND------SQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSF 753
            S+ +   H+K+L+P++  GA+IGKGGE I   QKDTG +VK+SK ++F+PGTTERVCLI G  ++I+ ++++I ++I E  D           Q +E  +Q KI++PNS+AG++IGK G  I +IK+ +G+++Q+S K  +    ER + I+G+ +    A + I++KIVED +  +  N++Y D+  P +     NF  P G+P   + N+ 
Sbjct:   38 SSGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVA-----NFN-PTGSPYATNQNAI 244          

HSP 2 Score: 55.4546 bits (132), Expect = 9.373e-8
Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 1135 TRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRA 1371
            ++ +EV E  IGAILG  GRS+VE+Q V+  N+++S K          R VTITG    +++A  LI  KI  E+ +RA
Sbjct:  463 SKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQIS-KKGIFAPGTRNRIVTITGQPSAIAKAQYLIEQKINEEETKRA 540          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Fly
Match: ps (gene:FBgn0261552 transcript:FBtr0302695)

HSP 1 Score: 140.969 bits (354), Expect = 9.783e-36
Identity = 82/213 (38.50%), Postives = 135/213 (63.38%), Query Frame = 1
Query:  133 SNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETND------SQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSF 753
            S+ +   H+K+L+P++  GA+IGKGGE I   QKDTG +VK+SK ++F+PGTTERVCLI G  ++I+ ++++I ++I E  D           Q +E  +Q KI++PNS+AG++IGK G  I +IK+ +G+++Q+S K  +    ER + I+G+ +    A + I++KIVED +  +  N++Y D+  P +     NF  P G+P   + N+ 
Sbjct:   38 SSGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVA-----NFN-PTGSPYATNQNAI 244          

HSP 2 Score: 55.4546 bits (132), Expect = 9.373e-8
Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 1135 TRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRA 1371
            ++ +EV E  IGAILG  GRS+VE+Q V+  N+++S K          R VTITG    +++A  LI  KI  E+ +RA
Sbjct:  463 SKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQIS-KKGIFAPGTRNRIVTITGQPSAIAKAQYLIEQKINEEETKRA 540          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Fly
Match: ps (gene:FBgn0261552 transcript:FBtr0302694)

HSP 1 Score: 140.969 bits (354), Expect = 9.783e-36
Identity = 82/213 (38.50%), Postives = 135/213 (63.38%), Query Frame = 1
Query:  133 SNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETND------SQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSF 753
            S+ +   H+K+L+P++  GA+IGKGGE I   QKDTG +VK+SK ++F+PGTTERVCLI G  ++I+ ++++I ++I E  D           Q +E  +Q KI++PNS+AG++IGK G  I +IK+ +G+++Q+S K  +    ER + I+G+ +    A + I++KIVED +  +  N++Y D+  P +     NF  P G+P   + N+ 
Sbjct:   38 SSGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVA-----NFN-PTGSPYATNQNAI 244          

HSP 2 Score: 55.4546 bits (132), Expect = 9.373e-8
Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 1135 TRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRA 1371
            ++ +EV E  IGAILG  GRS+VE+Q V+  N+++S K          R VTITG    +++A  LI  KI  E+ +RA
Sbjct:  463 SKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQIS-KKGIFAPGTRNRIVTITGQPSAIAKAQYLIEQKINEEETKRA 540          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Zebrafish
Match: nova2 (NOVA alternative splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-080211-1])

HSP 1 Score: 132.88 bits (333), Expect = 4.589e-33
Identity = 82/206 (39.81%), Postives = 125/206 (60.68%), Query Frame = 1
Query:  109 ASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            AS     ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ N+ D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V I G  +Q  +A   I+ KI ED +  S  NI+Y++I  P +
Sbjct:   43 ASSTKRTNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNNVHDFIAEKVREMPQSAQKTEPVSILQPQTTVNPDRV--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNISGPVA 246          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Zebrafish
Match: nova2 (NOVA alternative splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-080211-1])

HSP 1 Score: 132.88 bits (333), Expect = 5.341e-33
Identity = 82/206 (39.81%), Postives = 125/206 (60.68%), Query Frame = 1
Query:  109 ASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            AS     ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ N+ D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V I G  +Q  +A   I+ KI ED +  S  NI+Y++I  P +
Sbjct:   43 ASSTKRTNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNNVHDFIAEKVREMPQSAQKTEPVSILQPQTTVNPDRV--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNISGPVA 246          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Zebrafish
Match: nova2 (NOVA alternative splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-080211-1])

HSP 1 Score: 132.88 bits (333), Expect = 6.753e-33
Identity = 85/211 (40.28%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  109 ASHHSLFDSN----HQDNIH-LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            A H   F S+    H++  + LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ N+ D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V I G  +Q  +A   I+ KI ED +  S  NI+Y++I  P +
Sbjct:   59 AIHDPPFSSDIVGFHEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNNVHDFIAEKVREMPQSAQKTEPVSILQPQTTVNPDRV--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNISGPVA 267          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Zebrafish
Match: nova2 (NOVA alternative splicing regulator 2 [Source:ZFIN;Acc:ZDB-GENE-080211-1])

HSP 1 Score: 132.88 bits (333), Expect = 6.825e-33
Identity = 85/211 (40.28%), Postives = 129/211 (61.14%), Query Frame = 1
Query:  109 ASHHSLFDSN----HQDNIH-LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            A H   F S+    H++  + LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ N+ D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V I G  +Q  +A   I+ KI ED +  S  NI+Y++I  P +
Sbjct:   59 AIHDPPFSSDIVGFHEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNNVHDFIAEKVREMPQSAQKTEPVSILQPQTTVNPDRV--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNISGPVA 267          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Zebrafish
Match: nova1 (NOVA alternative splicing regulator 1 [Source:ZFIN;Acc:ZDB-GENE-060526-113])

HSP 1 Score: 128.257 bits (321), Expect = 1.827e-31
Identity = 84/230 (36.52%), Postives = 131/230 (56.96%), Query Frame = 1
Query:  109 ASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFEN 759
            AS     ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  + ++IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V + G  +Q  +A   I+ KI ED +  S  NI+Y++I  P + +       P G+P  N +    N
Sbjct:   43 ASSTKRSNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNGVHNFIAEKVREMPQSSQKTEPVSILQPQTTVNPDR--IKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNITGPVANS------NPTGSPFANSTEVLPN 264          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Xenopus
Match: nova2 (neuro-oncological ventral antigen 2 [Source:NCBI gene;Acc:595078])

HSP 1 Score: 128.257 bits (321), Expect = 8.797e-32
Identity = 75/197 (38.07%), Postives = 118/197 (59.90%), Query Frame = 1
Query:  133 SNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQ-----------NREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVED-TKLCSFPNINYNDIMAPTS 687
            +     + LKVLIPS   G++IGKGG+ I++ Q++TG  +K+SK  +F+PGTTERVCL+QG  +S++++ ++IA ++ E     T N            N E  +Q K+I+PN++AGL+IGK G T+  I + +GA++Q+S K       ER V + G   Q  +A R II+K  ED  +  +  NI+Y +   P +
Sbjct:   49 AGEDGELFLKVLIPSYAAGSIIGKGGQTIVQLQRETGATIKLSKSKDFYPGTTERVCLVQGSAESLLSVHNFIAEKVREVPQGGTKNDLGVLLPPQTTINAERAKQAKLIVPNTTAGLIIGKGGATVRSIMEESGAWVQLSQKPAGPNLHERVVTVSGEPSQVQKAIRSIIHKSREDPPQGTTHLNISYTNSQGPVA 245          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Xenopus
Match: nova2 (neuro-oncological ventral antigen 2 [Source:NCBI gene;Acc:595078])

HSP 1 Score: 128.257 bits (321), Expect = 1.269e-31
Identity = 75/197 (38.07%), Postives = 118/197 (59.90%), Query Frame = 1
Query:  133 SNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQ-----------NREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVED-TKLCSFPNINYNDIMAPTS 687
            +     + LKVLIPS   G++IGKGG+ I++ Q++TG  +K+SK  +F+PGTTERVCL+QG  +S++++ ++IA ++ E     T N            N E  +Q K+I+PN++AGL+IGK G T+  I + +GA++Q+S K       ER V + G   Q  +A R II+K  ED  +  +  NI+Y +   P +
Sbjct:   49 AGEDGELFLKVLIPSYAAGSIIGKGGQTIVQLQRETGATIKLSKSKDFYPGTTERVCLVQGSAESLLSVHNFIAEKVREVPQGGTKNDLGVLLPPQTTINAERAKQAKLIVPNTTAGLIIGKGGATVRSIMEESGAWVQLSQKPAGPNLHERVVTVSGEPSQVQKAIRSIIHKSREDPPQGTTHLNISYTNSQGPVA 245          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Xenopus
Match: hapln2 (hyaluronan and proteoglycan link protein 2 [Source:Xenbase;Acc:XB-GENE-6035673])

HSP 1 Score: 125.176 bits (313), Expect = 3.328e-30
Identity = 77/199 (38.69%), Postives = 118/199 (59.30%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            ++       LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R   +Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   I+ KI ED +  S  NI+Y ++  P +
Sbjct:   43 NTGEDGQFFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDR--IKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIVQKIQEDPQSGSCLNISYANVTGPVA 239          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Xenopus
Match: hapln2 (hyaluronan and proteoglycan link protein 2 [Source:Xenbase;Acc:XB-GENE-6035673])

HSP 1 Score: 124.79 bits (312), Expect = 3.625e-30
Identity = 77/199 (38.69%), Postives = 118/199 (59.30%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            ++       LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R   +Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   I+ KI ED +  S  NI+Y ++  P +
Sbjct:   43 NTGEDGQFFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDR--IKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIVQKIQEDPQSGSCLNISYANVTGPVA 239          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Xenopus
Match: hapln2 (hyaluronan and proteoglycan link protein 2 [Source:Xenbase;Acc:XB-GENE-6035673])

HSP 1 Score: 117.472 bits (293), Expect = 1.703e-27
Identity = 78/221 (35.29%), Postives = 118/221 (53.39%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQ----------------------RQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            ++       LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   I+ KI ED +  S  NI+Y ++  P +
Sbjct:   43 NTGEDGQFFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLSSLPPATKSSPSDPMTISRASQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIVQKIQEDPQSGSCLNISYANVTGPVA 263          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Mouse
Match: Nova2 (NOVA alternative splicing regulator 2 [Source:MGI Symbol;Acc:MGI:104296])

HSP 1 Score: 131.724 bits (330), Expect = 1.494e-32
Identity = 78/214 (36.45%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQT-------------MNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPS 732
            ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCL+QG  +++  +  +IA ++ E   + T             MN +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V + G  +Q ++A   I+ K+ ED +  S  NI+Y ++  P +   S+  G P  +P+
Sbjct:   26 NTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRA--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVAN--SNPTGSPYASPA 235          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Mouse
Match: Nova2 (NOVA alternative splicing regulator 2 [Source:MGI Symbol;Acc:MGI:104296])

HSP 1 Score: 132.109 bits (331), Expect = 1.876e-32
Identity = 78/214 (36.45%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQT-------------MNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPS 732
            ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCL+QG  +++  +  +IA ++ E   + T             MN +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V + G  +Q ++A   I+ K+ ED +  S  NI+Y ++  P +   S+  G P  +P+
Sbjct:   90 NTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRA--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVAN--SNPTGSPYASPA 299          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Mouse
Match: Nova1 (NOVA alternative splicing regulator 1 [Source:MGI Symbol;Acc:MGI:104297])

HSP 1 Score: 117.857 bits (294), Expect = 8.174e-28
Identity = 80/212 (37.74%), Postives = 116/212 (54.72%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQ----------------------RQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  I + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   52 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 263          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Mouse
Match: Nova1 (NOVA alternative splicing regulator 1 [Source:MGI Symbol;Acc:MGI:104297])

HSP 1 Score: 56.6102 bits (135), Expect = 1.665e-9
Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  229 QKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSA 447
            QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E      M QN        I+ P ++ 
Sbjct:    8 QKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIRE------MPQNVAKTEPVSILQPQTTV 74          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Mouse
Match: Pcbp3 (poly(rC) binding protein 3 [Source:MGI Symbol;Acc:MGI:1890470])

HSP 1 Score: 56.225 bits (134), Expect = 1.951e-8
Identity = 54/200 (27.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  223 KAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAE--TNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVS----PKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPT--------SYTISDNFGVP---IGTPSFNHSNSFENPSFP 771
            K ++++G ++ IS+ N       ER+  I G  D+I      IA +  E   N         +     ++++P S  G LIGK G  I EI++STGA +QV+    P S      ER V I G  D   +  ++I   ++E     +   I Y    A T        +YTI   + +P   +  P+  H  +  +  FP
Sbjct:   38 KMREESGARINISEGN-----CPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNST-----ERAVTISGTPDAIIQCVKQICVVMLESPPKGA--TIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDVWMPA--HRPALMSSPFP 223          
BLAST of RNA-binding protein Nova-1 vs. UniProt/SwissProt
Match: sp|Q9UNW9|NOVA2_HUMAN (RNA-binding protein Nova-2 OS=Homo sapiens OX=9606 GN=NOVA2 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.025e-31
Identity = 78/214 (36.45%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQT-------------MNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPS 732
            ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCL+QG  +++  +  +IA ++ E   + T             MN +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V + G  +Q ++A   I+ K+ ED +  S  NI+Y ++  P +   S+  G P  +P+
Sbjct:   26 NTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRA--KQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVAN--SNPTGSPYASPA 235          
BLAST of RNA-binding protein Nova-1 vs. UniProt/SwissProt
Match: sp|Q2PFW9|NOVA1_MACFA (RNA-binding protein Nova-1 OS=Macaca fascicularis OX=9541 GN=NOVA1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 9.391e-30
Identity = 79/190 (41.58%), Postives = 116/190 (61.05%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R   +Q KII+PNS+AGL+IGK G T+  I + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   52 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDR--IKQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 239          
BLAST of RNA-binding protein Nova-1 vs. UniProt/SwissProt
Match: sp|Q80WA4|NOVA1_RAT (RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Nova1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.207e-29
Identity = 79/190 (41.58%), Postives = 116/190 (61.05%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R   +Q KII+PNS+AGL+IGK G T+  I + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   51 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDR--IKQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 238          
BLAST of RNA-binding protein Nova-1 vs. UniProt/SwissProt
Match: sp|Q9JKN6|NOVA1_MOUSE (RNA-binding protein Nova-1 OS=Mus musculus OX=10090 GN=Nova1 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 5.718e-27
Identity = 80/212 (37.74%), Postives = 116/212 (54.72%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQ----------------------RQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  I + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   52 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 263          
BLAST of RNA-binding protein Nova-1 vs. UniProt/SwissProt
Match: sp|P51513|NOVA1_HUMAN (RNA-binding protein Nova-1 OS=Homo sapiens OX=9606 GN=NOVA1 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 6.764e-27
Identity = 79/212 (37.26%), Postives = 116/212 (54.72%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET-------------NDSQTMNQNREYQ----------------------RQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  +  +IA +I E                  T+N +R  Q                       Q KII+PNS+AGL+IGK G T+  + + +GA++Q+S K +     ER V + G  +Q  +A   II KI ED +  S  NI+Y ++  P +
Sbjct:   52 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVA 263          
BLAST of RNA-binding protein Nova-1 vs. TrEMBL
Match: B7PQM3 (RNA-binding protein Nova-1, putative (Fragment) OS=Ixodes scapularis OX=6945 GN=8052247 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.444e-42
Identity = 145/465 (31.18%), Postives = 217/465 (46.67%), Query Frame = 1
Query:  112 SHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTM-------NQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPPSVSLNTKAL----KNILSQNEMSNPSKSNMNLMEIAHALQILAQNGCLCPS--------------NSSNSKDNRNHGYYSQ---GTNSQYPT---SRSLTTTFSQM---------------DYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRR 1368
            SHH   +  +    H K+L+P++  GA+IGKGGE I   QK+ G +VK+SK N+F+PGTTERVCLI G  + ++ + ++I  +I E  D            Q  E ++Q KI++PNS+AG++IGK G  I +IK+ +GA++Q+S KS +    ER + ++G  +   +A   I+ KIVED +  S  +++Y ++  P +     NF  P G+P  N S+S   PSFP                         V P+V+ N   L    K +L  N  +  + +     +IA A+  LA  G L  S                 N       G  +Q   G  +  P    S  L T    +                 +A  +   + R LEV E  +GAILG  G+S+VE+Q  +   I++S K          R VTITG    VS A  LI  +I  E+ +R
Sbjct:   41 SHHGGGNGTY----HFKILVPAVAAGAIIGKGGETIALLQKEAGARVKMSKSNDFYPGTTERVCLITGSVEGVLRIHEFIMEKIKEKPDPTAKIAIDFDHKQPAEREKQVKILVPNSTAGMIIGKGGSYIKQIKEESGAYVQISQKSKDHALAERCITVIGELENNKKACHMILAKIVEDPQSGSCLHVSYAEVTGPVA-----NFN-PTGSPYANPSSSLV-PSFP------------------------GVAPAVAGNVAQLLENVKAVLRSNGYTEQATA-----DIAAAMGTLASYGVLGSSLGALLAGMNGTLVAGGGNPPQPLQMGTNAQQAIGNGTGLPVNNNSFGLGTGLGAIPGAGPMQCKSPPPPGGAVAEKAGDAVKRDLEVGENIVGAILGPGGKSLVEIQRFSGAAIQIS-KKGIFAPGTRNRIVTITGSPNAVSTAQYLIEQQIAEEEAKR 464          
BLAST of RNA-binding protein Nova-1 vs. TrEMBL
Match: J9KN76 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 GN=100161431 PE=4 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 1.041e-41
Identity = 149/487 (30.60%), Postives = 237/487 (48.67%), Query Frame = 1
Query:  112 SHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEK-DSIINMIDYIANRIAETNDSQTMNQN-----REYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSI---DMRNGKFDPTQSSRLSHVPP---------------SVSLNTKALKNILSQNEMSN-----------PSKSNMN-----------LMEIAHALQILAQNGCLCPSNSSNSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQMD------------------YIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRAMAY 1380
            +H S    N     H+K+LIP I  GA+IGKGGE I + Q +T TK+K+SK N+F+PGTTERVC+I G   + I+  + +I  RI E  D+    QN      + ++Q KI+IPNS+AG++IGK G  I ++K+ +G F+Q+S K+ +    ER + + GN++   +    I+NKI+ED    S PN++Y D+  P +     NF  P G+P    + +  N    Y+   TS+   D+ NG F    +  L +V P               +V+  T A  N+LS N +             PS ++ N           L ++  A   ++ N  L  + +S +  N N   Y  G  +    + +  +T   M                    + +D  Q + R ++V E+ +GAI+G  GRS+VE+Q+++   I +S K        T R VTI G    ++ A  L+  +I  E+ +RA A+
Sbjct:  183 THSSSVAGNSDGMYHMKILIPCITAGAIIGKGGETIAQLQTETNTKIKMSKTNDFYPGTTERVCIISGSSSEHIMAALTFIMERIREKPDASNRVQNSGDAIADREKQVKILIPNSTAGMIIGKAGAYIKQLKEDSGCFVQISQKAKDTTLQERCITVSGNTEGNKKVCLCILNKIIEDPLSASCPNLSYADVNGPVA-----NFN-PTGSPYALATTNCSNNQTSYNLNATSLSTQDVSNGIF---TNKFLDNVKPLLRSSGYPESAVNEIAVAFLTLAKHNVLSPNSIIGLINQTSILQPAPSVAHHNGTGLLSTVTNDLFDLGLAGGAISINAILSQNAASPTLSNANS--YGLGVAAAAAAAAAAASTPKAMGPTTNAAAAAAAAAAAALYEMTADDQQSVKREMDVPESIVGAIIGPGGRSLVEIQQMSGVTIHIS-KKGVYAPGTTNRKVTICGSASGIAMANYLMQQRIVDEETKRARAF 657          
BLAST of RNA-binding protein Nova-1 vs. TrEMBL
Match: A0A5E4NLF6 (K Homology domain,K Homology domain, type 1 OS=Cinara cedri OX=506608 GN=CINCED_3A004941 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.638e-41
Identity = 146/484 (30.17%), Postives = 239/484 (49.38%), Query Frame = 1
Query:  112 SHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEK-DSIINMIDYIANRIAETNDSQTMNQN-----REYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYS---AKETSIDMRNGKFDPTQSSRLSHVPP---------------SVSLNTKALKNILSQNEM----------------SNPSKSNMN-----------LMEIAHALQILAQNGCLCPSNSSNSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQ----------MDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRAMAY 1380
            +H S    N     H+K+LIP I  GA+IGKGGE I + Q +T TK+K+SK N+F+PGTTERVC+I G   + I+  + +I  RI E  ++    QN      + ++Q KI+IPNS+AG++IGK G  I ++K+ +G F+Q+S K+ +    ER + + G+++   +    I+NKI+ED    S PN++Y D+  P +     NF  P G+P     N+  N    Y+   A  ++ D+ NG F    +  L +V P               +V+  T A  N+LS N +                + PS ++ N           L ++  A   ++ N  L  + +S +  N N   Y  G  +     +++  + +            +  A+D  Q + R ++V E+ +GAI+G  GRS+VE+Q+++   I +S K        T R VTI G    ++ A  L+  +I  E+ +RA A+
Sbjct:  183 THSSTAAGNSDGMYHMKILIPCITAGAIIGKGGETIAQLQTETNTKIKMSKTNDFYPGTTERVCIISGSSSEHIMAALTFIMERIREKPEAANRVQNSGDAIADREKQVKILIPNSTAGMIIGKAGAYIKQLKEDSGCFVQISQKAKDTTLQERCITVSGDTEGNKKVCSCILNKIIEDPLSASCPNLSYADVNGPVA-----NFN-PTGSPYALAPNNCSNNQTGYNMNPAPLSTQDVSNGIFS---NKFLDNVKPLLRSSGYPESAVNEIAVAFLTLAKHNVLSPNSIIGLINQTNQPPMQLQPAPPSVAHHNGTGLLSTVTNDLFDLGLAGGAISINAILSQNAASPTLSNANS--YGLGVAAAAAAPKAIGPSAAAAAAAAAAAALFEMTATDDQQSVKREMDVPESIVGAIIGPGGRSLVEIQQMSGVTIHIS-KKGVYAPGTTNRKVTICGSASGIAMANYLMQQRIVEEETKRARAF 654          
BLAST of RNA-binding protein Nova-1 vs. TrEMBL
Match: A0A5K4F0S9 (Rna-binding protein related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.816e-41
Identity = 102/218 (46.79%), Postives = 134/218 (61.47%), Query Frame = 1
Query:  136 NHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ--TMNQNR---EYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS--YTISDNFGVPIGTPSFNHSNSFENPSF 768
            N +DN+ LK+L+PSI  GAVIGK GE I + QKDT TKVKISK +EF+PGTTERVCLI G  D +I + +YI +RI E  D    T  + R   E  +Q KI++PNS+AG++IGK G  I EIK+ TGA++Q+S KS     LER +++ G  DQ   A   I+N I  D +  S PN++Y+DI  P +  Y     +  PI  P    S    NPS 
Sbjct:   33 NCEDNVQLKILVPSIAAGAVIGKSGEAIGRIQKDTNTKVKISKQDEFYPGTTERVCLIIGSFDGVITVHNYIMDRIMEKPDPNPNTTGEGRLNVERHKQVKILVPNSTAGMVIGKGGSYIQEIKEKTGAYVQISQKSREFNLLERCIVVAGELDQTRSAVHLILNVIATDPQSASCPNLSYHDIQGPVASVYPTGSPYATPI-IPYLTSSTILSNPSI 249          
BLAST of RNA-binding protein Nova-1 vs. TrEMBL
Match: A0A2H8TR17 (RNA-binding protein Nova-1 (Fragment) OS=Melanaphis sacchari OX=742174 GN=NOVA1_1 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 8.966e-41
Identity = 149/487 (30.60%), Postives = 243/487 (49.90%), Query Frame = 1
Query:  112 SHHSLFDSNHQDNI-HLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEK-DSIINMIDYIANRIAETNDSQTMNQN-----REYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNF---GVPIGTPSFNHSNSFENPSFPYSAKETSI---DMRNGKFDPTQSSRLSHVPP---------------SVSLNTKALKNILSQNEMSN-----------PSKSNMN-----------LMEIAHALQILAQNGCLCPSNSSNSKDNRNH---GYYSQGTNSQYPTSRSLTTT-----------FSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRAMAY 1380
            +H S   + + D + H+K+LIP I  GA+IGKGGE I + Q +T TK+K+SK N+F+PGTTERVC+I G   + I+  + +I  RI E  D+    QN      + ++Q KI+IPNS+AG++IGK G  I ++K+ +G F+Q+S K+ +    ER + + GN++   +    I+NKI+ED    S PN++Y D+  P +     NF   G P   P+ N SN+  +    Y+   TS+   D+ NG F    +  L +V P               +++  T A  N+LS N +             PS  + N           L ++  A   ++ N  L  + +S +  N N    G  +    +   T +++  T            + +  + +D  Q + R ++V E+ +GAI+G  GRS+VE+Q+++   I +S K        T R VTI G    ++ A  L+  +I  E+ +RA A+
Sbjct:  141 THSSSIVAGNSDGMYHMKILIPCITAGAIIGKGGETIAQLQTETNTKIKMSKTNDFYPGTTERVCIISGSSSEHIMAALTFIMERIREKPDASNRVQNSGDAIADREKQVKILIPNSTAGMIIGKAGAYIKQLKEDSGCFVQISQKAKDTTLQERCITVSGNTEGNKKVCLCILNKIIEDPLSASCPNLSYADVNGPVA-----NFNPTGSPYALPTTNCSNNQAS----YNLNATSLSTQDISNGIF---TNKFLDNVKPLLRSSGYPESAVNEIAIAFLTLAKHNVLSLNSIIGLINQTSILQPAPSVPHHNGTGLLSTVTNDLFDLGLAGGAISINAILSQNAASPTLSNANSYGLGVAAAAAAAAASTPKTIGPTTNAAAAAAAAAAAALYEMTADDQQSVKREMDVPESIVGAIIGPGGRSLVEIQQMSGVTIHIS-KKGVYAPGTTNRKVTICGSASGIAMANYLMQQRIVDEETKRARAF 614          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Cavefish
Match: nova2 (RNA-binding protein Nova-1-like [Source:NCBI gene;Acc:103039352])

HSP 1 Score: 130.183 bits (326), Expect = 3.393e-32
Identity = 81/206 (39.32%), Postives = 124/206 (60.19%), Query Frame = 1
Query:  109 ASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            AS     ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ ++ D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V I G  +Q  +A   I+ KI ED +  S  NI+Y++I  P +
Sbjct:   43 ASSTKRTNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNSVHDFIAEKVREMPQSAPKTEPVSILQPQTTVNPDR--IKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNISGPVA 246          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Cavefish
Match: nova1 (RNA-binding protein Nova-1-like [Source:NCBI gene;Acc:103044679])

HSP 1 Score: 128.257 bits (321), Expect = 1.586e-31
Identity = 80/221 (36.20%), Postives = 129/221 (58.37%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQ-----------NREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFEN 759
            ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  + ++IA ++ E   S   ++           N +  +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V + G  +Q  +A   I+ KI ED +  S  NI+Y+++  P +   + N   P G+P  N +    N
Sbjct:   42 NTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNGVHNFIAEKVREMPQSSQKSEPVSILQPQTTVNPDRVKQAKLIVPNSTAGLIIGKGGATVKSVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNVTGPVA---NSN---PTGSPYANSTEVLPN 256          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Cavefish
Match: igf2bp3 (insulin like growth factor 2 mRNA binding protein 3 [Source:NCBI gene;Acc:103029255])

HSP 1 Score: 62.3882 bits (150), Expect = 7.197e-10
Identity = 49/170 (28.82%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  127 FDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAET--NDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVED 630
             D+   + I LK+L  +   G +IGK G  + K ++DTGTK+ IS   +      ER   ++G  ++     + +  +I E+  ND   MNQ  E +    + IP  + G +IGK+G+ I ++ +  GA I+++P ++     +R V+I G  +  ++A  +I  K+ E+
Sbjct:  244 LDTKITEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTGTKITISPLQDLTLYNPERTITVKGSIEACARAEEELMKKIRESYENDVAAMNQQPESE-TVYLFIPALAVGAIIGKQGQHIKQLSRFAGASIKIAP-ADGMDAKQRMVIIAGPPEAQFKAQGRIFGKLKEE 411          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Cavefish
Match: igf2bp1 (insulin like growth factor 2 mRNA binding protein 1 [Source:NCBI gene;Acc:103023726])

HSP 1 Score: 57.7658 bits (138), Expect = 1.761e-8
Identity = 45/172 (26.16%), Postives = 82/172 (47.67%), Query Frame = 1
Query:  115 HHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVED 630
            H    D+   D + LK+L  +   G +IGK G  + K ++DT TK+ IS   +      ER   ++G  ++       I  ++ E  D+     N   Q    + IP  + G +IGK+G+ I ++ +  GA I+++P       + R V++ G  +  ++A  +I  K+ E+
Sbjct:  255 HQEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTDTKITISPLQDLTLYNPERTITVKGAIEACCLAEQEIMKKVREAYDNDIAAMNAPEQETVHVYIPAQAVGAIIGKKGQHIKQLSRFAGASIKIAPAETPDSKM-RMVIVTGPPEAQFKAQGRIYGKLKEE 425          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Cavefish
Match: ENSAMXT00000013998.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:7820490:7828559:-1 gene:ENSAMXG00000013588.2 transcript:ENSAMXT00000013998.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.566e-7
Identity = 46/177 (25.99%), Postives = 75/177 (42.37%), Query Frame = 1
Query:  223 KAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAE--TNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVS----PKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPT------SYTISDNFGVP 717
            K ++++  ++ IS+ N       ER+  I G  D+I      IA +  E   N         +     ++++P S  G LIGK G  I E+++STGA +QV+    P S      ER V I G  D   +  ++I   ++E     +          AP       +YTI   + +P
Sbjct:   32 KMREESSARINISEGN-----CPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSQATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRESTGAQVQVAGDMLPNST-----ERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPAAAPVIFSGAQTYTIQGQYAIP 198          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000772.1 (pep scaffold:Pmarinus_7.0:GL478091:7710:17898:-1 gene:ENSPMAG00000000699.1 transcript:ENSPMAT00000000772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 1.558e-34
Identity = 126/429 (29.37%), Postives = 194/429 (45.22%), Query Frame = 1
Query:  142 QDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQR----------------QTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQ---FLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPPSVSLNTKALKNILSQNEMSNPSKSNMNLMEIAHALQILAQNGCLCPSNSSNSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRA 1371
            + +  LK+L+P+   GA++GKGGE I++ Q DTGT +KISK  EFFPGT ERV L+QG +++I+   D+IA++I    D      + E  R                  KI++PNS+AGL+IGK G+T+  I   +GA+++VS K          ER V + G  +Q   A R I+ KIVE  +  S P ++Y     P  Y +    G   G P+   S      +  Y                   SR++ VP  V      L+      E+   +++   L    ++++ L                    G  + GT  +     + T  +  ++ +        T  LEV E+ IGA+LG  G+++++ QE T T I++S +  E       R VTI G       A  LI  ++  EQV RA
Sbjct:   43 EKSFFLKLLVPNCAVGAIMGKGGETIVQLQNDTGTVIKISKAREFFPGTMERVALVQGTEEAIVQAHDFIADKIYGCLDKTAPATSTETDRGNMPTHQTPTLSTAVQHVKIVVPNSTAGLIIGKGGDTVRYIIHESGAWLEVSQKMTGGWTGAGRERVVSVAGTREQNRIAVRLIVQKIVEHPESSSCPRLSYP--AQPEGYGLHSAGGPSAGVPASAPSAYAAMAASGY------------------ESRVTAVPQPV------LQEGFQGQELQAVTEALDRLSRCGYSMKTL--------------------GVAADGTEEEKQGEAAPTDGYG-VEEVG-------TLELEVHESLIGAVLGKGGQTLMDYQEATGTRIQIS-RVGEFVPGTNNRRVTILGTAAARKAAEFLIRKRVGAEQVNRA 416          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Sea Lamprey
Match: NOVA1 (NOVA alternative splicing regulator 1 [Source:HGNC Symbol;Acc:HGNC:7886])

HSP 1 Score: 93.9745 bits (232), Expect = 4.893e-21
Identity = 66/205 (32.20%), Postives = 106/205 (51.71%), Query Frame = 1
Query:  283 GTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQ-----------NREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPPSVS 864
            GTTERV LIQG  DS+  +  +IA++I E   +   ++           N +  +Q KI++PNS+AGL+IGK G T+  I +++G+++Q+S K       ER + + G ++Q  +A   I+ KI ED +  S  NI+Y ++  P + +       P G+P   ++NS E    P SA      M  G    T  + ++  P  VS
Sbjct:    1 GTTERVALIQGAPDSLNGVHCFIADKIREMPTASGKSEAISVLQPQTTVNPDRMKQAKILVPNSTAGLIIGKGGATVKAIMEASGSWVQLSQKPEGINLQERVITVSGEAEQNQKAIELILQKIQEDPQSSSCLNISYCNLSGPVANS------NPTGSP---YANSAE--MLPGSA------MAAGLLGQTNLATVAAFPTLVS 188          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010780.1 (pep scaffold:Pmarinus_7.0:GL480698:16435:18438:-1 gene:ENSPMAG00000009765.1 transcript:ENSPMAT00000010780.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 6.863e-17
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  415 QTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            Q KII+PN++AGLLIGK G T+  I + +GA++Q+S K       ER V + G  +Q   A + I+ KI ED +  S  N++Y  I  P +
Sbjct:    3 QAKIIVPNTTAGLLIGKGGATVKWIMEQSGAWVQLSQKPEGGGLQERVVTVSGEREQARRAVQLIVQKIQEDPQSGSCLNVSYAGITGPVA 93          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005114.1 (pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1 gene:ENSPMAG00000004551.1 transcript:ENSPMAT00000005114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.691e-8
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  223 KAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQ---TKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVS----PKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVE 627
            + ++++G ++ IS  N       ER+  + G  +SI      I +++ E   S T++      R     ++++P S  G LIGK G  I E+++STGA +QV+    P S      ER V I G  D   +  R+I   ++E
Sbjct:   40 RVREESGARINISDAN-----CPERIVTVTGPMESIFLAFALITHKLEEDMGS-TLSGGVMMSRPPVTLRLVVPASQCGSLIGKSGNKIQELRESTGAQVQVAGDLLPNST-----ERAVTISGTPDAIVQCVRQICVLMME 170          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005105.1 (pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 gene:ENSPMAG00000004637.1 transcript:ENSPMAT00000005105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 3.781e-8
Identity = 39/141 (27.66%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  223 KAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQT--KIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVS----PKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVE 627
            K ++++G ++ IS+ +       ER+  I G+ D+I      I N+  E  ++   N     +     ++++P S  G LIGK G  I EI++STGA +QV+    P S      ER V + G  +   +  ++I   ++E
Sbjct:   38 KMREESGARINISEGS-----CPERIVTITGQTDAIFKAFSMITNKFEEDINASMANSAVTSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNST-----ERAVTVSGAPEAIIQCVKQICVIMLE 168          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Nematostella
Match: EDO35692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT2])

HSP 1 Score: 114.775 bits (286), Expect = 7.094e-28
Identity = 68/176 (38.64%), Postives = 111/176 (63.07%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAE----TNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDI 672
            LK+L+P+   G++IGKGG+ I + Q+ TG ++K+S  N+++PGT ER+ LI GE ++I+ M+D++ ++I +       S +++ +RE  +Q KII+PNS+AG++IGK G  I  I + TGA IQ+S K       ER V + G+ +Q   A   I +K+ ED +     NI Y+ +
Sbjct:   48 LKILVPNYAAGSIIGKGGQNIAQVQQTTGARIKLSPNNQYYPGTQERIGLIMGEVENIVQMLDFVIDKIRQEPQGIKASMSISFDRERAKQMKIIVPNSTAGMIIGKAGSAIKSISEQTGARIQISQKDAESVAGERIVCVGGSQEQVTAACVIITSKVQEDPEHALNNNIMYSGL 223          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Nematostella
Match: EDO38203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDL7])

HSP 1 Score: 51.6026 bits (122), Expect = 6.618e-7
Identity = 29/75 (38.67%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  421 KIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQF--LERYVLIMGNSDQCYEATRKIINKIVEDTKL 639
            ++ IPN   GL+IG+ GE IN+++  TGA IQV+P          +R V I G + Q  E  ++++NKI E+ K+
Sbjct:  160 EVKIPNKYVGLVIGRGGEQINKLQSETGARIQVAPDPPAGMMSPPDRSVTI-GGTVQAVEKAKQVLNKICEEGKI 233          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Medaka
Match: ENSORLT00000033980.1 (RNA-binding protein Nova-1 [Source:NCBI gene;Acc:101161569])

HSP 1 Score: 131.724 bits (330), Expect = 1.569e-32
Identity = 80/199 (40.20%), Postives = 122/199 (61.31%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            +++ +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  + D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V I G  +Q  +A   II KI ED +  S  NI+Y++I  P +
Sbjct:   73 ETHEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNGVHDFIAEKVREMPQSTQKTEPVSILQPQTTVNPDR--VKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTISGEPEQNRKAVEIIIQKIQEDPQSSSCLNISYSNITGPVA 269          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Medaka
Match: ENSORLT00000027747.1 (RNA-binding protein Nova-1 [Source:NCBI gene;Acc:101161569])

HSP 1 Score: 129.798 bits (325), Expect = 4.673e-32
Identity = 87/219 (39.73%), Postives = 130/219 (59.36%), Query Frame = 1
Query:  139 HQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFE 756
             +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  + D+IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V I G  +Q  +A   II KI ED +  S  NI+Y++I  P +   + N   P G+P   ++NS E
Sbjct:   43 EEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNGVHDFIAEKVREMPQSTQKTEPVSILQPQTTVNPDR--VKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTISGEPEQNRKAVEIIIQKIQEDPQSSSCLNISYSNITGPVA---NSN---PTGSP---YANSTE 250          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Medaka
Match: nova1 (RNA-binding protein Nova-1 [Source:NCBI gene;Acc:101165333])

HSP 1 Score: 127.872 bits (320), Expect = 2.408e-31
Identity = 82/223 (36.77%), Postives = 130/223 (58.30%), Query Frame = 1
Query:  130 DSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFEN 759
            ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ ++ ++IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V I G  +Q  +A   I+ KI ED +  S  NI+Y+++  P + +       P G+P  N +    N
Sbjct:   58 NTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNSVHNFIAEKVREMPQSAQKPEPVSILQPQTTVNPDR--VKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNVSGPVANS------NPTGSPYANTAEVLPN 272          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Medaka
Match: nova1 (RNA-binding protein Nova-1 [Source:NCBI gene;Acc:101165333])

HSP 1 Score: 127.487 bits (319), Expect = 4.541e-31
Identity = 82/214 (38.32%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  157 LKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFEN 759
            LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++ ++ ++IA ++ E   S              T+N +R   +Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V I G  +Q  +A   I+ KI ED +  S  NI+Y+++  P + +       P G+P  N +    N
Sbjct:   83 LKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNSVHNFIAEKVREMPQSAQKPEPVSILQPQTTVNPDR--VKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSNVSGPVANS------NPTGSPYANTAEVLPN 288          
BLAST of RNA-binding protein Nova-1 vs. Ensembl Medaka
Match: ENSORLT00000038211.1 (RNA-binding protein Nova-1 [Source:NCBI gene;Acc:101161569])

HSP 1 Score: 125.176 bits (313), Expect = 2.225e-30
Identity = 83/223 (37.22%), Postives = 123/223 (55.16%), Query Frame = 1
Query:  109 ASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQ-------------TMNQNREYQR-----------------QTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTS 687
            AS     ++  +    LKVLIPS   G++IGKGG+ I++ QK+TG  +K+SK  +F+PGTTERVCLIQG  +++  + D+IA ++ E   S              T+N +R  Q                  Q K+I+PNS+AGL+IGK G T+  + + +GA++Q+S K       ER V I G  +Q  +A   II KI ED +  S  NI+Y++I  P +
Sbjct:   43 ASSTKRTNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNGVHDFIAEKVREMPQSTQKTEPVSILQPQTTVNPDRVKQTSPATSSLTCFFFCRPSLQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTISGEPEQNRKAVEIIIQKIQEDPQSSSCLNISYSNITGPVA 265          
BLAST of RNA-binding protein Nova-1 vs. Planmine SMEST
Match: SMESG000066554.1 (SMESG000066554.1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 433/433 (100.00%), Postives = 433/433 (100.00%), Query Frame = 1
Query:  106 MASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPPSVSLNTKALKNILSQNEMSNPSKSNMNLMEIAHALQILAQNGCLCPSNSSNSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG 1404
            MASHHSLFDSNHQDNIHLKVLIPSICGGAVIGKGGEGIIKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPPSVSLNTKALKNILSQNEMSNPSKSNMNLMEIAHALQILAQNGCLCPSNSSNSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSKKPTETPEKNTKRTVTITGLYENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG
Sbjct:    1 MASHHSLFDSNHQDNIHLKVLIPSICGGAVIGKGGEGIIKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPPSVSLNTKALKNILSQNEMSNPSKSNMNLMEIAHALQILAQNGCLCPSNSSNSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSKKPTETPEKNTKRTVTITGLYENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG 433          
BLAST of RNA-binding protein Nova-1 vs. Planmine SMEST
Match: SMESG000066554.1 (SMESG000066554.1)

HSP 1 Score: 433.721 bits (1114), Expect = 1.067e-149
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 1
Query:  106 MASHHSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYS 777
            MASHHSLFDSNHQDNIHLKVLIPSICGGAVIGKGGEGIIKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYS
Sbjct:    1 MASHHSLFDSNHQDNIHLKVLIPSICGGAVIGKGGEGIIKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNREYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPSFPYS 224          

HSP 2 Score: 231.876 bits (590), Expect = 3.948e-71
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 1
Query: 1015 DNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSXXXXXXXXXXXXXXVTITGLYENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG 1404
            DNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSKKPTETPEKNTKRTVTITGLYENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG
Sbjct:  225 DNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVDETYIGAILGAKGRSIVELQEVTDTNIKVSKKPTETPEKNTKRTVTITGLYENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG 354          
BLAST of RNA-binding protein Nova-1 vs. Planmine SMEST
Match: SMESG000019747.1 (SMESG000019747.1)

HSP 1 Score: 164.081 bits (414), Expect = 2.252e-43
Identity = 105/244 (43.03%), Postives = 147/244 (60.25%), Query Frame = 1
Query:  145 DNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQ--NR---EYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTPSFNHSNSFENPS--FPYSAKETSIDMRNGKFDPTQSSRLSHVPP 855
            +N+H K+L+PSI  GA+IGKGGE I + QK+TG KVK+SK N+F+PGTTERVCLI G  ++I  M +YI ++I E  D+ + NQ  NR   +  +Q KI++PNS+AG++IGK G  I EIK S+GAFIQ+S KS      ER ++I G  +Q  +AT  I+ KI ED +  S PNI+Y D   P +         P G+P  N S     P+     S   + I ++     PT  +  +H+ P
Sbjct:   37 ENVHFKILVPSIAAGAIIGKGGEAIGQIQKETGAKVKMSKANDFYPGTTERVCLILGTVEAITKMHNYIIDKIFEKADTSSKNQSDNRMLADRHKQVKILVPNSTAGMIIGKGGAFIKEIKDSSGAFIQISQKSREVNLPERCIVIAGEPEQNRKATTAILAKIAEDPQSASCPNISYADAQGPVASA------YPTGSPYANSSPPHSVPTHQMGSSVLYSPIGVQLAGLPPTVGALQTHMSP 274          
BLAST of RNA-binding protein Nova-1 vs. Planmine SMEST
Match: SMESG000063949.1 (SMESG000063949.1)

HSP 1 Score: 147.902 bits (372), Expect = 2.742e-38
Identity = 87/210 (41.43%), Postives = 128/210 (60.95%), Query Frame = 1
Query:  118 HSLFDSNHQDNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNR------EYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTP 729
            ++ + S   +N++ K+L+PS+  GA+IGK GE I + Q +T TKVKISK N+F+PGT ERVCLI G  D II M  YI  +I +  D   +  N       E QRQ KI++PNS+AGL+IGK G  I +IK++TGAF+Q+S K+     LER +++ G  +    A + I+ K+ +D +   +PNI+Y D+  P +         P G+P
Sbjct:   14 NNFYFSPRVNNVYFKILVPSVSAGAIIGKRGESINQMQNETCTKVKISKSNDFYPGTKERVCLITGAVDGIIAMHTYIMKKINDKLDRNMLQHNHGLKDLNERQRQVKILVPNSTAGLIIGKSGTFIKDIKETTGAFVQISQKAKQINLLERCIIVAGEFEHVKSALKIILIKLSQDPQSKMYPNISYVDVCGPVASAF------PTGSP 217          
BLAST of RNA-binding protein Nova-1 vs. Planmine SMEST
Match: SMESG000063949.1 (SMESG000063949.1)

HSP 1 Score: 147.902 bits (372), Expect = 9.599e-38
Identity = 86/201 (42.79%), Postives = 124/201 (61.69%), Query Frame = 1
Query:  145 DNIHLKVLIPSXXXXXXXXXXXXXXXKAQKDTGTKVKISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNR------EYQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLERYVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDNFGVPIGTP 729
            +N++ K+L+PS+  GA+IGK GE I + Q +T TKVKISK N+F+PGT ERVCLI G  D II M  YI  +I +  D   +  N       E QRQ KI++PNS+AGL+IGK G  I +IK++TGAF+Q+S K+     LER +++ G  +    A + I+ K+ +D +   +PNI+Y D+  P +         P G+P
Sbjct:   23 NNVYFKILVPSVSAGAIIGKRGESINQMQNETCTKVKISKSNDFYPGTKERVCLITGAVDGIIAMHTYIMKKINDKLDRNMLQHNHGLKDLNERQRQVKILVPNSTAGLIIGKSGTFIKDIKETTGAFVQISQKAKQINLLERCIIVAGEFEHVKSALKIILIKLSQDPQSKMYPNISYVDVCGPVASAF------PTGSP 217          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein Nova-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOVA22.135e-3236.45NOVA alternative splicing regulator 2 [Source:HGNC... [more]
NOVA12.627e-3041.05NOVA alternative splicing regulator 1 [Source:HGNC... [more]
NOVA18.387e-2936.36NOVA alternative splicing regulator 1 [Source:HGNC... [more]
NOVA11.409e-2737.26NOVA alternative splicing regulator 1 [Source:HGNC... [more]
NOVA11.638e-2137.21NOVA alternative splicing regulator 1 [Source:HGNC... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nova-11.265e-1935.09NOVA kh (KH) homology domain homolog [Source:UniP... [more]
nova-11.265e-1935.09NOVA kh (KH) homology domain homolog [Source:UniP... [more]
nova-11.265e-1935.09NOVA kh (KH) homology domain homolog [Source:UniP... [more]
fubl-21.671e-841.43FUBp (FUBP) Like [Source:UniProtKB/TrEMBL;Acc:Q23... [more]
fubl-21.872e-837.50FUBp (FUBP) Like [Source:UniProtKB/TrEMBL;Acc:Q23... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ps4.889e-3639.32gene:FBgn0261552 transcript:FBtr0082037[more]
ps8.666e-3639.32gene:FBgn0261552 transcript:FBtr0334303[more]
ps9.783e-3638.50gene:FBgn0261552 transcript:FBtr0111032[more]
ps9.783e-3638.50gene:FBgn0261552 transcript:FBtr0302695[more]
ps9.783e-3638.50gene:FBgn0261552 transcript:FBtr0302694[more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nova24.589e-3339.81NOVA alternative splicing regulator 2 [Source:ZFIN... [more]
nova25.341e-3339.81NOVA alternative splicing regulator 2 [Source:ZFIN... [more]
nova26.753e-3340.28NOVA alternative splicing regulator 2 [Source:ZFIN... [more]
nova26.825e-3340.28NOVA alternative splicing regulator 2 [Source:ZFIN... [more]
nova11.827e-3136.52NOVA alternative splicing regulator 1 [Source:ZFIN... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nova28.797e-3238.07neuro-oncological ventral antigen 2 [Source:NCBI g... [more]
nova21.269e-3138.07neuro-oncological ventral antigen 2 [Source:NCBI g... [more]
hapln23.328e-3038.69hyaluronan and proteoglycan link protein 2 [Source... [more]
hapln23.625e-3038.69hyaluronan and proteoglycan link protein 2 [Source... [more]
hapln21.703e-2735.29hyaluronan and proteoglycan link protein 2 [Source... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nova21.494e-3236.45NOVA alternative splicing regulator 2 [Source:MGI ... [more]
Nova21.876e-3236.45NOVA alternative splicing regulator 2 [Source:MGI ... [more]
Nova18.174e-2837.74NOVA alternative splicing regulator 1 [Source:MGI ... [more]
Nova11.665e-939.73NOVA alternative splicing regulator 1 [Source:MGI ... [more]
Pcbp31.951e-827.00poly(rC) binding protein 3 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UNW9|NOVA2_HUMAN1.025e-3136.45RNA-binding protein Nova-2 OS=Homo sapiens OX=9606... [more]
sp|Q2PFW9|NOVA1_MACFA9.391e-3041.58RNA-binding protein Nova-1 OS=Macaca fascicularis ... [more]
sp|Q80WA4|NOVA1_RAT1.207e-2941.58RNA-binding protein Nova-1 (Fragment) OS=Rattus no... [more]
sp|Q9JKN6|NOVA1_MOUSE5.718e-2737.74RNA-binding protein Nova-1 OS=Mus musculus OX=1009... [more]
sp|P51513|NOVA1_HUMAN6.764e-2737.26RNA-binding protein Nova-1 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B7PQM31.444e-4231.18RNA-binding protein Nova-1, putative (Fragment) OS... [more]
J9KN761.041e-4130.60Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A5E4NLF63.638e-4130.17K Homology domain,K Homology domain, type 1 OS=Cin... [more]
A0A5K4F0S96.816e-4146.79Rna-binding protein related OS=Schistosoma mansoni... [more]
A0A2H8TR178.966e-4130.60RNA-binding protein Nova-1 (Fragment) OS=Melanaphi... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nova23.393e-3239.32RNA-binding protein Nova-1-like [Source:NCBI gene;... [more]
nova11.586e-3136.20RNA-binding protein Nova-1-like [Source:NCBI gene;... [more]
igf2bp37.197e-1028.82insulin like growth factor 2 mRNA binding protein ... [more]
igf2bp11.761e-826.16insulin like growth factor 2 mRNA binding protein ... [more]
ENSAMXT00000013998.25.566e-725.99pep primary_assembly:Astyanax_mexicanus-2.0:13:782... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000772.11.558e-3429.37pep scaffold:Pmarinus_7.0:GL478091:7710:17898:-1 g... [more]
NOVA14.893e-2132.20NOVA alternative splicing regulator 1 [Source:HGNC... [more]
ENSPMAT00000010780.16.863e-1740.66pep scaffold:Pmarinus_7.0:GL480698:16435:18438:-1 ... [more]
ENSPMAT00000005114.11.691e-828.87pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1... [more]
ENSPMAT00000005105.13.781e-827.66pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 g... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO356927.094e-2838.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382036.618e-738.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033980.11.569e-3240.20RNA-binding protein Nova-1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000027747.14.673e-3239.73RNA-binding protein Nova-1 [Source:NCBI gene;Acc:1... [more]
nova12.408e-3136.77RNA-binding protein Nova-1 [Source:NCBI gene;Acc:1... [more]
nova14.541e-3138.32RNA-binding protein Nova-1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000038211.12.225e-3037.22RNA-binding protein Nova-1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of RNA-binding protein Nova-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066554.10.000e+0100.00SMESG000066554.1[more]
SMESG000066554.11.067e-149100.00SMESG000066554.1[more]
SMESG000019747.12.252e-4343.03SMESG000019747.1[more]
SMESG000063949.12.742e-3841.43SMESG000063949.1[more]
SMESG000063949.19.599e-3842.79SMESG000063949.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000921 ID=SMED30000921|Name=RNA-binding protein Nova-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1621bp
TTTAATAAAGAGATTATATTTACATAATTCGATTACACGAAATTCATCTA
CATTTTCTTTTACATTCACCTACCAAACATCCATCCTTCAACCACAACTT
ACCTTATGGCCTCACACCATTCATTATTCGATTCAAATCATCAAGATAAC
ATTCATCTTAAAGTTCTCATACCTTCTATATGCGGCGGAGCAGTTATTGG
AAAAGGAGGAGAAGGAATAATTAAAGCACAAAAAGATACTGGAACTAAAG
TGAAAATATCCAAACCAAATGAGTTTTTCCCAGGCACTACAGAACGAGTT
TGTTTGATTCAAGGTGAAAAAGATAGCATTATAAATATGATAGATTACAT
TGCCAATCGAATTGCTGAAACAAATGACTCACAAACTATGAATCAGAATC
GAGAATATCAACGCCAAACAAAGATCATTATACCGAATAGCAGTGCCGGA
TTACTTATTGGGAAAGAAGGAGAGACAATCAATGAAATCAAGAAATCAAC
TGGTGCTTTTATCCAGGTTTCTCCAAAATCAAATAATAGACAATTTCTTG
AACGTTATGTTTTGATAATGGGGAATTCTGATCAATGCTATGAAGCGACT
AGGAAAATTATCAATAAAATTGTAGAAGATACAAAACTGTGTAGTTTTCC
AAATATTAATTACAATGACATAATGGCTCCGACTTCATACACAATTTCAG
ATAACTTCGGTGTTCCTATTGGAACACCTTCATTCAATCATTCTAATTCA
TTTGAAAATCCAAGTTTTCCATATTCAGCGAAAGAAACATCTATAGATAT
GAGAAATGGAAAATTTGATCCAACTCAATCATCAAGATTGTCTCATGTTC
CTCCCTCAGTTTCGTTAAATACCAAAGCTCTAAAAAATATTTTGTCTCAA
AACGAAATGTCTAACCCATCAAAGTCTAACATGAATCTGATGGAAATCGC
TCATGCTTTACAGATTCTAGCACAGAATGGATGCTTATGTCCATCTAATA
GTAGCAATTCTAAAGATAATCGCAATCATGGATATTATTCACAAGGAACC
AATTCACAATATCCGACTTCCAGATCATTAACAACCACATTTTCACAAAT
GGACTACATTGCAAGCGATTCGACTCAGGGAATAACAAGAACACTTGAAG
TTGATGAGACATATATTGGTGCGATCCTTGGTGCCAAAGGAAGATCGATT
GTAGAACTACAAGAAGTTACGGATACAAACATTAAAGTTTCTAAGAAACC
TACTGAAACTCCTGAAAAGAATACGAAGAGAACAGTCACGATAACGGGTT
TGTATGAAAATGTTTCACGGGCCTACTTATTAATAAATGATAAAATCCAA
TTGGAACAAGTTAGGCGGGCAATGGCATACCAGGAAACCGATTTAAGTGA
AGGCTAGAAATTGAAGATTTTAAATTGCGTTTTAATTTTGACTCGTTGTG
ATATTCTATGTTTGGCAGTGAAAGAGGCATGTAGTTTTTATTGATGAATG
GTAATAAAATGGTTTATTTTTTTCTTTATTTTTATGAATTCAAGTTGGAT
TTGGTCATTTTAGATAACAGATATATATATTATGTGCTTACAAATAAAAT
TTCCATTTCTATGAAAAAAAA
back to top

protein sequence of SMED30000921-orf-1

>SMED30000921-orf-1 ID=SMED30000921-orf-1|Name=SMED30000921-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=434bp
MASHHSLFDSNHQDNIHLKVLIPSICGGAVIGKGGEGIIKAQKDTGTKVK
ISKPNEFFPGTTERVCLIQGEKDSIINMIDYIANRIAETNDSQTMNQNRE
YQRQTKIIIPNSSAGLLIGKEGETINEIKKSTGAFIQVSPKSNNRQFLER
YVLIMGNSDQCYEATRKIINKIVEDTKLCSFPNINYNDIMAPTSYTISDN
FGVPIGTPSFNHSNSFENPSFPYSAKETSIDMRNGKFDPTQSSRLSHVPP
SVSLNTKALKNILSQNEMSNPSKSNMNLMEIAHALQILAQNGCLCPSNSS
NSKDNRNHGYYSQGTNSQYPTSRSLTTTFSQMDYIASDSTQGITRTLEVD
ETYIGAILGAKGRSIVELQEVTDTNIKVSKKPTETPEKNTKRTVTITGLY
ENVSRAYLLINDKIQLEQVRRAMAYQETDLSEG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 14..87
e-value: 1.1E-8
score: 44.9
coord: 101..173
e-value: 2.8E-12
score: 56.8
coord: 341..415
e-value: 1.1E-10
score: 51.5
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 100..177
e-value: 1.4E-19
score: 71.7
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 12..91
e-value: 1.1E-19
score: 72.0
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 333..421
e-value: 1.1E-14
score: 55.7
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 332..415
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 95..175
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 15..91
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 105..169
e-value: 1.3E-12
score: 47.4
coord: 19..82
e-value: 8.1E-9
score: 35.2
coord: 344..411
e-value: 1.3E-11
score: 44.2
NoneNo IPR availablePANTHERPTHR10288KH DOMAIN CONTAINING RNA BINDING PROTEINcoord: 13..417
NoneNo IPR availablePANTHERPTHR10288:SF261PASILLA, ISOFORM Rcoord: 13..417
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 15..82
score: 14.026
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 342..410
score: 14.152
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 102..168
score: 15.871
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 17..83
e-value: 2.67454E-13
score: 62.4939
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 106..169
e-value: 3.48313E-13
score: 62.1087
NoneNo IPR availableCDDcd00105KH-Icoord: 344..410
e-value: 5.01533E-10
score: 53.3327