Coiled-coil domain containing 13

Overview
NameCoiled-coil domain containing 13
Smed IDSMED30000918
Length (bp)1924
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 13 (SMED30000918) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 13 (SMED30000918) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 13 (SMED30000918) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 13 (SMED30000918) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000918

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000918h1SMcG0013517 SmedASXL_009612SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000918h1SMcG0013517 dd_Smed_v4_12055_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000918h1SMcG0013517 dd_Smed_v4_12055_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000918h1SMcG0013517 dd_Smed_v6_12055_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30000918h1SMcG0013517 Contig37308uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000918h1SMcG0013517 Contig37308newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30000918h1SMcG0013517 dd_Smed_v4_12055_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 13 vs. Ensembl Human
Match: CCDC13 (coiled-coil domain containing 13 [Source:HGNC Symbol;Acc:HGNC:26358])

HSP 1 Score: 137.502 bits (345), Expect = 3.375e-33
Identity = 107/342 (31.29%), Postives = 184/342 (53.80%), Query Frame = 3
Query:   96 SFDKETVNTNEDIIRN----IKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRT-------SDNNSKQNFLKFQSNEM--TDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            SF+K  +    + +RN      DENGRL KLL+E+DFEI  LKK + +        + ++    + KI+ELSKKNR + +E E  KT+  Q     + LE E+    T       +D  +K    +     +  T E+K ++D+L  +  K+ +L    Q++ ++ ++A K L  E+G+ ++++ +LL++P  WRGRAQ+I+ L  K+ +L KQ+ +++    G  S   D LS        Y + R       S+  +    +  L+RE+Q    K   E   L  E  +LK+  +G++SRN+ L++++K+ K Q+  +++K ++DDELI +L+   DQLK
Sbjct:   70 SFEKRVLEDEIEHLRNELRETVDENGRLYKLLKERDFEIKHLKKKIEEDRFAFTGTAGVAGDVVATKIVELSKKNRLLMAESEGAKTRVKQLTNRIQELERELQTALTRLSAKGATDAGAKPPRAQMGDRALLETPEVKALQDRLVATNLKMSDLRNQIQSVKQELRMAQKVLAREVGE-DINVQQLLSSPGTWRGRAQQILVLQSKVQELEKQLGQARSQSAGTAS---DELS-------VYPDPR-----KLSAQEKNLLRIRSLEREKQEGLEKLASERDVLQRELEELKKKFEGMRSRNKLLSSEMKTLKSQMGTLVEKGRHDDELIDALM---DQLK 392          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Human
Match: AC006059.2 (novel protein)

HSP 1 Score: 137.117 bits (344), Expect = 4.995e-33
Identity = 107/342 (31.29%), Postives = 184/342 (53.80%), Query Frame = 3
Query:   96 SFDKETVNTNEDIIRN----IKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRT-------SDNNSKQNFLKFQSNEM--TDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            SF+K  +    + +RN      DENGRL KLL+E+DFEI  LKK + +        + ++    + KI+ELSKKNR + +E E  KT+  Q     + LE E+    T       +D  +K    +     +  T E+K ++D+L  +  K+ +L    Q++ ++ ++A K L  E+G+ ++++ +LL++P  WRGRAQ+I+ L  K+ +L KQ+ +++    G  S   D LS        Y + R       S+  +    +  L+RE+Q    K   E   L  E  +LK+  +G++SRN+ L++++K+ K Q+  +++K ++DDELI +L+   DQLK
Sbjct:   93 SFEKRVLEDEIEHLRNELRETVDENGRLYKLLKERDFEIKHLKKKIEEDRFAFTGTAGVAGDVVATKIVELSKKNRLLMAESEGAKTRVKQLTNRIQELERELQTALTRLSAKGATDAGAKPPRAQMGDRALLETPEVKALQDRLVATNLKMSDLRNQIQSVKQELRMAQKVLAREVGE-DINVQQLLSSPGTWRGRAQQILVLQSKVQELEKQLGQARSQSAGTAS---DELS-------VYPDPR-----KLSAQEKNLLRIRSLEREKQEGLEKLASERDVLQRELEELKKKFEGMRSRNKLLSSEMKTLKSQMGTLVEKGRHDDELIDALM---DQLK 415          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Fly
Match: CG13032 (gene:FBgn0036652 transcript:FBtr0075316)

HSP 1 Score: 75.0998 bits (183), Expect = 8.486e-14
Identity = 65/184 (35.33%), Postives = 102/184 (55.43%), Query Frame = 3
Query:  165 LMKLLQEKDFEINKLKKDLNKPN-IGN---IDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDP-NMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQI 701
            L + + EK+ EI+ LKK ++  N + N   ID+   +   AS KI+ELSKKNR++ SELE  K++  ++  + + LE E   LR  +   + N    +     DEL+    K+   + K+ E    N  L    K+A K L+ EIG+  N++I       +NWRGRAQ+II+LNQK+ +L  ++
Sbjct:   72 LAQAIHEKNQEISDLKKSVDSLNEVLNSVPIDELRCNSSIASTKILELSKKNRQMRSELEQAKSRLGKKDAQIEKLEKE---LRAHEEKLQHNQDLPKKGCSPDELQA---KINSMQQKLFETRNRNTELQSQLKLAQKCLQHEIGESCNINILANNLNQANWRGRAQQIIALNQKVHELKARL 249          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Zebrafish
Match: ccdc13 (coiled-coil domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-061207-11])

HSP 1 Score: 150.984 bits (380), Expect = 4.153e-38
Identity = 117/353 (33.14%), Postives = 192/353 (54.39%), Query Frame = 3
Query:   54 LNFENSDDLNLKTFSFDKETVNTNE---DIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDE-------LKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            ++F   DD  +  F+  +   N NE   D +R ++DENGRL KLL EKDFEI  LKK   +  +     + L+  AA+ KI+ELSKK R++ SE+E  KTK  Q     + LE E + L     N  +   K Q++++ D+       +K +++KL +++ K+ E     Q   ++ KIA K L  E+G+ ++ I ++L  P  WRGR+Q+I++L  ++  L +Q+  SQ +    L+ FG       + G   ++ R  S   H            +++E++    K   E   L EEHT +K+  +G K+RN+ L+ +IK+ K QI  +LDK K+DDEL+ +L+++Q Q +
Sbjct:   56 IHFTEEDDKVMDLFNA-RMIQNENEQLLDHVRELRDENGRLHKLLSEKDFEIKHLKKKREEDRLALAGTAGLAGDAAATKIVELSKKTRDLASEVEREKTKTKQANNRVRELEKEAMLLL----NPGKTTNKKQASKIVDDHPENNPVVKSLQEKLSVAQLKMAEYRNQIQTFKQELKIAHKVLSCEVGE-DVSIQQILCNPGGWRGRSQQILALQNRVRDLEQQL--SQSSHRKPLNEFGLEDEMMRTGGPMKTQDRNLSHIRH------------IEKEKKETLEKLTVEYEVLLEEHTDVKKKLEGSKARNKVLSTEIKALKSQIGTLLDKGKHDDELVDALLKQQTQWQ 388          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Zebrafish
Match: ccdc13 (coiled-coil domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-061207-11])

HSP 1 Score: 73.1738 bits (178), Expect = 1.336e-14
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  129 DIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEI 392
            D +R ++DENGRL KLL EKDFEI  LKK   +  +     + L+  AA+ KI+ELSKK R++ SE+E  KTK  Q     + LE E+
Sbjct:   11 DHVRELRDENGRLHKLLSEKDFEIKHLKKKREEDRLALAGTAGLAGDAAATKIVELSKKTRDLASEVEREKTKTKQANNRVRELEKEL 98          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Xenopus
Match: moxd1 (monooxygenase, DBH-like 1 [Source:Xenbase;Acc:XB-GENE-988179])

HSP 1 Score: 142.895 bits (359), Expect = 4.518e-35
Identity = 103/324 (31.79%), Postives = 176/324 (54.32%), Query Frame = 3
Query:  126 EDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQL------RTSDNNSKQNFLKFQSNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGR---LQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQ 1070
            +D IR +KDENGRL KL+QEK+FEI  L+K L +  +     + L+   A+ KI+ELSKKNRE+T+ELES +TK  Q     K +E E+  L      + S N   +  +   +   + ELK +++KL  +  K++E     Q++ ++ K+A K L  E+G+  ++I++L  +  +WRGRAQ+I++L  ++ +L  Q+ +                 G + +     E  +  +T     + Q   L R   L++ER+    K   E     +++  LK+  +  K+RN  L+N++K  K Q+  +L+K K+D+ELI +L+ +Q
Sbjct:   85 QDQIRELKDENGRLHKLVQEKEFEIRHLRKKLEEGKLALAGTAGLAGDVAATKIVELSKKNRELTAELESERTKVKQLNNRVKGVEKELQNLAVNYTGKESGNGHSRTQIADGTPAESPELKALQEKLAATNLKMIEYRNQIQSMKQELKVAHKVLVSEVGE-EVNISQLAASSGSWRGRAQQILALQGRVRELENQLGQ-----------------GRSPVSELSLEEELSGVTVPKRVAAQEKNLFRIRTLEKERKEALEKITAEYEAFKKDNEDLKKKLEASKARNTVLSNEVKMLKMQMATILEKGKHDNELIDALLSQQ 390          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Xenopus
Match: moxd1 (monooxygenase, DBH-like 1 [Source:Xenbase;Acc:XB-GENE-988179])

HSP 1 Score: 65.4698 bits (158), Expect = 1.293e-10
Identity = 53/191 (27.75%), Postives = 100/191 (52.36%), Query Frame = 3
Query:  507 KVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGR---LQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQ 1070
            K++E     Q++ ++ K+A K L  E+G+  ++I++L  +  +WRGRAQ+I++L  ++ +L        EN+ G          G + +     E  +  +T     + Q   L R   L++ER+    K   E     +++  LK+  +  K+RN  L+N++K  K Q+  +L+K K+D+ELI +L+ +Q
Sbjct:    2 KMIEYRNQIQSMKQELKVAHKVLVSEVGE-EVNISQLAASSGSWRGRAQQILALQGRVREL--------ENQLG---------QGRSPVSELSLEEELSGVTVPKRVAAQEKNLFRIRTLEKERKEALEKITAEYEAFKKDNEDLKKKLEASKARNTVLSNEVKMLKMQMATILEKGKHDNELIDALLSQQ 174          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Mouse
Match: Ccdc13 (coiled-coil domain containing 13 [Source:MGI Symbol;Acc:MGI:1920144])

HSP 1 Score: 139.428 bits (350), Expect = 5.135e-34
Identity = 115/370 (31.08%), Postives = 203/370 (54.86%), Query Frame = 3
Query:   33 YILFMNLLNFENSDDLNLKTFSFDKETVNTNEDIIRNIK-------DENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSK------QNFLKFQSNEM----TDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSER---RVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            +++  + L+  ++++ NLK   F+K  +   ED I++++       DENGRL KLL+E+DFEI  LKK + +        S ++    + KI+ELSKKNR + +E ES K +  Q     + LE++ LQ+ ++   SK         LK Q+ +     T E+K ++D+L  +  K+ +L    Q+  ++ ++A K L +E+G+ +++I +LL +P  WRGRAQ+I+ L  ++  L KQ+ + Q    G  SS  +V   + S  M   E+   R+ S                L+R++Q    K   E  TL  E  +L++  +G++SRN+ L++++K+ + Q+  +++K ++DDELI +L+   DQLK
Sbjct:   50 FMVIPDGLSLLDTEEQNLKNI-FEKRVL---EDEIQHLRSELRETVDENGRLYKLLKERDFEIKHLKKKIEEDRFAFTGASGMAGDLVATKIVELSKKNRGLMAESESAKVRIKQLTNRIQELEHQ-LQMASAKPPSKGATDAGAKPLKTQTGDRALLETPEVKALQDRLAATNLKMSDLRNQIQSAKQELRVAQKVLANEVGE-DVNIQQLLASPGTWRGRAQQILVLQSRVRDLEKQLGQRQNKPAGSSSS--EVPLSSDSRKMTAQEKNLLRIRS----------------LERDKQESWEKLASERDTLQTELEELRKKFEGMRSRNKVLSSEVKTLRSQMTTLVEKGRHDDELIDALM---DQLK 392          
BLAST of Coiled-coil domain containing 13 vs. UniProt/SwissProt
Match: sp|D3YV10|CCD13_MOUSE (Coiled-coil domain-containing protein 13 OS=Mus musculus OX=10090 GN=Ccdc13 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.592e-33
Identity = 115/370 (31.08%), Postives = 203/370 (54.86%), Query Frame = 3
Query:   33 YILFMNLLNFENSDDLNLKTFSFDKETVNTNEDIIRNIK-------DENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSK------QNFLKFQSNEM----TDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSER---RVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            +++  + L+  ++++ NLK   F+K  +   ED I++++       DENGRL KLL+E+DFEI  LKK + +        S ++    + KI+ELSKKNR + +E ES K +  Q     + LE++ LQ+ ++   SK         LK Q+ +     T E+K ++D+L  +  K+ +L    Q+  ++ ++A K L +E+G+ +++I +LL +P  WRGRAQ+I+ L  ++  L KQ+ + Q    G  SS  +V   + S  M   E+   R+ S                L+R++Q    K   E  TL  E  +L++  +G++SRN+ L++++K+ + Q+  +++K ++DDELI +L+   DQLK
Sbjct:   50 FMVIPDGLSLLDTEEQNLKNI-FEKRVL---EDEIQHLRSELRETVDENGRLYKLLKERDFEIKHLKKKIEEDRFAFTGASGMAGDLVATKIVELSKKNRGLMAESESAKVRIKQLTNRIQELEHQ-LQMASAKPPSKGATDAGAKPLKTQTGDRALLETPEVKALQDRLAATNLKMSDLRNQIQSAKQELRVAQKVLANEVGE-DVNIQQLLASPGTWRGRAQQILVLQSRVRDLEKQLGQRQNKPAGSSSS--EVPLSSDSRKMTAQEKNLLRIRS----------------LERDKQESWEKLASERDTLQTELEELRKKFEGMRSRNKVLSSEVKTLRSQMTTLVEKGRHDDELIDALM---DQLK 392          
BLAST of Coiled-coil domain containing 13 vs. UniProt/SwissProt
Match: sp|Q8IYE1|CCD13_HUMAN (Coiled-coil domain-containing protein 13 OS=Homo sapiens OX=9606 GN=CCDC13 PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 1.621e-32
Identity = 107/342 (31.29%), Postives = 184/342 (53.80%), Query Frame = 3
Query:   96 SFDKETVNTNEDIIRN----IKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRT-------SDNNSKQNFLKFQSNEM--TDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            SF+K  +    + +RN      DENGRL KLL+E+DFEI  LKK + +        + ++    + KI+ELSKKNR + +E E  KT+  Q     + LE E+    T       +D  +K    +     +  T E+K ++D+L  +  K+ +L    Q++ ++ ++A K L  E+G+ ++++ +LL++P  WRGRAQ+I+ L  K+ +L KQ+ +++    G  S   D LS        Y + R       S+  +    +  L+RE+Q    K   E   L  E  +LK+  +G++SRN+ L++++K+ K Q+  +++K ++DDELI +L+   DQLK
Sbjct:   70 SFEKRVLEDEIEHLRNELRETVDENGRLYKLLKERDFEIKHLKKKIEEDRFAFTGTAGVAGDVVATKIVELSKKNRLLMAESEGAKTRVKQLTNRIQELERELQTALTRLSAKGATDAGAKPPRAQMGDRALLETPEVKALQDRLVATNLKMSDLRNQIQSVKQELRMAQKVLAREVGE-DINVQQLLSSPGTWRGRAQQILVLQSKVQELEKQLGQARSQSAGTAS---DELS-------VYPDPR-----KLSAQEKNLLRIRSLEREKQEGLEKLASERDVLQRELEELKKKFEGMRSRNKLLSSEMKTLKSQMGTLVEKGRHDDELIDALM---DQLK 392          
BLAST of Coiled-coil domain containing 13 vs. TrEMBL
Match: A0A1S3HCI6 (coiled-coil domain-containing protein 13 OS=Lingula unguis OX=7574 GN=LOC106153467 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 2.527e-43
Identity = 131/393 (33.33%), Postives = 223/393 (56.74%), Query Frame = 3
Query:   99 FDKETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNE---------MTDELKVVKDKLKISEAKVLELLTTNQNLS--KDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKXXXXXXXXXXXXXXXDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRD 1244
            + +E VN   D +R +KDENGRL KLL E+DFEI +LKK   +        + ++  AA+ KI+ELSKK RE+ +E+E+ KTK  Q QK+ ++LEN++    + D   K +  K+ SN          +  ELK  ++KL+ +E K+ E    NQ LS   + K   K L +E+G+  + +  LL   S WRGRAQ+I++L +K+ +L  Q+++ Q      L+   D+   A  +G   S+R        + D R    + RL++ER+    K   EL  L EEH  LK+  D  K+RN+ L+ D+K  KQQ++ +LDK K+DDELI +L+++Q++LK+ ++         +   + ++ +   + + D++ + +L++I+  K++++ ++ D
Sbjct:   71 YSEELVNHLNDQLREMKDENGRLYKLLSERDFEIRQLKKKREEDRAAIAGGAGVASDAAATKIVELSKKVRELRAEVEAEKTKARQTQKKCRDLENKLRSADSEDMAGKGDIPKY-SNPYGSPRDDKSLEQELKATQEKLRQTELKLSE--QRNQVLSVKNELKSTQKVLANEVGE-GVTVQSLLNATSGWRGRAQQILALQKKVTELKSQLQDRQ----SSLAMEDDL--EAQFMGTSSSKR-------STLDDRHQTQIKRLEKERREAQDKAANELKALEEEHAALKRKFDASKARNKVLSEDVKLQKQQVQKLLDKGKHDDELIEALMKQQERLKSMVEQNNKSQQEKEQSQSAKLRELSQKQQHDVNVVEQLKKIVAEKEQKLHSMED 446          
BLAST of Coiled-coil domain containing 13 vs. TrEMBL
Match: A0A1S3HKX8 (coiled-coil domain-containing protein 13-like OS=Lingula unguis OX=7574 GN=LOC106156111 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.246e-43
Identity = 131/393 (33.33%), Postives = 223/393 (56.74%), Query Frame = 3
Query:   99 FDKETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNE---------MTDELKVVKDKLKISEAKVLELLTTNQNLS--KDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKXXXXXXXXXXXXXXXDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRD 1244
            + +E VN   D +R +KDENGRL KLL E+DFEI +LKK   +        + ++  AA+ KI+ELSKK RE+ +E+E+ KTK  Q QK+ ++LEN++    + D   K +  K+ SN          +  ELK  ++KL+ +E K+ E    NQ LS   + K   K L +E+G+  + +  LL   S WRGRAQ+I++L +K+ +L  Q+++ Q      L+   D+   A  +G   S+R        + D R    + RL++ER+    K   EL  L EEH  LK+  D  K+RN+ L+ D+K  KQQ++ +LDK K+DDELI +L+++Q++LK+ ++         +   + ++ +   + + D++ + +L++I+  K++++ ++ D
Sbjct:   71 YSEELVNHLNDQLREMKDENGRLYKLLSERDFEIRQLKKKREEDRAAIAGGAGVASDAAATKIVELSKKVRELRAEVEAEKTKARQTQKKCRDLENKLRSADSEDLAGKGDIPKY-SNPYGSPRDDKSLEQELKATQEKLRQTELKLSE--QRNQVLSVKNELKSTQKVLANEVGE-GVTVQSLLNATSGWRGRAQQILALQKKVTELKSQLQDRQ----SSLAMEDDL--EAQFMGTSSSKR-------STLDDRHQTQIKRLEKERREAQDKAANELKALEEEHAALKRKFDASKARNKVLSEDVKLQKQQVQKLLDKGKHDDELIEALMKQQERLKSMVEQNNKSQQEKEQSQSAKLRELSQKQQHDVNVVEQLKKIVAEKEQKLHSMED 446          
BLAST of Coiled-coil domain containing 13 vs. TrEMBL
Match: A0A210QJ33 (Coiled-coil domain-containing protein 13 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04926 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 8.626e-42
Identity = 127/375 (33.87%), Postives = 208/375 (55.47%), Query Frame = 3
Query:  135 IRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNF--LKFQSNEMTDE---LKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKXXXXXXXXXXXXXXXDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRD 1244
            IR +KDENGR+ KLL EKDFE+  +KK   +   G    S L++  A+ KI+ELSKK RE+TSE+E  +TK  Q  ++  +L N+I  +     +   +   L+ Q+ E +++   +K ++DKLK +E+KV +      +L ++ KI  K L  EIGD N+++  LL T S+WRGR+Q+I+ L  +++ L  Q+    + EG               +GM  S RR       ++D R  + L +L +ER+    K+  EL  L EEH  LK   D  K+RN+ LAN+IKS K Q++  + K  +DDELI +L+++Q +L+  ++   S        +  Q+     +++QD + + +L+ I+  K+ ++  L D
Sbjct:   81 IRELKDENGRVYKLLSEKDFELRNMKKKREEDKSG---ASGLTNETAATKIVELSKKVRELTSEMEVERTKSKQLARKCMDLSNQISSIPQEARSMMGSAVSLRLQAEEKSEDQVDVKAIQDKLKQTESKVSDYRNQISSLKQELKIVNKVLSQEIGD-NVNVQSLLNTNSSWRGRSQQILGLQARLEDLRAQLASKTKPEGDLEKDM---------MGMTSSRRR-------TADDRHREQLRKLDKERKESQEKQANELKALEEEHEALKTKLDASKTRNKVLANEIKSMKGQMQTCIQKGHHDDELIEALMRQQSKLQKLLEESGSDKMVNSQQAEAQLKHMSMKAQQDSNIVQQLKVIVTEKESKVHQLED 435          
BLAST of Coiled-coil domain containing 13 vs. TrEMBL
Match: A0A267GG38 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014410g1 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.877e-41
Identity = 125/388 (32.22%), Postives = 216/388 (55.67%), Query Frame = 3
Query:  129 DIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDK------SSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDE-----LKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTT-PSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDF------LGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKXXXXXXXXXXXXXXXDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNL 1238
            D +R + DENGRL+KL+ E++FEI +L++  ++  +G   +      S  +  AAS KI+ELSKK RE+T+ELE  +TK  Q  ++   LE           ++        + E  +E      K +K++LK S+AK+ +L    Q L+++  IA K L +E+GD  +   +LL+    NW+GR Q+++ L  ++ +L +++K ++      + S     +GATS+G D       + T    D++ +        L RLQRER+    + E+EL  L +E  KL++  DG K+R ++LAND KS K Q++ +L+K ++DDELIASL+++Q++ +T ++  I    +++  +  +  +   Q  Q+   I +L+EI+  KD +I  L
Sbjct:   90 DRVRALTDENGRLLKLVNEREFEIQRLQRAKDRLTMGAGGEGGSNAESGAAAAAASTKIVELSKKIRELTAELEKERTKSAQLSRKCHELERSSAASAAVPASAPPKMAPSAAGEAPEESTKKERKELKERLKASDAKLTDLRGQVQTLTRELNIAKKVLTEELGDCGVTPVQLLSGQGGNWKGRQQQVLMLQARVRELEQRLKSAESTSSNLMMS-----TGATSLGYDAFSVGSAASTQRGVDNKSTTATAANRDLQRLQRERREAVERSEKELRELRDEREKLQERLDGAKARAKTLANDNKSLKSQVQTLLEKGRHDDELIASLMRQQERARTLLEEAIEARATLEKAAQGETARQAVQRDQEARVIDRLKEIVADKDAQIRKL 472          

HSP 2 Score: 65.0846 bits (157), Expect = 4.486e-7
Identity = 46/132 (34.85%), Postives = 75/132 (56.82%), Query Frame = 3
Query: 1338 EINQLREILKLNNTRYQELMEKFSTLSEQ-NSLLKQNGFQLEREIQKLSPNSKFKFKSLNGVP---ENVLDSNINGLLSNDVSVTRETVTELQDALSLRLDKINSLNNALQLISLSKQEDITMLTGIIDQTR 1721
            E ++LRE+  +  TRYQ L+++ +  + Q  S +++    LER+++K S  +    ++  G     E   D+ +  LLS D++  +E+V  L+DAL+   ++  SL  ALQ    SK ED+ MLT II QTR
Sbjct:  554 ERDRLRELAGVQETRYQHLLDREAKSAAQLQSTMRRLAL-LERQLEKSSRQTGKTAQAHPGTSVAIEMPSDAELAALLSEDLAANKESVDRLRDALTACYEEAASLRRALQSALHSKNEDLKMLTDIISQTR 684          
BLAST of Coiled-coil domain containing 13 vs. TrEMBL
Match: C3ZH04 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_124068 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.877e-41
Identity = 132/430 (30.70%), Postives = 230/430 (53.49%), Query Frame = 3
Query:   99 FDKETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPN---IGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEI------LQLRTSDNNSKQNFLKFQSNEMTD---ELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKXXXXXXXXXXXXXXXDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRDFHQSKTSKESEKSFVDLDFEQLKISAASFVSEINQL 1352
            + +E +   +D +R ++DENGRL KLL E+D+E+ +++K + K      G      ++  AA+ KI++LSKKNRE+T+ELES KTK  Q  ++ ++LE ++       +    D  +    +     E  D   + K +KDKL  + +K+LE       L ++ K+A K LE E+G+  ++I  LL   S +RGR+Q+I+SL +K+ +L  Q+       G  LS     +  AT              TN+S  +R  D + +L+R+R+    K + E   L  +++K+K   D  K+RN+ LAN++KS K Q+  +LDK KNDDELI +L+ +Q+Q++  ++    +    Q     +V Q +T++ QD + + +L+ I+  K+ ++  L            E+   ++   +   SAA++ S +NQ+
Sbjct:   71 YAEEQMTNLKDQVRELRDENGRLYKLLSERDYEVRQIRKKMEKERALLTGGT--GGVASEAAATKIVDLSKKNRELTAELESGKTKMTQLSRKVQDLEKQLKAAVAQARAAARDEKASPRQVTLSLEEEKDLEADAKALKDKLTQTTSKLLETKNEVSMLKQELKVANKVLEKEVGE-GVNIQALLKDSSGFRGRSQQILSLQKKVSELKSQLGMQTTRSGSGLSLEEQFMGTATRA------------TNYSDKNR--DRIRQLERDRKEATEKAQAEKEALEADYSKMKDRFDASKARNKVLANEVKSLKDQLAVLLDKGKNDDELITALMNQQEQMQKLLEQTTKKQQEYQQQQQAEVTQIITKNMQDQNIVDQLKAIVAQKEGQVKAL------------EEEIREIRIPEPVCSAAAWRSRMNQV 471          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Cavefish
Match: ccdc13 (coiled-coil domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-061207-11])

HSP 1 Score: 130.568 bits (327), Expect = 2.051e-31
Identity = 106/332 (31.93%), Postives = 186/332 (56.02%), Query Frame = 3
Query:  117 NTNEDI---IRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEI--LQLRTSDNNSKQNF-LKFQSNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSI---GMDYSERRVHSM-TNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            N NE +   +R ++D+NGRL KLL EK+FEI  LKK   +  +  +  + ++  AA+ KI+ELSKKNRE  +E+E  K K  Q     K LE E+    L +S+  + Q   L+    E +  +K +++KL  ++ K+ E     Q + ++ KIA K L  E+G+ ++++ +L+++  +WRGRAQ+I++L  ++  L +Q+           S+    + G  S+   GM  +   + +   NHS       ++  ++R+R+ +  K   +   L  EH+ LK+  +  K+RN+ L  +++S K QI  +LDK K+DDEL+ +L+++Q QL+
Sbjct:   69 NENEQLQEELRELRDQNGRLHKLLSEKEFEIKHLKKKREENRLALVGMAGMAGDAAATKIVELSKKNREFAAEIEREKAKTKQMSNRVKELEKELQNFSLLSSELKAGQTLELRNTEEEASPLVKTLQEKLSSAQFKMTEYRNQIQAVKQELKIAHKVLSCEVGE-DVNVLQLVSSTGSWRGRAQQILALQNRVRDLEQQLS----------SASSRKMPGDLSLEEEGMLGNGVHLRNQDKNHS-------YIRSMERDRKEMLEKLSADHDLLLNEHSDLKKKLEASKARNRVLTTELRSLKTQISTLLDKGKHDDELVDALLKQQAQLQ 382          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Sea Lamprey
Match: ccdc13 (coiled-coil domain containing 13 [Source:ZFIN;Acc:ZDB-GENE-061207-11])

HSP 1 Score: 121.324 bits (303), Expect = 4.551e-29
Identity = 96/336 (28.57%), Postives = 176/336 (52.38%), Query Frame = 3
Query:  108 ETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEI--------LQLRTSDNNSKQNFLKFQ--SNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKES-QENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            E V + ++ +R + DE  RL +++ EKD    +L+  L +  +        S   A++KI+ELSK+ RE+T+ELE  +++  Q   + + LE ++        L   T    +K     F   S    +E K ++DKL  +  K+ +     Q L ++ + A K L +E+G+  ++I  LL+ P +WRGR+Q+I++L  K+ +L  Q+ +S Q + G  L    + ++G      +   RR      + +  R       ++RER+    K   EL TL +E  + ++  +G ++RN  L  ++K+ + QI  ++ KA+NDDELI +L+++Q +L+
Sbjct:    2 EAVRSLQERVREMGDELSRLHRIVAEKDRRAAQLQSQLEESRLALAGPVGASGDTAALKIVELSKRVREMTAELERERSRVKQLTTKLRQLEEQVRPGLHLFSLNSSTYCTWTKPTLYTFPNLSFGAGNEEKALQDKLSATNLKLSDYRNQVQLLKQELRTAHKVLTNEVGE-TVNIPHLLSNPGSWRGRSQQILNLQTKVRELEAQLGQSTQRSRGSELLLEEEEMTG------NGGPRRTPLQDKNQAHIRA------MERERKEAMEKMAGELETLRKEQDEGRRKLEGTRARNIVLTTEVKTLRGQISTLMVKAQNDDELIQTLLEQQKRLQ 324          
BLAST of Coiled-coil domain containing 13 vs. Ensembl Medaka
Match: ccdc13 (coiled-coil domain containing 13 [Source:NCBI gene;Acc:101154982])

HSP 1 Score: 114.005 bits (284), Expect = 4.023e-26
Identity = 91/320 (28.44%), Postives = 175/320 (54.69%), Query Frame = 3
Query:  135 IRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDE----LKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLK 1082
            +R ++D NGRL+KLL EK+FEI  LKK  ++  +     + L    A+ KIIELSKKNRE+   +E  K K  Q     K LE E LQ+  S   +    L+  S+E  ++    +K ++ KL  +E K+ E     Q+  ++ K+A K L  E+G+  +++ ++L++P ++RGR+Q+I++L  K+  L +Q+K++ +            L  ++   +D   + V         ++   ++  +++ ++    K   +   L +E+ ++K+  D  K+RN   +N+I + + Q+  + +K K+D+EL+ +L+++Q Q++
Sbjct:   84 LRELEDVNGRLVKLLSEKEFEIKHLKKKRDEERLALAGTAGLEGAVAATKIIELSKKNRELNVTIEQEKVKSKQSANRIKELERE-LQVALSGEKTDSKPLEKSSSEDCEQENPGVKSLQKKLAAAELKMTEYRNQVQSAKQELKVAQKVLISEVGE-EVNLQQVLSSPGSFRGRSQQILALQTKVRDLEQQLKQAIQ------------LGQSSVFSLDEEFQGVGVFQKTPPPNKNLSYIRTMEKRKREAFEKISADYEALLKENKEMKKKMDAAKARNACQSNEIITLRAQLSTLQEKGKHDEELMDALLKQQVQMQ 389          
BLAST of Coiled-coil domain containing 13 vs. Planmine SMEST
Match: SMESG000058204.1 (SMESG000058204.1)

HSP 1 Score: 1069.3 bits (2764), Expect = 0.000e+0
Identity = 559/559 (100.00%), Postives = 559/559 (100.00%), Query Frame = 3
Query:   45 MNLLNFENSDDLNLKTFSFDKETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKXXXXXXXXXXXXXXXDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRDFHQSKTSKESEKSFVDLDFEQLKISAASFVSEINQLREILKLNNTRYQELMEKFSTLSEQNSLLKQNGFQLEREIQKLSPNSKFKFKSLNGVPENVLDSNINGLLSNDVSVTRETVTELQDALSLRLDKINSLNNALQLISLSKQEDITMLTGIIDQTR 1721
            MNLLNFENSDDLNLKTFSFDKETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKTTIQSLISQTTSVQIDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRDFHQSKTSKESEKSFVDLDFEQLKISAASFVSEINQLREILKLNNTRYQELMEKFSTLSEQNSLLKQNGFQLEREIQKLSPNSKFKFKSLNGVPENVLDSNINGLLSNDVSVTRETVTELQDALSLRLDKINSLNNALQLISLSKQEDITMLTGIIDQTR
Sbjct:    1 MNLLNFENSDDLNLKTFSFDKETVNTNEDIIRNIKDENGRLMKLLQEKDFEINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKTKYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDELKVVKDKLKISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRGRAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSERRVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQICDGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKTTIQSLISQTTSVQIDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRDFHQSKTSKESEKSFVDLDFEQLKISAASFVSEINQLREILKLNNTRYQELMEKFSTLSEQNSLLKQNGFQLEREIQKLSPNSKFKFKSLNGVPENVLDSNINGLLSNDVSVTRETVTELQDALSLRLDKINSLNNALQLISLSKQEDITMLTGIIDQTR 559          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC133.375e-3331.29coiled-coil domain containing 13 [Source:HGNC Symb... [more]
AC006059.24.995e-3331.29novel protein[more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG130328.486e-1435.33gene:FBgn0036652 transcript:FBtr0075316[more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc134.153e-3833.14coiled-coil domain containing 13 [Source:ZFIN;Acc:... [more]
ccdc131.336e-1446.59coiled-coil domain containing 13 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
moxd14.518e-3531.79monooxygenase, DBH-like 1 [Source:Xenbase;Acc:XB-G... [more]
moxd11.293e-1027.75monooxygenase, DBH-like 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc135.135e-3431.08coiled-coil domain containing 13 [Source:MGI Symbo... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|D3YV10|CCD13_MOUSE3.592e-3331.08Coiled-coil domain-containing protein 13 OS=Mus mu... [more]
sp|Q8IYE1|CCD13_HUMAN1.621e-3231.29Coiled-coil domain-containing protein 13 OS=Homo s... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HCI62.527e-4333.33coiled-coil domain-containing protein 13 OS=Lingul... [more]
A0A1S3HKX84.246e-4333.33coiled-coil domain-containing protein 13-like OS=L... [more]
A0A210QJ338.626e-4233.87Coiled-coil domain-containing protein 13 OS=Mizuho... [more]
A0A267GG381.877e-4132.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
C3ZH041.877e-4130.70Uncharacterized protein (Fragment) OS=Branchiostom... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc132.051e-3131.93coiled-coil domain containing 13 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc134.551e-2928.57coiled-coil domain containing 13 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc134.023e-2628.44coiled-coil domain containing 13 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain containing 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058204.10.000e+0100.00SMESG000058204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000918 ID=SMED30000918|Name=Coiled-coil domain containing 13|organism=Schmidtea mediterranea sexual|type=transcript|length=1924bp
TTAATTGATTAACAACCAAGATTTTATTATTTTACATTCTATTTATGAAC
TTATTAAATTTTGAAAATTCAGATGATTTAAACCTTAAAACTTTTTCTTT
TGATAAAGAAACTGTCAATACTAATGAAGACATAATTCGTAATATTAAAG
ATGAAAATGGACGTTTAATGAAATTGTTACAAGAAAAAGATTTCGAGATT
AACAAGCTGAAAAAAGATTTAAATAAACCAAATATTGGTAATATTGACAA
ATCAAGTTTGTCTGATGGAGCAGCGTCTATGAAAATAATCGAGTTATCTA
AAAAAAATCGTGAAATAACATCTGAATTGGAATCATTTAAAACAAAATAC
AATCAAAGGCAAAAAGAAAATAAAAACCTAGAAAATGAAATACTGCAATT
AAGAACATCAGATAATAATTCCAAGCAAAATTTTTTAAAATTTCAATCTA
ATGAAATGACTGATGAACTGAAAGTAGTCAAAGATAAACTCAAAATATCT
GAAGCAAAAGTTTTGGAATTATTAACAACAAATCAAAATCTATCTAAAGA
TTATAAAATTGCTCTAAAAGCATTAGAAGACGAAATTGGTGATCCGAATA
TGGATATAAATAAATTATTAACAACACCTTCGAATTGGAGGGGCAGAGCT
CAAAAGATAATCAGTTTGAATCAAAAAATTGATAAATTATCAAAACAAAT
TAAAGAATCCCAAGAAAACGAAGGTGGATGCTTGTCATCGTTTGGTGATG
TTTTATCTGGAGCAACATCAATCGGAATGGATTATAGTGAACGACGAGTT
CATTCTATGACGAATCATTCTTCAGACAGTCGACAGAGTGATTTTCTTGG
ACGTCTACAACGCGAGCGTCAGTTAATTGCAATGAAAAAAGAACAAGAGC
TTCATACACTCAACGAAGAACACACAAAACTGAAACAGATCTGTGACGGG
TTAAAAAGTAGAAATCAGTCACTTGCTAACGATATAAAATCTTATAAGCA
ACAAATCAAAAACATGCTCGATAAAGCTAAAAACGATGATGAATTAATCG
CCTCATTAATTCAAAGACAAGATCAACTGAAAACAACAATCCAATCTTTG
ATAAGTCAAACCACATCCGTTCAAATAGACTCTAACCTGCAGGTTAACCA
AGCAGTTACTCAATCTAAGCAAGACATTGATACGATAGCAAAATTGAGAG
AAATTATCGAATTAAAAGATCGAGAAATTGTAAATTTGCGAGATTTTCAT
CAATCAAAAACATCGAAAGAAAGCGAAAAATCTTTTGTTGATCTGGATTT
CGAACAATTGAAAATTAGTGCTGCTTCATTTGTCAGTGAAATAAATCAAT
TGAGGGAAATTCTGAAATTAAATAATACAAGATATCAGGAACTAATGGAG
AAATTCTCGACTTTGTCAGAGCAAAATTCTCTATTGAAACAAAATGGATT
CCAGTTGGAACGAGAAATACAGAAATTATCCCCAAATTCAAAATTCAAAT
TCAAATCCCTAAATGGAGTGCCAGAAAATGTGCTCGATTCCAATATCAAT
GGATTGCTGTCAAATGATGTCTCTGTTACCAGGGAAACCGTTACTGAACT
ACAAGATGCGCTATCATTGCGTTTGGATAAAATTAACTCGCTTAATAATG
CGTTACAATTAATTTCTCTTTCAAAGCAGGAAGATATCACCATGTTGACT
GGTATCATTGATCAGACCAGAAATAAGTTCTTGGAGAGCTTCAAGAAATT
GAAAAATAATTTAAATGAAAAATAAAATTTGAACTTGCATATAATTTTTG
TTTGATGTTTTGATAACATTTTTTCATCTTGGACAAATAATATTTACAAT
CAAAATATCATTGAAAAACTCACTTATTTTTATACATGTTCCAATTACTC
ACTTCATAATCTTTTAAATAACCT
back to top

protein sequence of SMED30000918-orf-1

>SMED30000918-orf-1 ID=SMED30000918-orf-1|Name=SMED30000918-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=577bp
MNLLNFENSDDLNLKTFSFDKETVNTNEDIIRNIKDENGRLMKLLQEKDF
EINKLKKDLNKPNIGNIDKSSLSDGAASMKIIELSKKNREITSELESFKT
KYNQRQKENKNLENEILQLRTSDNNSKQNFLKFQSNEMTDELKVVKDKLK
ISEAKVLELLTTNQNLSKDYKIALKALEDEIGDPNMDINKLLTTPSNWRG
RAQKIISLNQKIDKLSKQIKESQENEGGCLSSFGDVLSGATSIGMDYSER
RVHSMTNHSSDSRQSDFLGRLQRERQLIAMKKEQELHTLNEEHTKLKQIC
DGLKSRNQSLANDIKSYKQQIKNMLDKAKNDDELIASLIQRQDQLKTTIQ
SLISQTTSVQIDSNLQVNQAVTQSKQDIDTIAKLREIIELKDREIVNLRD
FHQSKTSKESEKSFVDLDFEQLKISAASFVSEINQLREILKLNNTRYQEL
MEKFSTLSEQNSLLKQNGFQLEREIQKLSPNSKFKFKSLNGVPENVLDSN
INGLLSNDVSVTRETVTELQDALSLRLDKINSLNNALQLISLSKQEDITM
LTGIIDQTRNKFLESFKKLKNNLNEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038929CCDC13
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0034451centriolar satellite
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0006974cellular response to DNA damage stimulus
GO:0030030cell projection organization
GO:0031122cytoplasmic microtubule organization
GO:1905515non-motile cilium assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..47
NoneNo IPR availableCOILSCoilCoilcoord: 205..225
NoneNo IPR availableCOILSCoilCoilcoord: 433..467
NoneNo IPR availableCOILSCoilCoilcoord: 279..327
NoneNo IPR availableCOILSCoilCoilcoord: 81..129
IPR038929Coiled-coil domain-containing protein 13PANTHERPTHR31935FAMILY NOT NAMEDcoord: 28..571