CN hydrolase domain-containing protein

Overview
NameCN hydrolase domain-containing protein
Smed IDSMED30000908
Length (bp)1379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CN hydrolase domain-containing protein (SMED30000908) t-SNE clustered cells

Violin plots show distribution of expression levels for CN hydrolase domain-containing protein (SMED30000908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CN hydrolase domain-containing protein (SMED30000908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CN hydrolase domain-containing protein (SMED30000908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30000908h1SMcG0002077 Contig45720newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000908h1SMcG0002077 Contig45720uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000908 Contig11765newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000908 Contig11765uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000908 Contig15604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000908 Contig15604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30000908 Contig19011newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30000908 Contig19011uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30000908 Contig19011newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30000908 Contig19011uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CN hydrolase domain-containing protein vs. Ensembl Celegans
Match: F54H12.2 (pep chromosome:WBcel235:III:7964581:7965840:1 gene:WBGene00018842.1 transcript:F54H12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F54H12.2)

HSP 1 Score: 51.9878 bits (123), Expect = 6.177e-7
Identity = 48/173 (27.75%), Postives = 80/173 (46.24%), Query Frame = 2
Query:  848 YPLKTKKIVSFAIGQGASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDY------RETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNC-GITLEDFKSK-YPFFTFVLAP-DFDLNQSQLPQNGNLRLDIKFAKATTE-PVHVVIYGVFE 1336
            YP+ + ++ SF I  G            +MP  + +   S   YNGS+ T+   FK +GVT + +    DY            DF+N+ +   Y+Q +   +G+   N +C  I +  F+SK Y  F F L+P   D N  +L +  N+ + + F K T    ++ V+Y  F+
Sbjct:  235 YPMISSQVRSFYIDGGRFDAPANTLFTSKMPRRLFLGLVSSEAYNGSFGTTPFNFKPYGVTDVHI----DYCGQTIPGRPMNLDFENNKFVEAYVQ-LQETLGHTRNNFSCNSIDIGMFRSKGYTIFGFELSPVAQDNNLFELVRQTNVSVRLNFKKETPPGGLYCVVYAEFD 402          
BLAST of CN hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|P34456|YMD2_CAEEL (Uncharacterized protein F54H12.2 OS=Caenorhabditis elegans OX=6239 GN=F54H12.2 PE=4 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 7.858e-6
Identity = 48/173 (27.75%), Postives = 80/173 (46.24%), Query Frame = 2
Query:  848 YPLKTKKIVSFAIGQGASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDY------RETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNC-GITLEDFKSK-YPFFTFVLAP-DFDLNQSQLPQNGNLRLDIKFAKATTE-PVHVVIYGVFE 1336
            YP+ + ++ SF I  G            +MP  + +   S   YNGS+ T+   FK +GVT + +    DY            DF+N+ +   Y+Q +   +G+   N +C  I +  F+SK Y  F F L+P   D N  +L +  N+ + + F K T    ++ V+Y  F+
Sbjct:  235 YPMISSQVRSFYIDGGRFDAPANTLFTSKMPRRLFLGLVSSEAYNGSFGTTPFNFKPYGVTDVHI----DYCGQTIPGRPMNLDFENNKFVEAYVQ-LQETLGHTRNNFSCNSIDIGMFRSKGYTIFGFELSPVAQDNNLFELVRQTNVSVRLNFKKETPPGGLYCVVYAEFD 402          
BLAST of CN hydrolase domain-containing protein vs. TrEMBL
Match: W4YCC1 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.767e-36
Identity = 71/248 (28.63%), Postives = 126/248 (50.81%), Query Frame = 2
Query:  665 LLPGVNVHLRLERSDSALSLTSAT--GKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQ-IFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSD------YRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQS-QLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVLV 1375
            LL GV++ L+L RS ++ SL S+         I  A L VRRV + P     H   L ++ A YP++  ++ +F+I +G  SF +E  I G  ++P  +++   S + +NG Y  +   F ++ +  L L  +S+       R  ++    + NY   Y Q++   +  +  +    IT  D+   Y  + F + PD        L ++GN+RL+++FA A  E V+V++Y  +E+ ++I  NR V+V
Sbjct:  196 LLGGVDIKLKLNRSKNSFSLMSSVENANYKVLITSASLHVRRVKLSPEAALLHAKTLETQTAKYPIRRGEVKTFSIPRGNLSFTRESLILG--QLPKRLVIGCVSNTAFNGDYSKNPFNFHHYDLNFLALYADSEQIPWKPIRPNFSA--PDPNYILAY-QTLFSGINSMFHDKGNQITRNDYNKGYTLYAFDMTPDLSTGDCFNLRKHGNVRLELQFASALPETVNVLVYAEYESVIEIDRNRNVIV 438          

HSP 2 Score: 87.4261 bits (215), Expect = 4.767e-36
Identity = 57/187 (30.48%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLT-------TMGY-------RSDDS------RKAWIKNS*LYTMWSSLQLDFMDQPKYI 665
            CSK+E+ +F     Q  +E G + E F + +++D+   ++F++ GS  EY DL+ +L+  Q +V++ D   L D + V P N   H LF+D  L  N+  I    NTY ++A +ET+L Y ++   + L+       T G+       R+DD       R  +IK S +  M   L LD + Q + +
Sbjct:   11 CSKSEIDLFSIPPTQTTVEKGKWVEFFPLTNISDT-APIQFHLQGSTEEYTDLSQSLIHLQAKVVNGDGTPLADDAQVGPTNMFLHSLFSDVDLMLNDRLITPSTNTYAYRAALETLLTYGAEAKESQLSSALFYKDTAGHMDDGNPLRNDDGNMGLKERHRFIKGSNIVDMVGVLHLDMVFQDRLL 196          
BLAST of CN hydrolase domain-containing protein vs. TrEMBL
Match: W4ZG02 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.108e-35
Identity = 73/250 (29.20%), Postives = 130/250 (52.00%), Query Frame = 2
Query:  665 LLPGVNVHLRLERSDSALSLTS----ATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQ-IFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSD------YRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQS-QLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVLV 1375
            LL GV++ L+L RS ++ SL S    A  K+I  I  A L VRRV + P     H   L ++ A YP++  ++ +F+I +G  SF +E  I G  +MP  +++   S + +NG+Y  +   F ++ +  L L  +S+       R  ++    + NY   Y Q++   +  +  +    IT  D+   Y  + F + PD        L ++GN+RL+++FA+   E V+V++Y  +E+ ++I  NR V++
Sbjct:  196 LLGGVDIKLKLNRSKNSFSLMSSVQNAEYKVI--ITSASLHVRRVKLSPETSLLHAKTLETQTAKYPIRRSEVKTFSIPRGNLSFTRESLILG--QMPKRLVIGCVSNTAFNGNYAKNPFNFHHYDLNFLALYADSEQIPWKPIRPNFSA--PDPNYILAY-QTLFSGINSMFHDKGNQITRTDYDKGYTLYAFDMTPDLSTGDCFNLRKHGNVRLEMQFARELPETVNVMVYAEYESVIEIDRNRNVII 438          

HSP 2 Score: 85.8853 bits (211), Expect = 1.108e-35
Identity = 58/192 (30.21%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  150 HEMVSCSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLT-------TMGYRSDDS-------------RKAWIKNS*LYTMWSSLQLDFMDQPKYI 665
            H    CSK+E  +F     Q  +E G + E F + +++D+   ++F++ GS  EY DL+ TL+  Q++V++ D   L + + V P N   H LF+D  L  N+  I    NTY ++A +ET+L Y  +   + LT       T G+  D +             R  +IK S    M   L LD + Q K +
Sbjct:    6 HMSCECSKSETDLFSIPPTQTTVEKGKWVEFFPLTNISDT-TPIQFHLQGSTEEYTDLSQTLIHLQVKVVNGDGTPLAEDAQVGPTNMFLHSLFSDVDLMLNDRLITPSTNTYAYRAALETLLTYGPEAKESQLTSALFYKDTPGHMDDGNPLREDAGNMGLKERHRFIKGSKTVDMVGLLHLDMVFQDKLL 196          
BLAST of CN hydrolase domain-containing protein vs. TrEMBL
Match: W4YPC4 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.435e-34
Identity = 87/250 (34.80%), Postives = 126/250 (50.40%), Query Frame = 2
Query:  665 LLPGVNVHLRLERSDSALSLTS--ATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNF-----GVT----SLTLSK-NSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDF-DLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVL 1372
            LLPGV++ L+L RS  A  L S  A G    +I+ A L+VRRV  +PSV+  H   L   +A YPL    + SF I  G  SF K+ +F    +PN I+V F     YNG+Y  +   FKN      GVT    S+ +     ++RE   QDF +  Y + +M S   N  + DK ++  I  E++   Y  F F L PD  D     L + GNLRL+++F       V+ ++Y   +  +QI  +R V+
Sbjct:  197 LLPGVDLKLKLNRSKDAFCLLSSNAEGNYKVKILSAALYVRRVKTNPSVMLNHAKMLEKANAKYPLNKVDVRSFTIPAGNMSFNKDNLFLG-HLPNRIVVGFVDNDAYNGTYGKNPYNFKNLLLNYVGVTVDGESIPMKPLRPNFREGPGQDFIHA-YNSLFMGS---NRLFQDKGID--INREEYARGYTLFAFDLTPDLSDGCHLNLVKQGNLRLELQFDNPLPNTVNCLVYSESQGLIQIDRSRNVV 439          

HSP 2 Score: 69.707 bits (169), Expect = 2.435e-34
Identity = 43/147 (29.25%), Postives = 76/147 (51.70%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKAWIKNS 605
            C K+EL +F     Q  I  G + E   ++++TDS   +EF + G+  EY+DL+ T+L    ++ + D   L   + V P N     LF+   +  N   +   +NTY ++A++E+I++Y  +T ++ LT   Y  D + K  + N 
Sbjct:   11 CCKSELDLFTLPFTQMSILKGPWVEYHPVSNITDS-APIEFNVAGTAEEYVDLSQTMLAVTAKITNPDNTNLAQEAPVGPVNLFLPSLFSQVDVMLNEKLVSQPSNTYPYRAMLESIMHYGKETKDSQLTQQLYYKDAAGKMDLLNP 156          
BLAST of CN hydrolase domain-containing protein vs. TrEMBL
Match: A0A3C1P7N7 (Uncharacterized protein (Fragment) OS=Planktothrix sp. UBA8402 OX=2055759 GN=DCQ63_02400 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.243e-33
Identity = 76/180 (42.22%), Postives = 106/180 (58.89%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDD-SRKAWIKNS*LYTMWSSLQLDFMDQPKYIYFQVLTFICV*K 701
              KTEL IF+   PQ VIE G FE+V Y  + T+S   +EF +  S  +YLDLNDTLL+ Q++V+  D   L D    VP+++  H LF+D  L  N+  IEGG+  Y +KA+IE+ L +NS+T  T L   G+      RKAW+  S +  M   L+LDF++QPKY+   V   I + K
Sbjct:    2 SGKTELKIFDDHPPQVVIEAGYFEDV-YPKAATESTT-IEFEVPSSNVDYLDLNDTLLSLQVKVVKADGTALTDKDKPVPSDYFMHSLFSDVSLALNDTTIEGGSGIYPYKAVIESELNFNSETKQTQLAMAGHEPAVLKRKAWVALSKVLEMIGPLRLDFLNQPKYLLPGVKVRIILTK 179          
BLAST of CN hydrolase domain-containing protein vs. TrEMBL
Match: A0A1W2W8E9 (uncharacterized protein F54H12.2-like OS=Ciona intestinalis OX=7719 GN=LOC100177200 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.874e-33
Identity = 70/238 (29.41%), Postives = 113/238 (47.48%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAI-GQGASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDY--RETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDF-DLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANR 1363
            YLL  V+V L+L RS    +     G    +I  A L VR++ +  SV  GH   L+     YP+   ++ +  I G   S   E +F  + +P  +++ F     +NG +  +   FK++ +TSL L  N      +  T +F +  Y  +YM ++   +G    +   GI+  D+   Y  F F L PD  D     L ++G+L L+ KF  A T  V+++IY  F+N +QI   R
Sbjct:  189 YLLNEVDVKLKLTRSKDTFATIRPAG-FKVKITQASLHVRKLKISSSVQLGHITALDRGLCKYPITRVEMKTITIPGGNQSISHENLFLGQ-LPKRVIIGFVDNDAFNGIHNKNPFNFKHYNLTSLALHSNGRQIPSKELTPNFTDGLYIRSYM-TLFTGLGKFYADEGNGISRSDYPHGYTLFAFNLTPDLADGTHFDLIKSGDLSLEAKFGNALTNSVNIIIYAEFQNLIQIDRER 423          

HSP 2 Score: 80.1073 bits (196), Expect = 3.874e-33
Identity = 55/186 (29.57%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLT-TMGYRS--------DDS------RKAWIKNS*LYTMWSSLQLDFMDQPKYIYFQV 677
            C K+EL +F     Q  ++ G +      N L+DS   VEF I+G++  Y+DL ++ L  ++++++ D   L + + VVP N  FH L++  ++  NN  +   ++TY +++ IE +L +  D   T LT ++ Y+         DD+      RKA+   S +  M   L LD M Q +Y+  +V
Sbjct:   10 CLKSELDLFSAPMTQTSVQDGMWVVNGVQNGLSDS-GTVEFLISGTKEHYIDLANSYLHIEVKIVNADGTNLANDATVVPTNNFFHSLWSQVMMSLNNRDVTSSSSTYPYRSYIENLLTFGPDAKATHLTGSLFYKDTPQHMDAIDDTNTGATLRKAFCAGSRVIDMQGKLHLDLMFQQRYLLNEV 194          
BLAST of CN hydrolase domain-containing protein vs. Ensembl Nematostella
Match: EDO39053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB46])

HSP 1 Score: 48.521 bits (114), Expect = 3.552e-6
Identity = 59/240 (24.58%), Postives = 103/240 (42.92%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQGASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLN-CGITLEDFKSKYPFFTFVLAPDFDL-NQSQLPQ-NGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVL 1372
            YL  GV++ L+L+ +  A  L S     I +IVDA+L +  V   P    G       K   +P++   I+    G  ++  ++   GDR  PN I V F     YN SY  +   F    ++++ +  +            +      Y  ++    G +++ +    IT ++F + Y    F L P  +  ++   PQ  G + + + FA ATT+    +I G  E  VQ+ A R ++
Sbjct:  192 YLPDGVSIKLKLDLNPDAFVLMSENQNEIVRIVDAQLSLFHVKASPDE-EGVVHSATPKTVKFPVR-PLIIKTREGLRSTKLQDVFVGDR--PNRIFVAFVDSEGYNVSYSHNPFHFPTSMLSAIKVVVDGIEMPAPQYKIADGWVAELYYNTLGAIAGTVNQAMGLVSITRKEFANGYGVMVFDLTPAGNAASEFAHPQYKGIVNIYVDFAVATTKAYTALIGGELERTVQVDAQRQLV 427          
BLAST of CN hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000023611.1 (SMESG000023611.1)

HSP 1 Score: 447.973 bits (1151), Expect = 0.000e+0
Identity = 220/238 (92.44%), Postives = 228/238 (95.80%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVL 1372
            YLLPGVNVH+RL+RSDSALSLTSAT   I Q+VDAKL VRRV V+PSVLAGHQ+GLNSKHAIYPLKTK+IV FAI +G ASFYKEQIFGDRRMPNFILVTFQSESQYNGS+LTSSSIFKNFGVTSLTLSKNSDYRE YTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVL
Sbjct:  399 YLLPGVNVHIRLKRSDSALSLTSATTAPILQLVDAKLLVRRVRVEPSVLAGHQLGLNSKHAIYPLKTKEIVQFAIAKGSASFYKEQIFGDRRMPNFILVTFQSESQYNGSHLTSSSIFKNFGVTSLTLSKNSDYREKYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVL 636          

HSP 2 Score: 253.062 bits (645), Expect = 0.000e+0
Identity = 123/155 (79.35%), Postives = 134/155 (86.45%), Query Frame = 3
Query:  201 SPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKAWIKNS*LYTMWSSLQLDFMDQPKYI 665
            SPQ VIE GAFEEVF MNS+ DSR D+EFYINGSQTEYLDLNDTLLT QI+V+DKDRK L + SDV+PNNFLFH LF DA+LGFNNIKIEGGNNTY +KALIETI+ YNSDT NTCLT MGY SDD RK WIK S L+TM SSLQLDFMDQPKY+
Sbjct:  246 SPQAVIEMGAFEEVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNNTYIYKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYL 400          
BLAST of CN hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000029226.1 (SMESG000029226.1)

HSP 1 Score: 444.506 bits (1142), Expect = 0.000e+0
Identity = 218/239 (91.21%), Postives = 227/239 (94.98%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVLV 1375
            YLLPGVNVH+RL+RSDSALSLTSAT   I Q+VDAKL VRRV V+PSVLAGHQ+GLNSKHAIYPLKTK+IV FAI +G ASFYKEQIF DRRMPNFILVTFQSESQYNGSYLTS SIFKNFGVTSLTLSKNSDYRETYTQDF+NDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFT VLAPDFDLNQSQLPQNGNLRLDIKF+KATTEPVHVVIYGVFENEVQITANRTVLV
Sbjct:  820 YLLPGVNVHIRLKRSDSALSLTSATTSPILQLVDAKLLVRRVRVEPSVLAGHQLGLNSKHAIYPLKTKEIVQFAIAKGSASFYKEQIFVDRRMPNFILVTFQSESQYNGSYLTSCSIFKNFGVTSLTLSKNSDYRETYTQDFENDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTLVLAPDFDLNQSQLPQNGNLRLDIKFSKATTEPVHVVIYGVFENEVQITANRTVLV 1058          

HSP 2 Score: 230.72 bits (587), Expect = 0.000e+0
Identity = 115/167 (68.86%), Postives = 129/167 (77.25%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKAWIKNS*LYTMWSSLQLDFMDQPKYI 665
            C K+ELC+F+R SPQ VIE GAFE+VF MNS+ DSR D+EFYIN SQTEYLDLNDTLLT Q++V+DKDRK L                  DA+LGFNNIKIEGGN+TY HKALIETI+ YNSDT NTCLT MGY SDD RK WIK S L+TM SSLQLDFMDQPKY+
Sbjct:  673 CGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINDSQTEYLDLNDTLLTVQVKVVDKDRKPL------------------DAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYL 821          
BLAST of CN hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000076652.1 (SMESG000076652.1)

HSP 1 Score: 436.802 bits (1122), Expect = 0.000e+0
Identity = 216/239 (90.38%), Postives = 225/239 (94.14%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVLV 1375
            YLL  VNVH+RL+RSDSALSLTSAT   I Q+VDAKL VRRV V+PSVLAGHQ+GLNSKHAIYPLKTK+IV FAI +G ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKN GVTSLTLSKNSDYRET TQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITL+DFK+KYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKAT EPVHVVIYGVFENEVQITANRTVLV
Sbjct:  593 YLLLCVNVHIRLKRSDSALSLTSATTAPILQLVDAKLLVRRVRVEPSVLAGHQLGLNSKHAIYPLKTKEIVQFAIAKGSASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNLGVTSLTLSKNSDYRETDTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLDDFKNKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATIEPVHVVIYGVFENEVQITANRTVLV 831          

HSP 2 Score: 276.944 bits (707), Expect = 0.000e+0
Identity = 135/194 (69.59%), Postives = 156/194 (80.41%), Query Frame = 3
Query:  102 ERKKHRSSYKNKRMKGHEM--VSCSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKAWIKNS*LYTMWSSLQLDFMDQPKYIYFQV 677
            +RK+H    + K    + +  + C K+ELC+F+R SPQ VIE GAFE+VF MNS+ DSR D+EFYINGSQTEYLDLNDTLLT QI+V+DKDRKLL + SDV+PNNFLFH LF DA+LGFNNIKIEGGN+TY HKALIETI+ YNSDT NTCLT MGY SDD RK WIK S L+TM SSLQLDFMDQPKY+   V
Sbjct:  405 KRKRHHEHLQTKERAWNYISKMICGKSELCLFDRPSPQAVIEMGAFEDVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKLLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYLLLCV 598          
BLAST of CN hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000050587.1 (SMESG000050587.1)

HSP 1 Score: 404.06 bits (1037), Expect = 0.000e+0
Identity = 195/220 (88.64%), Postives = 209/220 (95.00%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVV 1318
            YLLPGVNVH+RL+RSDS LSLTSAT   I Q+VDAKL VRRV ++PSVLAGHQ+GLNSKHAIYPLKTK+IV FAI +G ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTS+SIFKNFGVTSLTLSKNSDYRETYTQDF+NDNYCA+YMQSIVRNMGYLDKNLNCGITLEDFK+KYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPV+ +
Sbjct:  168 YLLPGVNVHIRLKRSDSVLSLTSATTAPILQLVDAKLLVRRVRIEPSVLAGHQLGLNSKHAIYPLKTKEIVQFAIAKGSASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSNSIFKNFGVTSLTLSKNSDYRETYTQDFENDNYCASYMQSIVRNMGYLDKNLNCGITLEDFKNKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVYRI 387          

HSP 2 Score: 273.478 bits (698), Expect = 0.000e+0
Identity = 130/167 (77.84%), Postives = 144/167 (86.23%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKAWIKNS*LYTMWSSLQLDFMDQPKYI 665
            C K+ELC+F+R SPQ VIE GAFEEVF MNS+ DSR D+EFYINGSQTEYLDLNDTLLT QI+V+DKDRK L + SDV+PNNFLFH LF DA+LGFNNIKIEGGN+TY HKALIETI+ YNSDT NTCLT MGY SDD RK WIK S L+TM SSLQLDFMDQPKY+
Sbjct:    3 CGKSELCLFDRPSPQAVIEMGAFEEVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYL 169          
BLAST of CN hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000050587.1 (SMESG000050587.1)

HSP 1 Score: 403.675 bits (1036), Expect = 0.000e+0
Identity = 195/220 (88.64%), Postives = 209/220 (95.00%), Query Frame = 2
Query:  662 YLLPGVNVHLRLERSDSALSLTSATGKLICQIVDAKLFVRRV*VDPSVLAGHQIGLNSKHAIYPLKTKKIVSFAIGQG-ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDFDNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVHVV 1318
            YLLPGVNVH+RL+RSDS LSLTSAT   I Q+VDAKL VRRV ++PSVLAGHQ+GLNSKHAIYPLKTK+IV FAI +G ASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTS+SIFKNFGVTSLTLSKNSDYRETYTQDF+NDNYCA+YMQSIVRNMGYLDKNLNCGITLEDFK+KYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPV+ +
Sbjct:  168 YLLPGVNVHIRLKRSDSVLSLTSATTAPILQLVDAKLLVRRVRIEPSVLAGHQLGLNSKHAIYPLKTKEIVQFAIAKGSASFYKEQIFGDRRMPNFILVTFQSESQYNGSYLTSNSIFKNFGVTSLTLSKNSDYRETYTQDFENDNYCASYMQSIVRNMGYLDKNLNCGITLEDFKNKYPFFTFVLAPDFDLNQSQLPQNGNLRLDIKFAKATTEPVYRI 387          

HSP 2 Score: 273.092 bits (697), Expect = 0.000e+0
Identity = 130/167 (77.84%), Postives = 144/167 (86.23%), Query Frame = 3
Query:  165 CSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFYINGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDAILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKAWIKNS*LYTMWSSLQLDFMDQPKYI 665
            C K+ELC+F+R SPQ VIE GAFEEVF MNS+ DSR D+EFYINGSQTEYLDLNDTLLT QI+V+DKDRK L + SDV+PNNFLFH LF DA+LGFNNIKIEGGN+TY HKALIETI+ YNSDT NTCLT MGY SDD RK WIK S L+TM SSLQLDFMDQPKY+
Sbjct:    3 CGKSELCLFDRPSPQAVIEMGAFEEVFPMNSIMDSRTDIEFYINGSQTEYLDLNDTLLTVQIKVVDKDRKPLGEPSDVIPNNFLFHTLFKDAVLGFNNIKIEGGNSTYIHKALIETIINYNSDTKNTCLTPMGYGSDDDRKKWIKGSKLFTMCSSLQLDFMDQPKYL 169          
The following BLAST results are available for this feature:
BLAST of CN hydrolase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F54H12.26.177e-727.75pep chromosome:WBcel235:III:7964581:7965840:1 gene... [more]
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P34456|YMD2_CAEEL7.858e-627.75Uncharacterized protein F54H12.2 OS=Caenorhabditis... [more]
back to top
BLAST of CN hydrolase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4YCC14.767e-3628.63Uncharacterized protein OS=Strongylocentrotus purp... [more]
W4ZG021.108e-3529.20Uncharacterized protein OS=Strongylocentrotus purp... [more]
W4YPC42.435e-3434.80Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A3C1P7N73.243e-3342.22Uncharacterized protein (Fragment) OS=Planktothrix... [more]
A0A1W2W8E93.874e-3329.41uncharacterized protein F54H12.2-like OS=Ciona int... [more]
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO390533.552e-624.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CN hydrolase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CN hydrolase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023611.10.000e+092.44SMESG000023611.1[more]
SMESG000029226.10.000e+091.21SMESG000029226.1[more]
SMESG000076652.10.000e+090.38SMESG000076652.1[more]
SMESG000050587.10.000e+088.64SMESG000050587.1[more]
SMESG000050587.10.000e+088.64SMESG000050587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000908 ID=SMED30000908|Name=CN hydrolase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1379bp
CATGGAAATTGGGAAGTTGCTTTGTTTGATTTTACCTTTGTATAAAGTTT
ATTTCCATTATACAACAAATCCAAAATTGAATACAATAAGACTGAAATGA
TGAACGTAAAAAACATCGATCATCGTATAAAAACAAAAGAATGAAAGGTC
ATGAAATGGTCAGTTGCAGCAAAACTGAATTGTGTATATTTGAAAGGCTA
TCACCTCAAGAAGTAATTGAGTATGGTGCATTTGAAGAAGTATTTTACAT
GAATTCTCTTACAGATAGTAGAAAGGATGTTGAATTTTATATTAATGGTT
CTCAAACTGAATATCTGGATTTGAATGATACTTTATTAACTTTCCAAATA
GAAGTCATAGATAAAGATAGAAAACTTTTGCTTGATGCTTCAGATGTTGT
GCCAAACAATTTCTTGTTCCATATACTTTTTAATGATGCAATACTTGGTT
TTAACAATATCAAGATTGAAGGTGGTAACAACACGTATAATCACAAAGCT
TTAATTGAAACTATTTTATATTATAATTCTGATACTACAAATACCTGTCT
TACTACTATGGGTTATAGAAGTGATGACAGTAGAAAGGCTTGGATTAAAA
ACTCTTGATTATACACTATGTGGTCATCTTTACAACTTGATTTCATGGAC
CAGCCAAAATATATCTACTTCCAGGTGTTAACGTTCATTTGCGTTTAGAA
AGATCTGATTCCGCATTATCATTAACTTCTGCAACAGGGAAACTAATTTG
TCAAATAGTTGATGCAAAATTATTTGTAAGAAGAGTTTGAGTAGATCCGT
CAGTATTAGCCGGTCATCAAATTGGTCTCAATTCTAAACACGCTATTTAT
CCATTAAAAACCAAGAAAATTGTTTCATTTGCAATTGGTCAAGGTGCATC
TTTCTATAAGGAACAAATATTTGGAGATAGAAGAATGCCCAACTTTATAT
TGGTAACATTTCAAAGTGAATCTCAATATAATGGATCCTACTTAACATCG
AGCTCAATTTTCAAAAACTTTGGTGTAACATCGCTAACTTTATCGAAAAA
TAGTGATTATAGAGAAACATATACTCAAGATTTCGATAATGATAATTATT
GTGCTACATATATGCAGAGTATAGTGAGAAATATGGGTTATTTGGATAAA
AACCTTAATTGTGGTATAACTCTTGAAGATTTTAAAAGCAAATATCCATT
CTTTACATTTGTTTTGGCACCCGATTTTGATTTAAATCAGAGTCAATTAC
CTCAAAATGGAAATTTACGATTAGATATAAAGTTTGCTAAAGCTACAACT
GAACCGGTACATGTTGTAATATATGGAGTATTTGAAAATGAGGTTCAAAT
AACTGCAAACAGAACAGTATTGGTTTGAA
back to top

protein sequence of SMED30000908-orf-1

>SMED30000908-orf-1 ID=SMED30000908-orf-1|Name=SMED30000908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MKGHEMVSCSKTELCIFERLSPQEVIEYGAFEEVFYMNSLTDSRKDVEFY
INGSQTEYLDLNDTLLTFQIEVIDKDRKLLLDASDVVPNNFLFHILFNDA
ILGFNNIKIEGGNNTYNHKALIETILYYNSDTTNTCLTTMGYRSDDSRKA
WIKNS*
back to top

protein sequence of SMED30000908-orf-2

>SMED30000908-orf-2 ID=SMED30000908-orf-2|Name=SMED30000908-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MPNFILVTFQSESQYNGSYLTSSSIFKNFGVTSLTLSKNSDYRETYTQDF
DNDNYCATYMQSIVRNMGYLDKNLNCGITLEDFKSKYPFFTFVLAPDFDL
NQSQLPQNGNLRLDIKFAKATTEPVHVVIYGVFENEVQITANRTVLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000136whole organism