Ribonuclease P protein subunit p29

Overview
NameRibonuclease P protein subunit p29
Smed IDSMED30000905
Length (bp)873
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribonuclease P protein subunit p29 (SMED30000905) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribonuclease P protein subunit p29 (SMED30000905) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribonuclease P protein subunit p29 (SMED30000905) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribonuclease P protein subunit p29 (SMED30000905) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000905

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30000905h1SMcG0007460 dd_Smed_v4_10916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30000905h1SMcG0007460 dd_Smed_v4_10916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30000905h1SMcG0007460 dd_Smed_v4_10916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30000905h1SMcG0007460 dd_Smed_v4_10916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Human
Match: POP4 (POP4 homolog, ribonuclease P/MRP subunit [Source:HGNC Symbol;Acc:HGNC:30081])

HSP 1 Score: 67.0106 bits (162), Expect = 1.343e-12
Identity = 46/144 (31.94%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  219 GINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            G++++++R   +  +   Q     L + L+  W+ YI+   + L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++  D F   I+GS F  +  +R+ +K
Sbjct:   75 GLSARQRRELRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCSGL---KPDTQPQMIQAKLLKADLHGAIISVTKSK-CPSYVGITGILLQETKHIFKIITKED-RLKVIPKLNCVFTVET-DGFISYIYGSKFQLRSSERSAKK 211          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Human
Match: POP4 (POP4 homolog, ribonuclease P/MRP subunit [Source:HGNC Symbol;Acc:HGNC:30081])

HSP 1 Score: 54.6842 bits (130), Expect = 3.721e-9
Identity = 37/95 (38.95%), Postives = 57/95 (60.00%), Query Frame = 3
Query:  393 QILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNFPQKFDI 677
            ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++  D F   I+GS F  +  +R+ +K       D+
Sbjct:    5 KLLKADLHGAIISVTKSK-CPSYVGITGILLQETKHIFKIITKED-RLKVIPKLNCVFTVET-DGFISYIYGSKFQLRSSERSAKKFKAKGTIDL 96          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Human
Match: POP4 (POP4 homolog, ribonuclease P/MRP subunit [Source:HGNC Symbol;Acc:HGNC:30081])

HSP 1 Score: 55.4546 bits (132), Expect = 9.014e-9
Identity = 36/111 (32.43%), Postives = 65/111 (58.56%), Query Frame = 3
Query:  219 GINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILK 551
            G++++++R   +  +   Q   + L + L+  W+ YI+   + L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K
Sbjct:   75 GLSARQRRELRLFDIKPEQ---QSLFLPLHELWKQYIRDLCSGL---KPDTQPQMIQAKLLKADLHGAIISVTKSK-CPSYVGITGILLQETKHIFKIITKED-RLKVIPK 177          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Zebrafish
Match: pop4 (POP4 homolog, ribonuclease P/MRP subunit [Source:ZFIN;Acc:ZDB-GENE-050522-505])

HSP 1 Score: 68.1662 bits (165), Expect = 3.179e-13
Identity = 49/154 (31.82%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  219 GINSKKKRSNSINAV-LKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNFPQKFDI 677
            G+N+K++R   I  +  +HQ  E  L + L+  W++YI+     L      +N +V  +++LK D  GA + V +SK  P+ VGL+GI++ E K++F++ + ED  LK I K  +VF +++   F   I+GS F  +  +R+ +K       D+
Sbjct:   74 GLNAKERRRLQIFQLKPEHQKYE--LFLPLHKLWKSYIEDLCNGL---KPGSNPQVIQQKLLKADFHGAILTVVRSK-CPSYVGLTGILVQELKHIFKLITKED-KLKVIPKRNSVFSVEV-GGFVSHIYGSKFELRSSERSAKKFKVKGTIDL 219          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Zebrafish
Match: pop4 (POP4 homolog, ribonuclease P/MRP subunit [Source:ZFIN;Acc:ZDB-GENE-050522-505])

HSP 1 Score: 68.5514 bits (166), Expect = 3.390e-13
Identity = 50/154 (32.47%), Postives = 86/154 (55.84%), Query Frame = 3
Query:  219 GINSKKKRSNSINAV-LKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNFPQKFDI 677
            G+N+K++R   I  +  +HQ  E  L + L+  W++YI+     L   S   N +V  +++LK D  GA + V +SK  P+ VGL+GI++ E K++F++ + ED  LK I K  +VF +++   F   I+GS F  +  +R+ +K       D+
Sbjct:   81 GLNAKERRRLQIFQLKPEHQKYE--LFLPLHKLWKSYIEDLCNGLKPGS---NPQVIQQKLLKADFHGAILTVVRSK-CPSYVGLTGILVQELKHIFKLITKED-KLKVIPKRNSVFSVEV-GGFVSHIYGSKFELRSSERSAKKFKVKGTIDL 226          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Xenopus
Match: pop4 (POP4 homolog, ribonuclease P/MRP subunit [Source:NCBI gene;Acc:550006])

HSP 1 Score: 63.5438 bits (153), Expect = 2.042e-11
Identity = 42/120 (35.00%), Postives = 68/120 (56.67%), Query Frame = 3
Query:  291 LLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            L + L+  W+ YI+     L     +   ++   ++LK DL GA + V KSK  P+ VGL GII+ ETK++F+  + +D  LK++ K   VF ++I D F   I+GS F  +  +R+ +K
Sbjct:   97 LFLPLHELWRQYIRDLCNGL---RPDAQPQMIQNKLLKADLHGALLTVAKSK-CPSYVGLQGIILQETKHVFKFITKDD-KLKTVPKLNCVFSVEI-DGFISYIYGSKFQMRSSERSAKK 210          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Xenopus
Match: pop4 (POP4 homolog, ribonuclease P/MRP subunit [Source:NCBI gene;Acc:550006])

HSP 1 Score: 63.5438 bits (153), Expect = 2.517e-11
Identity = 42/120 (35.00%), Postives = 68/120 (56.67%), Query Frame = 3
Query:  291 LLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            L + L+  W+ YI+     L     +   ++   ++LK DL GA + V KSK  P+ VGL GII+ ETK++F+  + +D  LK++ K   VF ++I D F   I+GS F  +  +R+ +K
Sbjct:  101 LFLPLHELWRQYIRDLCNGL---RPDAQPQMIQNKLLKADLHGALLTVAKSK-CPSYVGLQGIILQETKHVFKFITKDD-KLKTVPKLNCVFSVEI-DGFISYIYGSKFQMRSSERSAKK 214          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Mouse
Match: Pop4 (processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913411])

HSP 1 Score: 73.1738 bits (178), Expect = 6.606e-15
Identity = 57/191 (29.84%), Postives = 102/191 (53.40%), Query Frame = 3
Query:   96 SFIKNYFKEAGSEFTERDGAT------LVFESVXXXXXXXXXXXXXTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            +F++ + K++    ++ D  +      ++ E   R K  P   K+  G+++K++R   +  +   Q     L + L+  W+ YI+     L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++I DDF   I+GS F  +  +R+ +K
Sbjct:   29 AFVRAFLKQSIPHMSQEDCESHLQRKAVILEYFTRLKPRPRPKKKSKGLSAKQRRDMRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCNGL---KPDTQPQMIQAKLLKADLHGAIISVTKSK-CPSYVGVTGILLQETKHVFKIITRED-HLKVIPKLNCVFTIEI-DDFISYIYGSKFQLRASERSAKK 212          
BLAST of Ribonuclease P protein subunit p29 vs. UniProt/SwissProt
Match: sp|Q5M882|RPP29_RAT (Ribonuclease P protein subunit p29 OS=Rattus norvegicus OX=10116 GN=Pop4 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.497e-14
Identity = 57/191 (29.84%), Postives = 103/191 (53.93%), Query Frame = 3
Query:   96 SFIKNYFKEAGSEFTERDGAT------LVFESVXXXXXXXXXXXXXTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            +F++ + K++    +++D  +      ++ E   R K  P   K+  G+++K++R   +  +   Q     L + L+  W+ YI+     L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++I DDF   I+GS F  +  +R+ +K
Sbjct:   29 AFVRAFLKQSIPHMSQQDCESHLQRKAVILEYFTRLKPKPRPKKKSKGLSAKQRRELRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCNGL---KPDTQPQMIQAKLLKADLHGAVISVTKSK-CPSYVGVTGILLQETKHVFKIITKED-HLKVIPKQNCVFTIEI-DDFISYIYGSKFQLRASERSAKK 212          
BLAST of Ribonuclease P protein subunit p29 vs. UniProt/SwissProt
Match: sp|Q9CR08|RPP29_MOUSE (Ribonuclease P protein subunit p29 OS=Mus musculus OX=10090 GN=Pop4 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.621e-14
Identity = 57/191 (29.84%), Postives = 102/191 (53.40%), Query Frame = 3
Query:   96 SFIKNYFKEAGSEFTERDGAT------LVFESVXXXXXXXXXXXXXTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            +F++ + K++    ++ D  +      ++ E   R K  P   K+  G+++K++R   +  +   Q     L + L+  W+ YI+     L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++I DDF   I+GS F  +  +R+ +K
Sbjct:   29 AFVRAFLKQSIPHMSQEDCESHLQRKAVILEYFTRLKPRPRPKKKSKGLSAKQRRDMRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCNGL---KPDTQPQMIQAKLLKADLHGAIISVTKSK-CPSYVGVTGILLQETKHVFKIITRED-HLKVIPKLNCVFTIEI-DDFISYIYGSKFQLRASERSAKK 212          
BLAST of Ribonuclease P protein subunit p29 vs. UniProt/SwissProt
Match: sp|Q2KIB9|RPP29_BOVIN (Ribonuclease P protein subunit p29 OS=Bos taurus OX=9913 GN=POP4 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.756e-12
Identity = 47/144 (32.64%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  219 GINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            G+++K++R   +  +   Q     L + L+  W+ YI+     L     +T  ++   ++LK DL GA + V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++I D F   I+GS F  +  +R+ +K
Sbjct:   75 GLSAKQRRELRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCNGL---KPDTQPQMIQAKLLKADLHGAIVSVTKSK-CPSYVGVTGILLQETKHVFKIITKED-RLKVIPKLNCVFTVEI-DGFISYIYGSKFQLRSSERSAKK 211          
BLAST of Ribonuclease P protein subunit p29 vs. UniProt/SwissProt
Match: sp|Q5R7B0|RPP29_PONAB (Ribonuclease P protein subunit p29 OS=Pongo abelii OX=9601 GN=POP4 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.024e-12
Identity = 47/144 (32.64%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  219 GINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            G++++++R   +  +   Q     L + L+  W+ YI+     L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++I D F   I+GS F  +  +R+ +K
Sbjct:   75 GLSARQRRELRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCNGL---KPDTQPQMIQAKLLKADLHGAIISVTKSK-CPSYVGITGILLQETKHIFKIITKED-RLKVIPKLNCVFTVEI-DGFISYIYGSKFQLRSSERSAKK 211          
BLAST of Ribonuclease P protein subunit p29 vs. UniProt/SwissProt
Match: sp|O95707|RPP29_HUMAN (Ribonuclease P protein subunit p29 OS=Homo sapiens OX=9606 GN=POP4 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 6.448e-12
Identity = 46/144 (31.94%), Postives = 81/144 (56.25%), Query Frame = 3
Query:  219 GINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            G++++++R   +  +   Q     L + L+  W+ YI+   + L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + ED  LK I K   VF ++  D F   I+GS F  +  +R+ +K
Sbjct:   75 GLSARQRRELRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCSGL---KPDTQPQMIQAKLLKADLHGAIISVTKSK-CPSYVGITGILLQETKHIFKIITKED-RLKVIPKLNCVFTVET-DGFISYIYGSKFQLRSSERSAKK 211          
BLAST of Ribonuclease P protein subunit p29 vs. TrEMBL
Match: A7SHU0 (Ribonuclease P protein subunit p29 OS=Nematostella vectensis OX=45351 GN=v1g118883 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.733e-14
Identity = 49/144 (34.03%), Postives = 87/144 (60.42%), Query Frame = 3
Query:  222 INSKKKRSNSINAV-LKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            +++++KR   +  +  +HQ  E  L + L+  W+ Y+Q     +++  +N+N K    ++LK D  G  + V +SK  P+ VG +GIII ET+N+F++ + +D SLK I K  +VF  ++ +DF   I+G+HF F+  +R+ RK
Sbjct:   41 MSAREKREKKVYDIEPEHQRYE--LFLPLHKLWREYMQ----DMLKLQLNSNLKGIYPRLLKADYHGCLVAVCRSK-CPSYVGTTGIIIQETRNVFKIITRDD-SLKMIPKANSVFSFQL-EDFMFKIYGNHFRFRASERSVRK 175          
BLAST of Ribonuclease P protein subunit p29 vs. TrEMBL
Match: A0A0L0CL05 (Ribonuclease P protein subunit p29 OS=Lucilia cuprina OX=7375 GN=FF38_07771 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.760e-12
Identity = 41/131 (31.30%), Postives = 78/131 (59.54%), Query Frame = 3
Query:  297 IELNNFWQTYIQQY----SASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKV-NFPQKFD 674
            + L+  W+ Y++++        +    +      ++ ++K DL GA++ V +SK  P LVGLSGI++L+TKN+ ++   +DC L++I K + VF +K+  + +  IFG H   +P +R+ +K+ NF + F+
Sbjct:   79 LPLHRLWKGYMKEHLGLREGDQVPRVYDAGYDAFSKLLVKTDLHGAKMYVMQSK-CPTLVGLSGIVVLDTKNVLKLLGKDDC-LRTIPKSECVFGMKL-GNMEFTIFGKHLCIRPAERSVKKIKNFIEPFE 206          
BLAST of Ribonuclease P protein subunit p29 vs. TrEMBL
Match: B0W0Q8 (Ribonuclease P, 29kD-subunit OS=Culex quinquefasciatus OX=7176 GN=6031502 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.134e-12
Identity = 46/119 (38.66%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  297 IELNNFWQTYIQQYSASLIRSSINTNSKVT-NEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            I LN  W+ YI +Y        +N    V     ILK+D  GA+I V +SK NP+LVG  GI+IL+TK  F++ S +D  +++I K+ +VFL+   +D Q+ +FG H   +P +R+ +K
Sbjct:  394 IPLNRLWRGYIARYLGKDTLPDVNDAQYVHFVSDILKVDFHGAKISVVRSK-NPSLVGAKGIVILDTKGTFKIVSKDD-KIRTIPKNDSVFLVH-WNDIQLTVFGKHLNTRPAERSVKK 509          
BLAST of Ribonuclease P protein subunit p29 vs. TrEMBL
Match: G3SL27 (Ribonuclease P protein subunit p29 OS=Loxodonta africana OX=9785 GN=POP4 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.185e-12
Identity = 48/144 (33.33%), Postives = 82/144 (56.94%), Query Frame = 3
Query:  219 GINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            G++++++R   +  +   Q     L + L+  W+ YI+     L     +T  ++   ++LK DL GA I V KSK  P+ VG++GI++ ETK++F++ + EDC LK I K   VF ++I D F   I+GS F  +  +R+ +K
Sbjct:   75 GLSARQRRELRLFDIKPEQQ-RYSLFLPLHELWKQYIRDLCNGL---KADTQPQMIQAKLLKADLHGAVISVTKSK-CPSYVGVTGILLQETKHVFKIVTKEDC-LKVIPKLNCVFAVEI-DGFVSYIYGSKFQLRSSERSAKK 211          
BLAST of Ribonuclease P protein subunit p29 vs. TrEMBL
Match: B4KUP9 (Ribonuclease P protein subunit p29 OS=Drosophila mojavensis OX=7230 GN=Dmoj\GI12183 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.008e-11
Identity = 49/166 (29.52%), Postives = 92/166 (55.42%), Query Frame = 3
Query:  225 NSKKKRSNSINAVLKHQSIEKPL------------LIELNNFWQTYIQQYSASLIRSSI-NTNSKVTNE---QILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKV-NFPQKF 671
            +S+K+R++  N++ + +  E  L             + L+  W+ YI+++        +   + K  +E   Q++K+DL GA++ V +SK  P LVGLSGI +++TKN+ ++   ED  +++I K + VF L + D    +IFG H   +P +R+ +K+ N+ + F
Sbjct:   43 HSRKRRAHKSNSLTRREYAELGLNTLPTRQMRYEQALPLHKLWRGYIREHLGLKEGEEVPQLHEKRYDEFSRQLVKMDLHGAKLRVHQSK-CPTLVGLSGICVMDTKNVLKLLG-EDHRVRTIPKSECVFSLHV-DSMDFIIFGQHLNMRPAERSVKKIKNYVEPF 205          
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Nematostella
Match: EDO36711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU0])

HSP 1 Score: 78.9518 bits (193), Expect = 6.546e-18
Identity = 49/144 (34.03%), Postives = 87/144 (60.42%), Query Frame = 3
Query:  222 INSKKKRSNSINAV-LKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRK 650
            +++++KR   +  +  +HQ  E  L + L+  W+ Y+Q     +++  +N+N K    ++LK D  G  + V +SK  P+ VG +GIII ET+N+F++ + +D SLK I K  +VF  ++ +DF   I+G+HF F+  +R+ RK
Sbjct:   41 MSAREKREKKVYDIEPEHQRYE--LFLPLHKLWREYMQ----DMLKLQLNSNLKGIYPRLLKADYHGCLVAVCRSK-CPSYVGTTGIIIQETRNVFKIITRDD-SLKMIPKANSVFSFQL-EDFMFKIYGNHFRFRASERSVRK 175          
BLAST of Ribonuclease P protein subunit p29 vs. Planmine SMEST
Match: SMESG000071391.1 (SMESG000071391.1)

HSP 1 Score: 406.371 bits (1043), Expect = 4.636e-145
Identity = 216/217 (99.54%), Postives = 217/217 (100.00%), Query Frame = 3
Query:   60 MDNSIGQYTTNISFIKNYFKEAGSEFTERDGATLVFESVXXXXXXXXXXXXXTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRVASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNFPQKFDIETEFLISNFHE 710
            MDNSIGQYTTNISFIKNYFKEAGSEFTERDGATLVFESVKRKKKFPLLPKRKTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFR+ASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNFPQKFDIETEFLISNFHE
Sbjct:    1 MDNSIGQYTTNISFIKNYFKEAGSEFTERDGATLVFESVKRKKKFPLLPKRKTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRSSINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFRIASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNFPQKFDIETEFLISNFHE 217          
The following BLAST results are available for this feature:
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
POP41.343e-1231.94POP4 homolog, ribonuclease P/MRP subunit [Source:H... [more]
POP43.721e-938.95POP4 homolog, ribonuclease P/MRP subunit [Source:H... [more]
POP49.014e-932.43POP4 homolog, ribonuclease P/MRP subunit [Source:H... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pop43.179e-1331.82POP4 homolog, ribonuclease P/MRP subunit [Source:Z... [more]
pop43.390e-1332.47POP4 homolog, ribonuclease P/MRP subunit [Source:Z... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pop42.042e-1135.00POP4 homolog, ribonuclease P/MRP subunit [Source:N... [more]
pop42.517e-1135.00POP4 homolog, ribonuclease P/MRP subunit [Source:N... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pop46.606e-1529.84processing of precursor 4, ribonuclease P/MRP fami... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5M882|RPP29_RAT1.497e-1429.84Ribonuclease P protein subunit p29 OS=Rattus norve... [more]
sp|Q9CR08|RPP29_MOUSE4.621e-1429.84Ribonuclease P protein subunit p29 OS=Mus musculus... [more]
sp|Q2KIB9|RPP29_BOVIN3.756e-1232.64Ribonuclease P protein subunit p29 OS=Bos taurus O... [more]
sp|Q5R7B0|RPP29_PONAB4.024e-1232.64Ribonuclease P protein subunit p29 OS=Pongo abelii... [more]
sp|O95707|RPP29_HUMAN6.448e-1231.94Ribonuclease P protein subunit p29 OS=Homo sapiens... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7SHU04.733e-1434.03Ribonuclease P protein subunit p29 OS=Nematostella... [more]
A0A0L0CL051.760e-1231.30Ribonuclease P protein subunit p29 OS=Lucilia cupr... [more]
B0W0Q83.134e-1238.66Ribonuclease P, 29kD-subunit OS=Culex quinquefasci... [more]
G3SL278.185e-1233.33Ribonuclease P protein subunit p29 OS=Loxodonta af... [more]
B4KUP91.008e-1129.52Ribonuclease P protein subunit p29 OS=Drosophila m... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO367116.546e-1834.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribonuclease P protein subunit p29 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071391.14.636e-14599.54SMESG000071391.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000905 ID=SMED30000905|Name=Ribonuclease P protein subunit p29|organism=Schmidtea mediterranea sexual|type=transcript|length=873bp
TTTAAATAATATTTAAATATATATTTATTTTTAATCTTTTATTATATGCT
ATTTTTTCTATGGATAATTCGATAGGTCAATATACAACTAACATAAGTTT
TATCAAAAATTATTTCAAAGAAGCTGGTTCAGAATTCACAGAACGTGATG
GAGCAACTTTAGTTTTTGAATCAGTTAAACGGAAGAAAAAGTTTCCATTG
TTACCAAAAAGAAAAACAGGAATTAATAGTAAGAAAAAAAGATCTAATTC
TATTAATGCTGTTTTAAAGCATCAATCGATTGAGAAACCCTTATTAATAG
AGTTAAACAATTTCTGGCAAACTTATATCCAACAGTATTCTGCATCACTC
ATACGTTCTTCAATAAACACAAATTCCAAAGTTACTAATGAACAAATATT
AAAGTTGGATCTGATTGGAGCAGAAATTATCGTAAAGAAATCCAAGCACA
ACCCAAACTTAGTTGGGCTTTCTGGAATTATTATACTGGAAACTAAAAAT
TTATTTCGAGTCGCATCCATTGAAGATTGTTCTCTGAAGAGTATTCTAAA
AGATAAAGCGGTTTTTCTATTGAAAATTTGTGATGATTTTCAAGTTGTTA
TTTTTGGTAGTCACTTTTTATTCAAACCGAGAGATCGTGCAACTAGAAAA
GTGAATTTCCCACAGAAATTTGATATTGAAACTGAATTTCTAATTAGCAA
TTTTCACGAATGACATTTAATATATTAAATTTGAATTTTGTATATTTTTC
TCAATATTGGAAGTTGTATATCATTGGTTTAAATCCTTGGGATTTGATTG
GTCCCCTTTATAGAAATGTAAATACTGCGTAATTACGATTTTCGGTTAGA
AATGTCGTCACAATAAAGTCAAA
back to top

protein sequence of SMED30000905-orf-1

>SMED30000905-orf-1 ID=SMED30000905-orf-1|Name=SMED30000905-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MDNSIGQYTTNISFIKNYFKEAGSEFTERDGATLVFESVKRKKKFPLLPK
RKTGINSKKKRSNSINAVLKHQSIEKPLLIELNNFWQTYIQQYSASLIRS
SINTNSKVTNEQILKLDLIGAEIIVKKSKHNPNLVGLSGIIILETKNLFR
VASIEDCSLKSILKDKAVFLLKICDDFQVVIFGSHFLFKPRDRATRKVNF
PQKFDIETEFLISNFHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0090501RNA phosphodiester bond hydrolysis
GO:0006364rRNA processing
GO:0006379mRNA cleavage
GO:0008033tRNA processing
GO:0008150biological_process
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036980RNase_P/MRP_p29_sf
IPR002730RNase_P/MRP_p29
IPR023534Rof/RNase_P-like
Vocabulary: cellular component
TermDefinition
GO:0030677ribonuclease P complex
GO:0000172ribonuclease MRP complex
GO:0005575cellular_component
GO:0005634nucleus
GO:0005655nucleolar ribonuclease P complex
GO:0005730nucleolus
Vocabulary: molecular function
TermDefinition
GO:0004540ribonuclease activity
GO:0003723RNA binding
GO:0003674molecular_function
GO:0004526ribonuclease P activity
GO:0016787hydrolase activity
GO:0033204ribonuclease P RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002730Ribonuclease P/MRP, subunit p29SMARTSM00538pop4_2coord: 107..201
e-value: 1.0E-15
score: 68.2
IPR002730Ribonuclease P/MRP, subunit p29PFAMPF01868UPF0086coord: 112..196
e-value: 1.5E-19
score: 69.7
IPR036980Ribonuclease P/MRP, subunit p29 superfamilyGENE3DG3DSA:2.30.30.210coord: 89..199
e-value: 1.3E-19
score: 71.7
NoneNo IPR availablePANTHERPTHR13348RIBONUCLEASE P SUBUNIT P29coord: 48..199
IPR023534Rof/RNase P-likeSUPERFAMILYSSF101744Rof/RNase P subunit-likecoord: 108..198