Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30000893
Length (bp)911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30000893) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30000893) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30000893) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30000893) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000893

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000893h1SMcG0021174 SmedASXL_002393SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30000893h1SMcG0021174 dd_Smed_v4_33456_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000893h1SMcG0021174 dd_Smed_v4_33456_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000893h1SMcG0021174 dd_Smed_v4_33456_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000893h1SMcG0021174 dd_Smed_v6_33456_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX2-4 (NK2 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:7837])

HSP 1 Score: 108.612 bits (270), Expect = 1.174e-26
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  189 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQE 259          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 108.227 bits (269), Expect = 2.404e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 222          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 108.227 bits (269), Expect = 2.404e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 222          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 108.227 bits (269), Expect = 2.404e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 222          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 107.842 bits (268), Expect = 4.282e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  191 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 252          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-24 (Homeobox protein ceh-24 [Source:UniProtKB/Swiss-Prot;Acc:Q9NLC2])

HSP 1 Score: 110.538 bits (275), Expect = 3.468e-28
Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            QRRKRR+LFSQ+QVYELER+FK  KYL+A ER+QLA +I LTP QVKIWFQNHRYKCKR EK+
Sbjct:  149 QRRKRRVLFSQAQVYELERRFKQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKRQEKE 211          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-28 (C. Elegans Homeobox; NK-2 family homeodomain protein CEH-28 [Source:UniProtKB/TrEMBL;Acc:G5EE18])

HSP 1 Score: 91.6633 bits (226), Expect = 5.448e-22
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            Q+RK R+LF+Q QV ELE +FK Q+Y++A+ER++LAQ + LT  QVKIWFQN RYKCKR+ +D
Sbjct:  103 QKRKPRVLFTQHQVNELEERFKKQRYVTATEREELAQCLGLTATQVKIWFQNRRYKCKRLAQD 165          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-27 (C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:Q9XVN4])

HSP 1 Score: 90.1225 bits (222), Expect = 9.283e-22
Identity = 41/62 (66.13%), Postives = 52/62 (83.87%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFS  QV+ LERKF+  +YLSA++R+ LA++INL+  QVKIWFQN RYKCKR EK+
Sbjct:    5 RRKRRVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSATQVKIWFQNQRYKCKRQEKE 66          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-27 (C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:Q9XVN4])

HSP 1 Score: 92.4337 bits (228), Expect = 9.942e-22
Identity = 41/62 (66.13%), Postives = 52/62 (83.87%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFS  QV+ LERKF+  +YLSA++R+ LA++INL+  QVKIWFQN RYKCKR EK+
Sbjct:   98 RRKRRVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSATQVKIWFQNQRYKCKRQEKE 159          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 87.0409 bits (214), Expect = 3.404e-20
Identity = 37/57 (64.91%), Postives = 45/57 (78.95%), Query Frame = 3
Query:  435 ILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            +LF+++Q YELER+F+ QKYLSA ER+ LA  I LTP QVKIWFQNHRYK K+   D
Sbjct:   63 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKKSHTD 119          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0339923)

HSP 1 Score: 112.464 bits (280), Expect = 9.039e-29
Identity = 59/112 (52.68%), Postives = 74/112 (66.07%), Query Frame = 3
Query:  318 SSADNPGYNYDQLMLNSAIG------------SCYF----PLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            S+A++P +   +LM +SA G            +C      PL   F   QRRKRR+LF+Q+QVYELER+FK Q+YLSA ER+ LA  I+LTP QVKIWFQNHRYKCKR  K+
Sbjct:   44 STANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPL--QFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKE 153          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0113751)

HSP 1 Score: 113.235 bits (282), Expect = 4.560e-28
Identity = 59/112 (52.68%), Postives = 74/112 (66.07%), Query Frame = 3
Query:  318 SSADNPGYNYDQLMLNSAIGS------------CYF----PLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            S+A++P +   +LM +SA G+            C      PL   F   QRRKRR+LF+Q+QVYELER+FK Q+YLSA ER+ LA  I+LTP QVKIWFQNHRYKCKR  K+
Sbjct:  205 STANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPL--QFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKE 314          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: vnd (gene:FBgn0261930 transcript:FBtr0070110)

HSP 1 Score: 98.2117 bits (243), Expect = 1.469e-22
Identity = 42/69 (60.87%), Postives = 54/69 (78.26%), Query Frame = 3
Query:  399 SSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            S  L  ++RKRR+LF+++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK KR + +
Sbjct:  538 SDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE 606          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: vnd (gene:FBgn0261930 transcript:FBtr0110929)

HSP 1 Score: 97.0561 bits (240), Expect = 3.249e-22
Identity = 42/69 (60.87%), Postives = 54/69 (78.26%), Query Frame = 3
Query:  399 SSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            S  L  ++RKRR+LF+++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK KR + +
Sbjct:  392 SDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE 460          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: tin (gene:FBgn0004110 transcript:FBtr0084086)

HSP 1 Score: 87.0409 bits (214), Expect = 6.416e-19
Identity = 40/73 (54.79%), Postives = 54/73 (73.97%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLK 638
            +RK R+LFSQ+QV ELE +F+ +KYL+ +ER+ +AQ +NL+  QVKIWFQN RYK KR + D E +    KLK
Sbjct:  301 KRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLK 373          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx2.1 (NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1])

HSP 1 Score: 110.923 bits (276), Expect = 1.025e-27
Identity = 53/78 (67.95%), Postives = 60/78 (76.92%), Query Frame = 3
Query:  372 IGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            +G    PLTS+     RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  147 VGKGMGPLTST----PRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 220          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx2.4a (NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6336])

HSP 1 Score: 107.842 bits (268), Expect = 1.167e-26
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  151 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQE 221          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx2.4a (NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6336])

HSP 1 Score: 107.842 bits (268), Expect = 1.237e-26
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  160 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQE 230          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx2.4b (NK2 homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-000830-1])

HSP 1 Score: 107.071 bits (266), Expect = 1.625e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  147 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKREAKD 208          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 103.99 bits (258), Expect = 8.319e-26
Identity = 49/80 (61.25%), Postives = 62/80 (77.50%), Query Frame = 3
Query:  414 GQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCK--RIEKDME--HMQSQRKLKI 641
            G++RKRR+LFS++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK K  R EK ME  H+ S R++ +
Sbjct:  123 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVAV 202          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000008392.1 (homeobox protein Nkx-2.1-like [Source:NCBI gene;Acc:100485697])

HSP 1 Score: 107.071 bits (266), Expect = 1.026e-26
Identity = 64/151 (42.38%), Postives = 91/151 (60.26%), Query Frame = 3
Query:  231 PTYSNNIKHQQIFSPPYPV--PPYENLAIPS----SSADNPGYNYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHM--QSQRKLKISSNSKK 659
            P+Y +NI++   +     +  PP+  +  PS    S+A   GY     +      S Y   TS      +RKRR+LFSQ+QVYELE++F+HQKYL+A ER+QLA+ I+LTPNQVKIWFQNHRYK KR  ++ + +  +  +   + SN  K
Sbjct:   63 PSYQDNIRNTDWYGGNQDMHYPPFSRIITPSGFNVSTAGCLGY-----LTEGPKHSLYLQHTS------KRKRRVLFSQAQVYELEKRFEHQKYLTAPEREQLAKHIHLTPNQVKIWFQNHRYKMKRQARNHDPLAEEEAKSYSVESNGSK 202          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: fam221a (family with sequence similarity 221 member A [Source:Xenbase;Acc:XB-GENE-1000335])

HSP 1 Score: 107.842 bits (268), Expect = 2.022e-26
Identity = 51/78 (65.38%), Postives = 59/78 (75.64%), Query Frame = 3
Query:  372 IGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            +G    PL ++     RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  150 VGKSMTPLQAT----PRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 223          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:Xenbase;Acc:XB-GENE-1014039])

HSP 1 Score: 107.457 bits (267), Expect = 2.729e-26
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  160 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKVTQQLQQE 230          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: NKX2-2 (NK2 homeobox 2 [Source:NCBI gene;Acc:100038077])

HSP 1 Score: 102.834 bits (255), Expect = 4.114e-25
Identity = 53/117 (45.30%), Postives = 71/117 (60.68%), Query Frame = 3
Query:  414 GQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCK--RIEKDMEHMQSQRKLKISSNSKKNDASIISLNSQRSASSTIPPGSQYSIYGDNNIQ 758
            G++RKRR+LFS++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK K  R EK ME        +++      D         +  ++T P G  +S Y   ++Q
Sbjct:  125 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHTLKAQDLAATFPAGIPFSAYSAQSLQ 241          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: mtm1 (myotubularin 1 [Source:Xenbase;Acc:XB-GENE-1002030])

HSP 1 Score: 96.6709 bits (239), Expect = 4.488e-23
Identity = 44/63 (69.84%), Postives = 52/63 (82.54%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            QRRK R+LFSQ QV+ELER+FK Q+YLSA ER+QLA  + LT  QVKIWFQN RYKCKR ++D
Sbjct:   93 QRRKPRVLFSQMQVFELERRFKQQRYLSAPEREQLALALKLTSTQVKIWFQNRRYKCKRQKQD 155          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx2-4 (NK2 homeobox 4 [Source:MGI Symbol;Acc:MGI:97349])

HSP 1 Score: 110.538 bits (275), Expect = 1.632e-27
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  188 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQE 258          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx2-1 (NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067])

HSP 1 Score: 107.842 bits (268), Expect = 2.197e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 222          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx2-1 (NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067])

HSP 1 Score: 107.842 bits (268), Expect = 2.197e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 222          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx2-2 (NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347])

HSP 1 Score: 104.76 bits (260), Expect = 6.365e-26
Identity = 56/119 (47.06%), Postives = 78/119 (65.55%), Query Frame = 3
Query:  414 GQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCK--RIEKDME--HMQSQRKLKISSNSKKNDASIISLNSQRSASSTIPPGSQYSIYGDNNIQ 758
            G++RKRR+LFS++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK K  R EK ME   + S R++ +     ++     +L +Q  A++T   G  +S Y   ++Q
Sbjct:  126 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLV-RDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQ 243          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx2-2 (NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347])

HSP 1 Score: 97.0561 bits (240), Expect = 2.485e-23
Identity = 42/60 (70.00%), Postives = 51/60 (85.00%), Query Frame = 3
Query:  414 GQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            G++RKRR+LFS++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK KR
Sbjct:  126 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR 185          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q00401|HMH2_GIRTI (Homeobox protein DTH-2 OS=Girardia tigrina OX=6162 GN=DTH-2 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.851e-31
Identity = 77/200 (38.50%), Postives = 107/200 (53.50%), Query Frame = 3
Query:  132 LPGMPSVEPGNDYYSWYQHMGIGLTNSFFPMNCPTYSNNIKHQQIFSPPYPVPPYENLAIPSSSADNPGYNYDQLM------------------------LNSAIG------SCYFPLTSSFLF---GQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            L GM S+ P + Y +  QH G+   +S F      Y +++     +S P     +  +A  ++++++P     +LM                        ++SA+G      + Y    ++  F    QRRKRRILFSQ+Q+YELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR +KD E  Q + K
Sbjct:    7 LAGMSSMSPYSAYAALTQHTGVSSGSSPF---GSQYCSSVNDFNPYSDPRGSNTWYGMAASANASNDPRMTMSRLMGSAAAAASSSMSAYSGIPTNFHQGMHSAMGMASLGAATYDHQKAAMQFNNMSQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKEQQKEK 203          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O17319|HM24_CAEBR (Homeobox protein ceh-24 OS=Caenorhabditis briggsae OX=6238 GN=ceh-24 PE=2 SV=3)

HSP 1 Score: 112.464 bits (280), Expect = 8.420e-28
Identity = 63/124 (50.81%), Postives = 71/124 (57.26%), Query Frame = 3
Query:  276 PYPVPPYENLAIPSSSADNPGYNYDQLMLNS--------------AIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            PYP       A    S   PGYN  Q   N               AI      +   F   QRRKRR+LFSQ+QVYELER+FK  KYL+A ER+QLA +I LTP QVKIWFQNHRYKCKR EK+
Sbjct:   86 PYPA----RFATNCFSGPFPGYNGSQNWYNGNDARFAAAAALLPCAIDPVRSAINHQFSMSQRRKRRVLFSQAQVYELERRFKQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKRQEKE 205          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NLC2|HM24_CAEEL (Homeobox protein ceh-24 OS=Caenorhabditis elegans OX=6239 GN=ceh-24 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.412e-27
Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            QRRKRR+LFSQ+QVYELER+FK  KYL+A ER+QLA +I LTP QVKIWFQNHRYKCKR EK+
Sbjct:  149 QRRKRRVLFSQAQVYELERRFKQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKRQEKE 211          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EQM3|NKX24_MOUSE (Homeobox protein Nkx-2.4 OS=Mus musculus OX=10090 GN=Nkx2-4 PE=2 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.142e-26
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  188 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQE 258          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H2Z4|NKX24_HUMAN (Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 GN=NKX2-4 PE=1 SV=3)

HSP 1 Score: 108.612 bits (270), Expect = 5.636e-26
Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK 632
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    Q Q++
Sbjct:  189 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQE 259          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A2P1DV77 (NK2.1-1 homeobox protein (Fragment) OS=Isodiametra pulchra OX=504439 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.423e-29
Identity = 57/94 (60.64%), Postives = 68/94 (72.34%), Query Frame = 3
Query:  366 SAIGSCYFPLTSSF--------LFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQS 623
            + + S + P+TSSF        L  QRRKRR+LF+Q+QVYELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR  K+    Q+
Sbjct:   13 AGMASSFNPMTSSFSLTDPCKMLASQRRKRRVLFTQAQVYELERRFKTQKYLSAPERETLAHAINLTPTQVKIWFQNHRYKCKRASKERSSNQT 106          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A0Y0HYM7 (Homeodomain protein NK2.1 OS=Leptochiton asellus OX=211853 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.559e-29
Identity = 66/112 (58.93%), Postives = 77/112 (68.75%), Query Frame = 3
Query:  303 LAIPSSSADNP---GYNYDQLMLN----SAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHM 617
            L  PSS A NP   G N+  + L+    + +    FPLT      QRRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR +KD + M
Sbjct:  119 LMGPSSCAMNPMSSGMNHMSMSLSGMDQAKMHGMQFPLT------QRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMINLTPTQVKIWFQNHRYKCKRQQKDKDKM 224          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A267H0L1 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006911g3 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.240e-29
Identity = 66/138 (47.83%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  363 NSAIGSCYFPLTSS--------------------FLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKNDASIISLNSQRSASSTIP 716
            ++++GSCY  + SS                    F   QRRKRR+LF+Q+QVYELER+FK QKYLSA ER+QLAQ INLTP QVKIWFQNHRYKCKR  KD            S N+ K+  S    ++ RS  +  P
Sbjct:  112 SASMGSCYSSMPSSLGMAASMGLGAYDQKAAGMQFPMSQRRKRRVLFTQAQVYELERRFKQQKYLSAPEREQLAQMINLTPTQVKIWFQNHRYKCKRASKDKSGGGGGGGDTSSLNTSKDSNSSSGGHNHRSPKAGGP 249          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1W6AZH9 (Nk2.1 OS=Membranipora membranacea OX=95170 GN=nk2.1 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.441e-28
Identity = 55/73 (75.34%), Postives = 61/73 (83.56%), Query Frame = 3
Query:  405 FLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQS 623
            F   QRRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LAQ INLTP QVKIWFQNHRYKCKR +KD E + S
Sbjct:  178 FPISQRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLAQMINLTPTQVKIWFQNHRYKCKRAQKDKEKVSS 250          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A183A7H9 (Homeobox domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2914 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.709e-28
Identity = 62/105 (59.05%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  396 TSSFL-FGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKND--ASIISLNSQRSA 701
            T+SF    QRRKRR+LF+Q+QVYELER+FK QKYLSA ER+ L+Q INLTP QVKIWFQNHRYKCKR +KD E       L   SNS   D  +++++L+S R+ 
Sbjct:   55 TASFRGLSQRRKRRVLFTQAQVYELERRFKQQKYLSAPEREHLSQIINLTPTQVKIWFQNHRYKCKRAQKDKE----SASLTDHSNSSGVDLRSTVLNLSSDRAT 155          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx2.1 (homeobox protein Nkx-2.1 [Source:NCBI gene;Acc:103043023])

HSP 1 Score: 108.227 bits (269), Expect = 9.469e-27
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  160 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 221          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx2.4b (NK2 homeobox 4 [Source:NCBI gene;Acc:103036401])

HSP 1 Score: 107.457 bits (267), Expect = 9.876e-27
Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK Q+YLSA ER+ LA  I+LTPNQVKIWFQNHRYK KR  KD
Sbjct:  143 RRKRRVLFSQAQVYELERRFKQQRYLSAPEREHLASMIHLTPNQVKIWFQNHRYKMKRQAKD 204          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000002203.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:20913167:20916891:1 gene:ENSAMXG00000002158.2 transcript:ENSAMXT00000002203.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 6.792e-22
Identity = 39/63 (61.90%), Postives = 52/63 (82.54%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            +++KRR+LFS++Q YELER+F+ Q+YLSA ER+ LA+ + LTP QVKIWFQNHRYK KR   +
Sbjct:   16 KKKKRRVLFSKTQTYELERRFRQQRYLSAPEREHLARALRLTPTQVKIWFQNHRYKMKRARTE 78          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx2.5 (homeobox protein Nkx-2.5 [Source:NCBI gene;Acc:103025318])

HSP 1 Score: 92.0485 bits (227), Expect = 4.392e-21
Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            +RRK R+LFSQ+QV ELER+F  Q+YLSA+ER+ LA  + LT  QVKIWFQN RYKCKR
Sbjct:  131 KRRKPRVLFSQAQVCELERRFTQQRYLSAAEREHLAGALRLTSTQVKIWFQNRRYKCKR 189          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx2.3 (NK2 homeobox 3 [Source:NCBI gene;Acc:103034978])

HSP 1 Score: 88.1965 bits (217), Expect = 1.193e-19
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 3
Query:  435 ILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            +LFSQ+QV+ELER+FK Q+YLSA ER+ LA  + LT  QVKIWFQN RYKCKR  +D
Sbjct:  154 VLFSQAQVFELERRFKQQRYLSAPEREHLASALKLTSTQVKIWFQNRRYKCKRQRQD 210          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: nkx2.1 (NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1])

HSP 1 Score: 108.997 bits (271), Expect = 8.877e-29
Identity = 58/97 (59.79%), Postives = 65/97 (67.01%), Query Frame = 3
Query:  315 SSSADNPGYNYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            SS  +  G N    M   A G    PL S+     RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:   10 SSGMNMGGMNAYGGMGGDA-GKVLAPLVST----PRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 101          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005776.1 (pep scaffold:Pmarinus_7.0:GL477528:542110:542457:1 gene:ENSPMAG00000005236.1 transcript:ENSPMAT00000005776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 5.699e-24
Identity = 40/59 (67.80%), Postives = 51/59 (86.44%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            ++RKRR+LFS++Q +ELER+F+HQ+YLSA ER+ LA  + LTP QVKIWFQNHRYK KR
Sbjct:    1 KKRKRRVLFSKAQTFELERRFRHQRYLSAPEREHLASLLKLTPTQVKIWFQNHRYKMKR 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: MSX1 (msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391])

HSP 1 Score: 68.5514 bits (166), Expect = 1.319e-14
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = 3
Query:  423 RKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRI-EKDMEHMQSQRK 632
            RK R  F+ SQ+  LE KF+ ++YLS +ER + + +++LT  QVKIWFQN R K KR+ E ++E ++   K
Sbjct:   15 RKPRTPFTTSQLLALEHKFRQKQYLSIAERAEFSTSLSLTETQVKIWFQNRRAKAKRLQEAELERLKMAAK 85          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: hhex (pep scaffold:Pmarinus_7.0:GL476649:273574:289580:-1 gene:ENSPMAG00000009445.1 transcript:ENSPMAT00000010429.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hhex)

HSP 1 Score: 69.3218 bits (168), Expect = 4.496e-14
Identity = 36/96 (37.50%), Postives = 55/96 (57.29%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKNDASIISLNSQRSAS 704
            +R+  ++ FS  Q  ELERKF+ QKYLS  ER  LA+ + L+  QVK WFQN R K +R+++++    S  K++   +  + D      +  RS S
Sbjct:  142 KRKGGQVRFSSEQTVELERKFERQKYLSPGERKGLAKLLQLSERQVKTWFQNRRAKWRRLKQELP---SDGKVESGESGARADPCGPPSDCSRSDS 234          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: HMX1 (H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5017])

HSP 1 Score: 66.6254 bits (161), Expect = 4.740e-14
Identity = 31/58 (53.45%), Postives = 44/58 (75.86%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            ++K R +FS+SQV++LE  F  ++YLS++ER  LA +++LT  QVKIWFQN R K KR
Sbjct:    1 KKKTRTVFSRSQVFQLESTFDMKRYLSSAERAGLAASLHLTETQVKIWFQNRRNKWKR 58          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO33947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP6])

HSP 1 Score: 94.7449 bits (234), Expect = 9.474e-25
Identity = 43/68 (63.24%), Postives = 58/68 (85.29%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQ 620
            ++RKRRILF++SQ+YELER+F++Q+YLSA ER+QL + INLTP QVKIWFQNHRYK K+   + E+ +
Sbjct:    1 KKRKRRILFTKSQIYELERRFRYQRYLSAPEREQLGRMINLTPTQVKIWFQNHRYKHKKQASEGEYKE 68          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: NK-4 (NK-4 homeobox protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q7YZD1])

HSP 1 Score: 100.138 bits (248), Expect = 1.409e-24
Identity = 45/58 (77.59%), Postives = 50/58 (86.21%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            RRK R+LFSQ+QVYELER+FK QKYLSA ERD LA  + LTPNQVKIWFQN RYKCK+
Sbjct:  155 RRKPRVLFSQAQVYELERRFKGQKYLSAPERDHLASLLKLTPNQVKIWFQNKRYKCKK 212          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO33946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP5])

HSP 1 Score: 95.1301 bits (235), Expect = 2.103e-24
Identity = 41/59 (69.49%), Postives = 53/59 (89.83%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            ++RKRR+LF+++Q YELER+F+ Q+YLSA ER+QLA+ INLTP QVKIWFQNHRYK K+
Sbjct:    6 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREQLARIINLTPTQVKIWFQNHRYKFKK 64          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: NK-2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP7])

HSP 1 Score: 96.2857 bits (238), Expect = 1.134e-23
Identity = 44/84 (52.38%), Postives = 65/84 (77.38%), Query Frame = 3
Query:  342 NYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKR 593
            + +Q  +++  G    P  ++    +++KRRILF++SQ++ELER+F+ QKYLSA+ER+QLA+ I+LTP QVKIWFQNHRYK K+
Sbjct:   65 DREQARVDNGSGLQDVPKFTTSSHVRKKKRRILFTKSQIFELERRFRQQKYLSANEREQLARIIDLTPTQVKIWFQNHRYKFKK 148          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO45871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR7])

HSP 1 Score: 88.9669 bits (219), Expect = 7.154e-23
Identity = 39/57 (68.42%), Postives = 52/57 (91.23%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCK 590
            ++K+RILF++SQ+YELER+F+ Q+YLSA ER+ LA+ I+LTP QVKIWFQNHRYKC+
Sbjct:    1 KKKKRILFTRSQIYELERRFRVQQYLSAPEREHLARMISLTPVQVKIWFQNHRYKCR 57          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000021504.2 (NK2 homeobox 4 [Source:NCBI gene;Acc:101162726])

HSP 1 Score: 111.309 bits (277), Expect = 4.666e-28
Identity = 51/69 (73.91%), Postives = 56/69 (81.16%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQ 626
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTPNQVKIWFQNHRYK KR  KD    Q Q
Sbjct:  158 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLAGLIHLTPNQVKIWFQNHRYKLKRQAKDKAAQQPQ 226          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042590.1 (NK2 homeobox 4 [Source:NCBI gene;Acc:101162726])

HSP 1 Score: 111.694 bits (278), Expect = 4.962e-28
Identity = 51/69 (73.91%), Postives = 56/69 (81.16%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQ 626
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTPNQVKIWFQNHRYK KR  KD    Q Q
Sbjct:  177 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLAGLIHLTPNQVKIWFQNHRYKLKRQAKDKAAQQPQ 245          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx2.1 (NK2 homeobox 1 [Source:NCBI gene;Acc:100049404])

HSP 1 Score: 108.612 bits (270), Expect = 6.900e-27
Identity = 50/70 (71.43%), Postives = 57/70 (81.43%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD---MEHMQ 620
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD    +H+Q
Sbjct:  159 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKASQQHLQ 228          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx2.4a (homeobox protein Nkx-2.4-like [Source:NCBI gene;Acc:101163285])

HSP 1 Score: 107.457 bits (267), Expect = 1.794e-26
Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 3
Query:  420 RRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKD 605
            RRKRR+LFSQ+QVYELER+FK QKYLSA ER+ LA  I+LTP QVKIWFQNHRYK KR  KD
Sbjct:  151 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKD 212          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx2.2a (homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:101157822])

HSP 1 Score: 100.908 bits (250), Expect = 1.180e-24
Identity = 48/79 (60.76%), Postives = 61/79 (77.22%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCK--RIEKDME--HMQSQRKLKI 641
            ++RKRR+LFS++Q YELER+F+ Q+YLSA ER+ LA  I LTP QVKIWFQNHRYK K  R EK ME  H+ S R++ +
Sbjct:  128 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVAV 206          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000062916.1 (SMESG000062916.1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 261/262 (99.62%), Postives = 262/262 (100.00%), Query Frame = 3
Query:   33 MTSKEDLCYGYQQSMDPTQFMTNKWSPLSLETSLPGMPSVEPGNDYYSWYQHMGIGLTNSFFPMNCPTYSNNIKHQQIFSPPYPVPPYENLAIPSSSADNPGYNYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKNDASIISLNSQRSASSTIPPGSQYSIYGDNNIQSTCRPIDEVASTFPFAPSLI 818
            MTSKEDLCYGYQQSMDPTQFMTNKWSPLSLETSLPGMPSVEPGNDYYSWYQHMGIGLTNSFFPMNCPTYSNNIKHQQIFSPPYPVPPYENLAIPSSSADNPGYNYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKNDASIISLNSQRSASSTIPPGSQYSIYGDNNIQS+CRPIDEVASTFPFAPSLI
Sbjct:    1 MTSKEDLCYGYQQSMDPTQFMTNKWSPLSLETSLPGMPSVEPGNDYYSWYQHMGIGLTNSFFPMNCPTYSNNIKHQQIFSPPYPVPPYENLAIPSSSADNPGYNYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKNDASIISLNSQRSASSTIPPGSQYSIYGDNNIQSSCRPIDEVASTFPFAPSLI 262          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000037282.1 (SMESG000037282.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.170e-31
Identity = 83/210 (39.52%), Postives = 107/210 (50.95%), Query Frame = 3
Query:  132 LPGMPSVEPGNDYYSWYQHMGIGLTNSFFPMNCPTYSNNIKHQQIFSPPYPVPPYENLAIPSSSADNPGYNYDQLMLNSAIG-----SCYFPLTSSFLFG----------------------------QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKN 662
            L GM S+ P + Y +  QH G+   +S F      Y +++     +  P     +   +  S+S  +P     +LM  +A       S Y  + S+F  G                            QRRKRRILFSQ+Q+YELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR +KD E  + Q K K S + KKN
Sbjct:    7 LSGMSSMSPYSAYAALTQHTGVSSGSSPF---GSQYCSSVNDFNPYGDPRGTNSWYGTSSLSNSNSDPRMAMSRLMGTAAAAASGNMSVYAGIPSNFHQGMHSAMGISSLGTATYEHQKASIQFNNISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKE--KEQLKEKSSCHLKKN 211          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000037282.1 (SMESG000037282.1)

HSP 1 Score: 119.783 bits (299), Expect = 3.636e-31
Identity = 59/82 (71.95%), Postives = 66/82 (80.49%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKN 662
            QRRKRRILFSQ+Q+YELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR +KD E  + Q K K S + KKN
Sbjct:  123 QRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKE--KEQLKEKSSCHLKKN 202          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000081885.1 (SMESG000081885.1)

HSP 1 Score: 109.383 bits (272), Expect = 4.209e-27
Identity = 70/150 (46.67%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  417 QRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRKLKISSNSKKNDASIISLN----------------SQRSASSTIPPGSQYSIYGDNNIQSTCRPIDEVASTFPFAPSLI 818
            QRR+RRILFSQ+QVYELER+FK QKYLSA ER+ LA  INLTP QVKIWFQNHRYKCKR +KD+E  Q +R++   S       S+ S +                S+ S  S  PP  + S    +N  S  +  D+   TF F+ S++
Sbjct:  130 QRRRRRILFSQAQVYELERRFKQQKYLSAPEREHLASLINLTPTQVKIWFQNHRYKCKRSQKDIEKDQQKREITGMSTVHSPADSVTSADHCDNRHNVCNLFQNQQSKTSGLSASPPIMKISENIPDNSLSQVKVEDQNDMTFAFSKSIL 279          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000079512.1 (SMESG000079512.1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.832e-22
Identity = 45/74 (60.81%), Postives = 56/74 (75.68%), Query Frame = 3
Query:  396 TSSFLFGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRI--EKDME 611
            +SS   G++RKRR+LFS+ Q+ ELER F+ +KYLSA ER+ LA  I L+P QVKIWFQNHRYK KR   EK +E
Sbjct:  358 SSSGDVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 431          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX2-41.174e-2670.42NK2 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:7837][more]
NKX2-12.404e-2677.42NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-12.404e-2677.42NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-12.404e-2677.42NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-14.282e-2677.42NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-243.468e-2877.78Homeobox protein ceh-24 [Source:UniProtKB/Swiss-P... [more]
ceh-285.448e-2261.90C. Elegans Homeobox; NK-2 family homeodomain prote... [more]
ceh-279.283e-2266.13C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:... [more]
ceh-279.942e-2266.13C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:... [more]
ceh-223.404e-2064.91Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scro9.039e-2952.68gene:FBgn0028993 transcript:FBtr0339923[more]
scro4.560e-2852.68gene:FBgn0028993 transcript:FBtr0113751[more]
vnd1.469e-2260.87gene:FBgn0261930 transcript:FBtr0070110[more]
vnd3.249e-2260.87gene:FBgn0261930 transcript:FBtr0110929[more]
tin6.416e-1954.79gene:FBgn0004110 transcript:FBtr0084086[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.11.025e-2767.95NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1][more]
nkx2.4a1.167e-2670.42NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
nkx2.4a1.237e-2670.42NK2 homeobox 4a [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
nkx2.4b1.625e-2677.42NK2 homeobox 4b [Source:ZFIN;Acc:ZDB-GENE-000830-1... [more]
nkx2.2a8.319e-2661.25NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008392.11.026e-2642.38homeobox protein Nkx-2.1-like [Source:NCBI gene;Ac... [more]
fam221a2.022e-2665.38family with sequence similarity 221 member A [Sour... [more]
trpc32.729e-2670.42transient receptor potential cation channel, subfa... [more]
NKX2-24.114e-2545.30NK2 homeobox 2 [Source:NCBI gene;Acc:100038077][more]
mtm14.488e-2369.84myotubularin 1 [Source:Xenbase;Acc:XB-GENE-1002030... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkx2-41.632e-2770.42NK2 homeobox 4 [Source:MGI Symbol;Acc:MGI:97349][more]
Nkx2-12.197e-2677.42NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067][more]
Nkx2-12.197e-2677.42NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067][more]
Nkx2-26.365e-2647.06NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347][more]
Nkx2-22.485e-2370.00NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347][more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00401|HMH2_GIRTI3.851e-3138.50Homeobox protein DTH-2 OS=Girardia tigrina OX=6162... [more]
sp|O17319|HM24_CAEBR8.420e-2850.81Homeobox protein ceh-24 OS=Caenorhabditis briggsae... [more]
sp|Q9NLC2|HM24_CAEEL4.412e-2777.78Homeobox protein ceh-24 OS=Caenorhabditis elegans ... [more]
sp|Q9EQM3|NKX24_MOUSE1.142e-2670.42Homeobox protein Nkx-2.4 OS=Mus musculus OX=10090 ... [more]
sp|Q9H2Z4|NKX24_HUMAN5.636e-2670.42Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P1DV774.423e-2960.64NK2.1-1 homeobox protein (Fragment) OS=Isodiametra... [more]
A0A0Y0HYM78.559e-2958.93Homeodomain protein NK2.1 OS=Leptochiton asellus O... [more]
A0A267H0L19.240e-2947.83Homeobox domain-containing protein OS=Macrostomum ... [more]
A0A1W6AZH91.441e-2875.34Nk2.1 OS=Membranipora membranacea OX=95170 GN=nk2.... [more]
A0A183A7H91.709e-2859.05Homeobox domain-containing protein OS=Echinostoma ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.19.469e-2777.42homeobox protein Nkx-2.1 [Source:NCBI gene;Acc:103... [more]
nkx2.4b9.876e-2777.42NK2 homeobox 4 [Source:NCBI gene;Acc:103036401][more]
ENSAMXT00000002203.26.792e-2261.90pep primary_assembly:Astyanax_mexicanus-2.0:9:2091... [more]
nkx2.54.392e-2167.80homeobox protein Nkx-2.5 [Source:NCBI gene;Acc:103... [more]
nkx2.31.193e-1966.67NK2 homeobox 3 [Source:NCBI gene;Acc:103034978][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.18.877e-2959.79NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1][more]
ENSPMAT00000005776.15.699e-2467.80pep scaffold:Pmarinus_7.0:GL477528:542110:542457:1... [more]
MSX11.319e-1445.07msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391][more]
hhex4.496e-1437.50pep scaffold:Pmarinus_7.0:GL476649:273574:289580:-... [more]
HMX14.740e-1453.45H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339479.474e-2563.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NK-41.409e-2477.59NK-4 homeobox protein; Predicted protein [Source:... [more]
EDO339462.103e-2469.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NK-21.134e-2352.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458717.154e-2368.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021504.24.666e-2873.91NK2 homeobox 4 [Source:NCBI gene;Acc:101162726][more]
ENSORLT00000042590.14.962e-2873.91NK2 homeobox 4 [Source:NCBI gene;Acc:101162726][more]
nkx2.16.900e-2771.43NK2 homeobox 1 [Source:NCBI gene;Acc:100049404][more]
nkx2.4a1.794e-2677.42homeobox protein Nkx-2.4-like [Source:NCBI gene;Ac... [more]
nkx2.2a1.180e-2460.76homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062916.10.000e+099.62SMESG000062916.1[more]
SMESG000037282.11.170e-3139.52SMESG000037282.1[more]
SMESG000037282.13.636e-3171.95SMESG000037282.1[more]
SMESG000081885.14.209e-2746.67SMESG000081885.1[more]
SMESG000079512.18.832e-2260.81SMESG000079512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000893 ID=SMED30000893|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=911bp
TAATTAATTAACAAAGTGTTTTATAATTAGACATGACTAGTAAAGAAGAC
TTATGTTATGGTTATCAACAATCAATGGATCCGACTCAGTTCATGACCAA
CAAATGGAGTCCTTTGTCTCTTGAAACATCTTTGCCAGGAATGCCATCAG
TCGAGCCGGGAAATGATTATTATTCCTGGTATCAGCATATGGGCATAGGA
TTAACCAATAGTTTTTTCCCGATGAACTGCCCAACCTATTCAAATAACAT
CAAACACCAACAGATTTTCTCCCCACCTTACCCAGTACCTCCATACGAGA
ACTTAGCAATTCCCTCCTCATCAGCTGACAATCCTGGATATAATTACGAT
CAATTGATGCTGAATTCTGCAATCGGATCTTGTTATTTCCCACTCACAAG
TTCATTTCTTTTCGGTCAAAGAAGAAAAAGGCGAATTTTGTTTTCTCAAA
GTCAAGTTTATGAACTAGAAAGGAAATTTAAACACCAAAAATATTTATCT
GCTTCTGAAAGGGATCAATTAGCGCAAACGATCAATCTAACTCCGAATCA
AGTTAAGATCTGGTTTCAGAATCACAGATACAAATGCAAACGAATTGAAA
AAGACATGGAACATATGCAGTCACAAAGAAAATTGAAAATTTCCTCGAAT
TCCAAAAAAAACGACGCATCAATTATTTCGTTGAATTCTCAACGATCAGC
ATCCTCCACAATTCCTCCTGGTTCACAATATTCAATTTACGGAGACAACA
ACATCCAATCTACTTGCAGACCCATCGATGAGGTTGCGTCGACTTTTCCA
TTCGCTCCGAGCTTAATTTAGAATTCAATAAAAATTTGAAATTAACTGTG
AATAATTAATTTGTACAATATTAATCAATCTTTCTTTTTGAGATTAAAAG
TTTACCAATGT
back to top

protein sequence of SMED30000893-orf-1

>SMED30000893-orf-1 ID=SMED30000893-orf-1|Name=SMED30000893-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=263bp
MTSKEDLCYGYQQSMDPTQFMTNKWSPLSLETSLPGMPSVEPGNDYYSWY
QHMGIGLTNSFFPMNCPTYSNNIKHQQIFSPPYPVPPYENLAIPSSSADN
PGYNYDQLMLNSAIGSCYFPLTSSFLFGQRRKRRILFSQSQVYELERKFK
HQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRIEKDMEHMQSQRK
LKISSNSKKNDASIISLNSQRSASSTIPPGSQYSIYGDNNIQSTCRPIDE
VASTFPFAPSLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 167..177
score: 54.64
coord: 177..186
score: 69.65
coord: 152..163
score: 37.79
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 130..192
e-value: 1.7E-24
score: 97.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 131..187
e-value: 1.7E-19
score: 69.4
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 128..188
score: 19.872
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 131..189
e-value: 6.42047E-23
score: 86.5284
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 126..193
e-value: 2.9E-23
score: 83.4
NoneNo IPR availablePANTHERPTHR24340FAMILY NOT NAMEDcoord: 109..245
NoneNo IPR availablePANTHERPTHR24340:SF41SCARECROW, ISOFORM Acoord: 109..245
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 163..186
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 116..190