Ribosome biogenesis protein WDR12 homolog

Overview
NameRibosome biogenesis protein WDR12 homolog
Smed IDSMED30000887
Length (bp)1378
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosome biogenesis protein WDR12 homolog (SMED30000887) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosome biogenesis protein WDR12 homolog (SMED30000887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosome biogenesis protein WDR12 homolog (SMED30000887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosome biogenesis protein WDR12 homolog (SMED30000887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000887SMESG000068152.1 SmedASXL_012336SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000887SMESG000068152.1 SmedASXL_012336SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30000887SMESG000068152.1 dd_Smed_v4_8737_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: WDR12 (WD repeat domain 12 [Source:HGNC Symbol;Acc:HGNC:14098])

HSP 1 Score: 73.1738 bits (178), Expect = 2.668e-13
Identity = 65/265 (24.53%), Postives = 115/265 (43.40%), Query Frame = 2
Query:  578 WKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWST-SQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            W+ +++   V      +GH   +  IAV  S     SG  D MLKIWST   +  D   E+   P   K K  +    R P++TL  H E++  + W D E +  +   D +++              +W +   ES +L+      K F  + ++   + +  G +D  +R +D R     + +++  +H   +  VKW+P +    ++ S D   KLWD R+ K+    +    + +   DW+  G LL+    D  L  +R+
Sbjct:  170 WEWNVERNKVKALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPR-KKQKTEQLGLTRTPIVTLSGHMEAVSSVLWSDAE-EICSASWDHTIR--------------VWDV---ESGSLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLS-GGADNKLYSYRY 414          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: APAF1 (apoptotic peptidase activating factor 1 [Source:HGNC Symbol;Acc:HGNC:576])

HSP 1 Score: 54.299 bits (129), Expect = 4.608e-7
Identity = 68/280 (24.29%), Postives = 114/280 (40.71%), Query Frame = 2
Query:  563 GYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKS-------PEA-----IRCCDWSHDGELLAVSYTDGSLKFFRFD 1366
            G +Y    + KN T   +   + HT+ +     S     IAS  +D  L+++          AETG                   LL + AH + + C  +   +   A   +D  VK        I N +T   ++ ++  + +     C F    ++ H  L+  G SD  L+ +D  + K   NT+ G H   +N  +++P +  +  +CS DG  KLWDA +    ++I  K        P+      ++CC WS DG  + V+  +   K F FD
Sbjct:  580 GMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFK---------AETGE-----------------KLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVK--------IWNSMTGELVHTYDEHSEQ--VNCCHFT---NSSHHLLLATGSSDCFLKLWDLNQ-KECRNTMFG-HTNSVNHCRFSP-DDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKN---KIFLFD 814          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: APAF1 (apoptotic peptidase activating factor 1 [Source:HGNC Symbol;Acc:HGNC:576])

HSP 1 Score: 53.9138 bits (128), Expect = 4.989e-7
Identity = 68/280 (24.29%), Postives = 114/280 (40.71%), Query Frame = 2
Query:  563 GYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKS-------PEA-----IRCCDWSHDGELLAVSYTDGSLKFFRFD 1366
            G +Y    + KN T   +   + HT+ +     S     IAS  +D  L+++          AETG                   LL + AH + + C  +   +   A   +D  VK        I N +T   ++ ++  + +     C F    ++ H  L+  G SD  L+ +D  + K   NT+ G H   +N  +++P +  +  +CS DG  KLWDA +    ++I  K        P+      ++CC WS DG  + V+  +   K F FD
Sbjct:  591 GMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFK---------AETGE-----------------KLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVK--------IWNSMTGELVHTYDEHSEQ--VNCCHFT---NSSHHLLLATGSSDCFLKLWDLNQ-KECRNTMFG-HTNSVNHCRFSP-DDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKN---KIFLFD 825          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: APAF1 (apoptotic peptidase activating factor 1 [Source:HGNC Symbol;Acc:HGNC:576])

HSP 1 Score: 51.6026 bits (122), Expect = 3.095e-6
Identity = 64/268 (23.88%), Postives = 109/268 (40.67%), Query Frame = 2
Query:  563 GYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKS-------PEA-----IRCCDWSHDGELLAVS 1330
            G +Y    + KN T   +   + HT+ +     S     IAS  +D  L+++          AETG                   LL + AH + + C  +   +   A   +D  VK        I N +T   ++ ++  + +     C F    ++ H  L+  G SD  L+ +D  + K   NT+ G H   +N  +++P +  +  +CS DG  KLWDA +    ++I  K        P+      ++CC WS DG  + V+
Sbjct:  591 GMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFK---------AETGE-----------------KLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVK--------IWNSMTGELVHTYDEHSEQ--VNCCHFT---NSSHHLLLATGSSDCFLKLWDLNQ-KECRNTMFG-HTNSVNHCRFSP-DDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVA 816          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Match: APAF1 (apoptotic peptidase activating factor 1 [Source:HGNC Symbol;Acc:HGNC:576])

HSP 1 Score: 51.6026 bits (122), Expect = 3.192e-6
Identity = 64/268 (23.88%), Postives = 109/268 (40.67%), Query Frame = 2
Query:  563 GYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKS-------PEA-----IRCCDWSHDGELLAVS 1330
            G +Y    + KN T   +   + HT+ +     S     IAS  +D  L+++          AETG                   LL + AH + + C  +   +   A   +D  VK        I N +T   ++ ++  + +     C F    ++ H  L+  G SD  L+ +D  + K   NT+ G H   +N  +++P +  +  +CS DG  KLWDA +    ++I  K        P+      ++CC WS DG  + V+
Sbjct:  580 GMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFK---------AETGE-----------------KLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVK--------IWNSMTGELVHTYDEHSEQ--VNCCHFT---NSSHHLLLATGSSDCFLKLWDLNQ-KECRNTMFG-HTNSVNHCRFSP-DDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVA 805          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: wdr-12 (Ribosome biogenesis protein WDR12 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91343])

HSP 1 Score: 73.559 bits (179), Expect = 6.601e-14
Identity = 58/259 (22.39%), Postives = 110/259 (42.47%), Query Frame = 2
Query:  590 LKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFD--FREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++   + ++   +GH   +  ++V++      SG  D  LKIW+        + E        K +  K+   ++P++T+  H + +  ++W                   SG   +   D T+   +   +  + RI  P  F  +D +  + L++  C+D   R +D   R+      +  G  +  +  VKWNP++ N FV+ S D   K+WD R+ KS+   +H   + I C  W+    L+A    D ++K F 
Sbjct:  196 IEKGALVEKLILRGHERAVECVSVNSDSTRAISGSVDTNLKIWNLDASDEATTYEKEEEEESAKKRRKKETKTKVPMVTIGGHRDKVSAVEW---------------CPWNSGHAFSCSWDHTIVEWDLELAGEISRIKGPKSFTSIDLHPKSDLLISSCTDAIPRLYDPKNRDGSMVKQSFIGHQNGWVEAVKWNPLDTNQFVSVSTDKTAKMWDVRSSKSSLFDIHGHDDRILCATWNEG--LIATGSADCTIKIFE 437          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: wdr-12 (Ribosome biogenesis protein WDR12 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91343])

HSP 1 Score: 73.559 bits (179), Expect = 6.601e-14
Identity = 58/259 (22.39%), Postives = 110/259 (42.47%), Query Frame = 2
Query:  590 LKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFD--FREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++   + ++   +GH   +  ++V++      SG  D  LKIW+        + E        K +  K+   ++P++T+  H + +  ++W                   SG   +   D T+   +   +  + RI  P  F  +D +  + L++  C+D   R +D   R+      +  G  +  +  VKWNP++ N FV+ S D   K+WD R+ KS+   +H   + I C  W+    L+A    D ++K F 
Sbjct:  196 IEKGALVEKLILRGHERAVECVSVNSDSTRAISGSVDTNLKIWNLDASDEATTYEKEEEEESAKKRRKKETKTKVPMVTIGGHRDKVSAVEW---------------CPWNSGHAFSCSWDHTIVEWDLELAGEISRIKGPKSFTSIDLHPKSDLLISSCTDAIPRLYDPKNRDGSMVKQSFIGHQNGWVEAVKWNPLDTNQFVSVSTDKTAKMWDVRSSKSSLFDIHGHDDRILCATWNEG--LIATGSADCTIKIFE 437          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 54.6842 bits (130), Expect = 1.232e-7
Identity = 55/278 (19.78%), Postives = 104/278 (37.41%), Query Frame = 2
Query:  527 SNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISR-IAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            SNE  +++    GY+  W+ ++ N  +     +  H ++  R +A + +    A+   DG  ++W  ++   +                            L  H   ++CI W          +I +  + T          + +W        A  +       M ++ N++   +L G  D  ++ +D R  K E+ T   AH K +  + W+PI+  +FV+   DG+   W     K    + H   +AI    W   G +LA    D + KF+
Sbjct:  196 SNEQWLLSADQGGYVKYWQPNMNNAHM-----FSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEER--------------------------VLRGHGAEVRCIDW-----HPTKGLIATGSRDTQ-------QPVKIWDPKSGSCLATLQ-EHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMK-EMRTYR-AHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILATGSNDNNTKFW 427          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 51.6026 bits (122), Expect = 8.431e-7
Identity = 32/112 (28.57%), Postives = 53/112 (47.32%), Query Frame = 2
Query: 1022 MVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            M ++ N++   +L G  D  ++ +D R  K E+ T   AH K +  + W+PI+  +FV+   DG+   W     K    + H   +AI    W   G +LA    D + KF+
Sbjct:  102 MAVEFNKNGNWLLTGGRDHLVKMYDIRMMK-EMRTYR-AHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILATGSNDNNTKFW 211          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Match: gad-1 (Gastrulation defective protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16519])

HSP 1 Score: 49.6766 bits (117), Expect = 3.640e-6
Identity = 26/91 (28.57%), Postives = 48/91 (52.75%), Query Frame = 2
Query: 1127 INGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIR------------CCDWSHDGELLAVSYTDGSLKFFRF 1363
            I   H   +N V++NP+N N F++CS DG+ +LW+  + K     ++K  + I+             C +S DG+ +A    DGS++ +++
Sbjct:  219 ITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKVITKCINKHRKVIKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKY 309          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: CG6724 (gene:FBgn0032298 transcript:FBtr0080191)

HSP 1 Score: 86.6557 bits (213), Expect = 4.850e-18
Identity = 87/337 (25.82%), Postives = 158/337 (46.88%), Query Frame = 2
Query:  368 EEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVI---DSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEV--NTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++ V  +K + KW+L    D  +   T+  K +++IS     ++ V+W+S DE++   V  +      ++ W  ++ + +V      KGH   +  ++VS      A+G  D MLK+WS   EL D  A  G       +K  K+  +R P +TL  H ES+  ++W    MDA  ++    D ++K    SL  I  +I+  + + F+++               +++  +LIL   +D  LR +D R  +  V  NT  G H+  +  V W+     +FV+ +YD   KLWD R+ K+    +    E +   DWS+   +++    D +++ F+
Sbjct:  106 DDWVSAVKARGKWILSGCYDNTLNLWTNKGKHILTISGHTAPIKAVDWISLDEETGRFVSTSQDQTAMLWQW--NVGSNSVECVSVCKGHERGVDSVSVSPDGLRFATGSWDTMLKVWSA--ELDD--AVEGS------SKRMKESGVRTPKITLQGHRESVSAVQW----MDATTLLTGSWDHTLKVWDLSLEGIKTEIST-NKSIFDAS---------------YSKLNRLILTASADKNLRLYDPRTNQGSVVRNTYLG-HNAWVQTVMWSTTEEFLFVSGAYDNQNKLWDCRSPKAPLYDLLGHGEKVLDIDWSNPKYIVS-GGVDNTVRVFK 408          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: CG6724 (gene:FBgn0032298 transcript:FBtr0333491)

HSP 1 Score: 82.4185 bits (202), Expect = 1.021e-16
Identity = 85/337 (25.22%), Postives = 156/337 (46.29%), Query Frame = 2
Query:  368 EEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVI---DSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEV--NTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++ V  +K + KW+L    D  +   T+  K +++IS     ++ V+W+S DE++   V  +      ++ W  ++ + +V      KGH   +  ++VS      A+G  D MLK+WS   EL D  A  G    + ++  PK        +TL  H ES+  ++W    MDA  ++    D ++K    SL  I  +I+  + + F+++               +++  +LIL   +D  LR +D R  +  V  NT  G H+  +  V W+     +FV+ +YD   KLWD R+ K+    +    E +   DWS+   +++    D +++ F+
Sbjct:  106 DDWVSAVKARGKWILSGCYDNTLNLWTNKGKHILTISGHTAPIKAVDWISLDEETGRFVSTSQDQTAMLWQW--NVGSNSVECVSVCKGHERGVDSVSVSPDGLRFATGSWDTMLKVWSA--ELDD--AVEGSSKRMKESGTPK--------ITLQGHRESVSAVQW----MDATTLLTGSWDHTLKVWDLSLEGIKTEIST-NKSIFDAS---------------YSKLNRLILTASADKNLRLYDPRTNQGSVVRNTYLG-HNAWVQTVMWSTTEEFLFVSGAYDNQNKLWDCRSPKAPLYDLLGHGEKVLDIDWSNPKYIVS-GGVDNTVRVFK 406          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: Wdr33 (gene:FBgn0046222 transcript:FBtr0078713)

HSP 1 Score: 59.6918 bits (143), Expect = 3.913e-9
Identity = 57/276 (20.65%), Postives = 98/276 (35.51%), Query Frame = 2
Query:  530 NEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            N++ ++ G   GY+  W+ ++ N  +     Y+ H   I  I+ S +     SG  DG L+IW    +      E                        L  H   +KC+ W         +V  S        +    + I L  ++  +ST           M +  N +   ++    D  L+ FD R  + EV    G H K  + V W+PI+  +F +   DG+   W+    K    +       +    W   G +L     D ++KF+
Sbjct:  199 NDSWMVTGDHGGYVKYWQSNMNNVKM-----YQAHKEAIRGISFSPTDSKFVSGSDDGTLRIW----DFMRCQEER----------------------VLRGHGADVKCVHW---HPQKGMIVSGSKDNQQPIKIWDPKSGIALATLHAHKSTV----------MDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRG-HKKEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKEIGCVETAHDSIVWTLAWHPLGHILCSGSNDHTIKFW 429          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: Wdr33 (gene:FBgn0046222 transcript:FBtr0078714)

HSP 1 Score: 59.6918 bits (143), Expect = 3.913e-9
Identity = 57/276 (20.65%), Postives = 98/276 (35.51%), Query Frame = 2
Query:  530 NEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            N++ ++ G   GY+  W+ ++ N  +     Y+ H   I  I+ S +     SG  DG L+IW    +      E                        L  H   +KC+ W         +V  S        +    + I L  ++  +ST           M +  N +   ++    D  L+ FD R  + EV    G H K  + V W+PI+  +F +   DG+   W+    K    +       +    W   G +L     D ++KF+
Sbjct:  199 NDSWMVTGDHGGYVKYWQSNMNNVKM-----YQAHKEAIRGISFSPTDSKFVSGSDDGTLRIW----DFMRCQEER----------------------VLRGHGADVKCVHW---HPQKGMIVSGSKDNQQPIKIWDPKSGIALATLHAHKSTV----------MDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRG-HKKEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKEIGCVETAHDSIVWTLAWHPLGHILCSGSNDHTIKFW 429          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Match: Ciao1 (gene:FBgn0033972 transcript:FBtr0087460)

HSP 1 Score: 50.0618 bits (118), Expect = 2.094e-6
Identity = 54/239 (22.59%), Postives = 93/239 (38.91%), Query Frame = 2
Query:  620 SYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPE------------MDAANVVIDSSVKSTSGSLMTIGNDITL-----WHINGFESTALRRITLPCKFMVMDHNQH------------TQLILIGCSDTRLRCF-DFREAK------HEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLW 1228
            + +GH N++  ++ S S GL+A+   D  + IW  +    D   E   + + P  +D K++ +  P   +LA +     IK    E                + V      +    L++  +D T+     +H       A        K +     QH            T LI   C D  +R F +  ++K       ++    GAHD+ +N V+WNP+     ++CS DG  K+W
Sbjct:   98 TLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAG---DDEFECAAVLN-PHTQDVKRV-VWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDFDADGERLVSCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQHSRAIYDVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWNPVVAGQLISCSDDGTIKIW 331          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:321652])

HSP 1 Score: 87.4261 bits (215), Expect = 3.105e-18
Identity = 79/345 (22.90%), Postives = 151/345 (43.77%), Query Frame = 2
Query:  341 PNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLW--HINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            P  E     ++ +  ++  S+W+L  + D      +   K V++++   D+++ V W+    D   +V++   +   +  W+ + +   V  +   +GH   +  IAV  +R    SG  D MLKIWS      +   E    P   K K  +    R PL+TL  H+E++  + W+D     A+ +  +S   T          I LW     G +ST    ++    F  + ++   + +  G +D  +R +D R     +  ++  +H+  +  V+W P + +  V+ S D   KLWD R+ K+    +    + + C DW+ +G +L+    D  L  +R+
Sbjct:   92 PQPEECIMHDDWISSVEADSEWILTGSYDKTARIWSMEGKAVMTVAGHADVVKDVAWVK--RDGLNSVLLTASLDQTVMLWEWNSERNKVKARHCCRGHAGSVDTIAVDPTRTKFCSGSWDKMLKIWSAVPTEEEDEIEEPNRPR-KKQKTEQMGLTRTPLMTLSGHNEAVSSVLWMD-----ADELCSASWDHT----------IRLWDAETGGQKST----LSGSKVFNCISYSPLCRRLASGSTDRHVRLWDPRSKDGSLVLLSLTSHNGWVTAVRWAPSHEHQLVSGSLDNVVKLWDTRSCKAPLYDLAAHEDKVLCADWTENGLILS-GGADNKLYTYRY 413          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 50.8322 bits (120), Expect = 1.644e-6
Identity = 41/167 (24.55%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  923 SGSLMTIGN---DITLWHINGFEST--ALRRITLPCKFMVMDHNQHT---QLILIGCSDTRLRCFDFREAKHEVNTING-----------AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVH-KSPEAIR----CCDWSHDGELLAVSYTDGSLK 1351
            SG+ +  G    D+  W   G ++   A R +  PC+   +   Q++    +IL+   +++ +  D R+    +  I G            H   +N   W+P     F+TCS DG  + WD  + K  +++   +S +  R    CC +S DG+L+A    DG+++
Sbjct:  138 SGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQ-PCECHQIKALQYSITGDVILVVAGNSQAKVLD-RDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKKHKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQ 302          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 51.2174 bits (121), Expect = 2.012e-6
Identity = 41/167 (24.55%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  923 SGSLMTIGN---DITLWHINGFEST--ALRRITLPCKFMVMDHNQHT---QLILIGCSDTRLRCFDFREAKHEVNTING-----------AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVH-KSPEAIR----CCDWSHDGELLAVSYTDGSLK 1351
            SG+ +  G    D+  W   G ++   A R +  PC+   +   Q++    +IL+   +++ +  D R+    +  I G            H   +N   W+P     F+TCS DG  + WD  + K  +++   +S +  R    CC +S DG+L+A    DG+++
Sbjct:  153 SGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQ-PCECHQIKALQYSITGDVILVVAGNSQAKVLD-RDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKKHKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQ 317          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 51.2174 bits (121), Expect = 2.070e-6
Identity = 41/167 (24.55%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  923 SGSLMTIGN---DITLWHINGFEST--ALRRITLPCKFMVMDHNQHT---QLILIGCSDTRLRCFDFREAKHEVNTING-----------AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVH-KSPEAIR----CCDWSHDGELLAVSYTDGSLK 1351
            SG+ +  G    D+  W   G ++   A R +  PC+   +   Q++    +IL+   +++ +  D R+    +  I G            H   +N   W+P     F+TCS DG  + WD  + K  +++   +S +  R    CC +S DG+L+A    DG+++
Sbjct:  123 SGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQ-PCECHQIKALQYSITGDVILVVAGNSQAKVLD-RDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKKHKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQ 287          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Match: WDR70 (WD repeat domain 70 [Source:NCBI gene;Acc:101884837])

HSP 1 Score: 50.447 bits (119), Expect = 2.753e-6
Identity = 41/167 (24.55%), Postives = 75/167 (44.91%), Query Frame = 2
Query:  923 SGSLMTIGN---DITLWHINGFEST--ALRRITLPCKFMVMDHNQHT---QLILIGCSDTRLRCFDFREAKHEVNTING-----------AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVH-KSPEAIR----CCDWSHDGELLAVSYTDGSLK 1351
            SG+ +  G    D+  W   G ++   A R +  PC+   +   Q++    +IL+   +++ +  D R+    +  I G            H   +N   W+P     F+TCS DG  + WD  + K  +++   +S +  R    CC +S DG+L+A    DG+++
Sbjct:  135 SGARLVTGGYDYDVRFWDFAGMDANLHAFRSLQ-PCECHQIKALQYSITGDVILVVAGNSQAKVLD-RDGFQVLECIKGDQYIVDMANTKGHTAMLNDGCWHPKIKEEFLTCSNDGTVRTWDLTSEKKHKSVFKPRSQQGKRVTPTCCTYSRDGKLIAAGCQDGTIQ 299          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:595016])

HSP 1 Score: 74.3294 bits (181), Expect = 1.425e-18
Identity = 78/348 (22.41%), Postives = 145/348 (41.67%), Query Frame = 2
Query:  332 IKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK--FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            I  P  E     ++ V  +    +W+L  + D      +   K +++I+   + ++ V W+   +DS   ++++  I   +  W+ + +   +      +GH   +  IAV  SR    SG  D MLKIWS      +   E        K K  K    RIP++TL  HSE++  + W D +   +                +  ++I +W +     T   + TL     F  + ++  +Q +  G +D  +R +D R     +   +  +H   +  VKW+P +    V+ S D   KLWD R+ K+    +    + +   DW+  G +L+   +D  L  +R+
Sbjct:   89 ITAPQPEECMMHDDWVSSIAGTEEWILTGSYDKTCRIWSLEGKTIMTITGHTEAVKDVTWVK--KDSLSCLLLSASIDQTIQLWEWNTERNKIKALHCCRGHAGSVDSIAVDASRTKFCSGSWDKMLKIWSAVPSEEEDEYEETSDRPRKKQKTEKMGLTRIPIVTLSGHSEAVSSVLWSDVDEICS---------------ASWDHNIKIWDVE----TGTVKSTLAGNKVFNCISYSPLSQRLASGSTDRHIRLWDPRSKDGSLVLCSLTSHTGWVTSVKWSPSHEQQLVSGSLDKLVKLWDTRSCKAPLYDLAAHSDKVLSVDWTDAGLILS-GGSDNKLYSYRY 414          

HSP 2 Score: 38.891 bits (89), Expect = 1.425e-18
Identity = 22/72 (30.56%), Postives = 37/72 (51.39%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   KY V+  P   P +   V L+  +  LL+    D K V+F+F +  + +  PL   +E +GIS
Sbjct:    5 QARFFTEEEKYKVDDVPFSIPATSEIVDLSNLINKLLETKNGDHKPVEFDFLVKSQFLRMPLIKHMEAEGIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:595016])

HSP 1 Score: 74.3294 bits (181), Expect = 1.475e-17
Identity = 78/348 (22.41%), Postives = 145/348 (41.67%), Query Frame = 2
Query:  332 IKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK--FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            I  P  E     ++ V  +    +W+L  + D      +   K +++I+   + ++ V W+   +DS   ++++  I   +  W+ + +   +      +GH   +  IAV  SR    SG  D MLKIWS      +   E        K K  K    RIP++TL  HSE++  + W D +   +                +  ++I +W +     T   + TL     F  + ++  +Q +  G +D  +R +D R     +   +  +H   +  VKW+P +    V+ S D   KLWD R+ K+    +    + +   DW+  G +L+   +D  L  +R+
Sbjct:   87 ITAPQPEECMMHDDWVSSIAGTEEWILTGSYDKTCRIWSLEGKTIMTITGHTEAVKDVTWVK--KDSLSCLLLSASIDQTIQLWEWNTERNKIKALHCCRGHAGSVDSIAVDASRTKFCSGSWDKMLKIWSAVPSEEEDEYEETSDRPRKKQKTEKMGLTRIPIVTLSGHSEAVSSVLWSDVDEICS---------------ASWDHNIKIWDVE----TGTVKSTLAGNKVFNCISYSPLSQRLASGSTDRHIRLWDPRSKDGSLVLCSLTSHTGWVTSVKWSPSHEQQLVSGSLDKLVKLWDTRSCKAPLYDLAAHSDKVLSVDWTDAGLILS-GGSDNKLYSYRY 412          

HSP 2 Score: 35.4242 bits (80), Expect = 1.475e-17
Identity = 19/63 (30.16%), Postives = 32/63 (50.79%), Query Frame = 1
Query:   64 KYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            +Y V+  P   P +   V L+  +  LL+    D K V+F+F +  + +  PL   +E +GIS
Sbjct:   12 EYKVDDVPFSIPATSEIVDLSNLINKLLETKNGDHKPVEFDFLVKSQFLRMPLIKHMEAEGIS 74          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:595016])

HSP 1 Score: 73.9442 bits (180), Expect = 1.160e-13
Identity = 64/265 (24.15%), Postives = 110/265 (41.51%), Query Frame = 2
Query:  578 WKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK--FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            W+ + +   +      +GH   +  IAV  SR    SG  D MLKIWS      +   E        K K  K    RIP++TL  HSE++  + W D +   +                +  ++I +W +     T   + TL     F  + ++  +Q +  G +D  +R +D R     +   +  +H   +  VKW+P +    V+ S D   KLWD R+ K+    +    + +   DW+  G +L+   +D  L  +R+
Sbjct:  130 WEWNTERNKIKALHCCRGHAGSVDSIAVDASRTKFCSGSWDKMLKIWSAVPSEEEDEYEETSDRPRKKQKTEKMGLTRIPIVTLSGHSEAVSSVLWSDVDEICS---------------ASWDHNIKIWDVE----TGTVKSTLAGNKVFNCISYSPLSQRLASGSTDRHIRLWDPRSKDGSLVLCSLTSHTGWVTSVKWSPSHEQQLVSGSLDKLVKLWDTRSCKAPLYDLAAHSDKVLSVDWTDAGLILS-GGSDNKLYSYRY 374          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:595016])

HSP 1 Score: 58.151 bits (139), Expect = 1.348e-12
Identity = 77/354 (21.75%), Postives = 144/354 (40.68%), Query Frame = 2
Query:  332 IKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRG------LIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK--FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            I  P  E     ++ V  +    +W+L  + D      +   K +++I+   + ++ V W+   +DS   ++++  I   +  W+ + +   +      +GH   +  IAV  SR        I  GC      ++S   E  D   ET   P   K K  K    RIP++TL  HSE++  + W D +   +                +  ++I +W +     T   + TL     F  + ++  +Q +  G +D  +R +D R     +   +  +H   +  VKW+P +    V+ S D   KLWD R+ K+    +    + +   DW+ D  L+    +D  L  +R+
Sbjct:   87 ITAPQPEECMMHDDWVSSIAGTEEWILTGSYDKTCRIWSLEGKTIMTITGHTEAVKDVTWVK--KDSLSCLLLSASIDQTIQLWEWNTERNKIKALHCCRGHAGSVDSIAVDASRTKCFSPPFIHLGC------LFSVPSEEEDEYEETSDRPR-KKQKTEKMGLTRIPIVTLSGHSEAVSSVLWSDVDEICS---------------ASWDHNIKIWDVE----TGTVKSTLAGNKVFNCISYSPLSQRLASGSTDRHIRLWDPRSKDGSLVLCSLTSHTGWVTSVKWSPSHEQQLVSGSLDKLVKLWDTRSCKAPLYDLAAHSDKVLSVDWT-DAGLILSGGSDNKLYSYRY 411          

HSP 2 Score: 35.039 bits (79), Expect = 1.348e-12
Identity = 19/62 (30.65%), Postives = 31/62 (50.00%), Query Frame = 1
Query:   67 YAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            Y V+  P   P +   V L+  +  LL+    D K V+F+F +  + +  PL   +E +GIS
Sbjct:   13 YKVDDVPFSIPATSEIVDLSNLINKLLETKNGDHKPVEFDFLVKSQFLRMPLIKHMEAEGIS 74          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Match: THOC3 (THO complex 3 [Source:NCBI gene;Acc:100490375])

HSP 1 Score: 51.9878 bits (123), Expect = 1.041e-6
Identity = 28/73 (38.36%), Postives = 39/73 (53.42%), Query Frame = 2
Query: 1136 AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKF 1354
             H   ++ + W+P NP++FVT S D   ++WD RN K    I  K  E I  C WS DG+ +AV   D  + F
Sbjct:  110 GHGDSVDQLCWHPYNPDLFVTASGDKTIRIWDVRNEKCISTISTKG-ENINIC-WSPDGQTIAVGNKDDVVTF 180          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr12 (WD repeat domain 12 [Source:MGI Symbol;Acc:MGI:1927241])

HSP 1 Score: 78.1814 bits (191), Expect = 3.854e-15
Identity = 75/333 (22.52%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  341 PNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKI--PIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLA 1324
            P  E     ++ +  ++   +W+L  + D      +   K +++I    D+++ V W+   +DS   +++   +   +  W+ +++   V      +GH   +  IAV +S     SG  D MLKIWST    TD   E     + P+ K   +     R PL+TL  H+E++  + W D E +  +   D +++              +W +   ES  L+      K F  + ++   + +  G +D  +R +D R     + +++  +H   +  VKW+P +    ++ S D   KLWD R+ K+    +    + +   DW+  G LL+
Sbjct:   92 PQPEQCMFHDDWISSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVK--KDSLSCLLLTASMDQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVP--TDEEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAE-EICSASWDHTIR--------------VWDV---ESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLS 402          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr12 (WD repeat domain 12 [Source:MGI Symbol;Acc:MGI:1927241])

HSP 1 Score: 78.1814 bits (191), Expect = 3.854e-15
Identity = 75/333 (22.52%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  341 PNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKI--PIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLA 1324
            P  E     ++ +  ++   +W+L  + D      +   K +++I    D+++ V W+   +DS   +++   +   +  W+ +++   V      +GH   +  IAV +S     SG  D MLKIWST    TD   E     + P+ K   +     R PL+TL  H+E++  + W D E +  +   D +++              +W +   ES  L+      K F  + ++   + +  G +D  +R +D R     + +++  +H   +  VKW+P +    ++ S D   KLWD R+ K+    +    + +   DW+  G LL+
Sbjct:   92 PQPEQCMFHDDWISSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVK--KDSLSCLLLTASMDQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVP--TDEEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAE-EICSASWDHTIR--------------VWDV---ESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLS 402          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Wdr12 (WD repeat domain 12 [Source:MGI Symbol;Acc:MGI:1927241])

HSP 1 Score: 78.1814 bits (191), Expect = 3.854e-15
Identity = 75/333 (22.52%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  341 PNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKI--PIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLA 1324
            P  E     ++ +  ++   +W+L  + D      +   K +++I    D+++ V W+   +DS   +++   +   +  W+ +++   V      +GH   +  IAV +S     SG  D MLKIWST    TD   E     + P+ K   +     R PL+TL  H+E++  + W D E +  +   D +++              +W +   ES  L+      K F  + ++   + +  G +D  +R +D R     + +++  +H   +  VKW+P +    ++ S D   KLWD R+ K+    +    + +   DW+  G LL+
Sbjct:   92 PQPEQCMFHDDWISSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVK--KDSLSCLLLTASMDQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVP--TDEEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAE-EICSASWDHTIR--------------VWDV---ESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLS 402          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Match: Thoc3 (THO complex 3 [Source:MGI Symbol;Acc:MGI:1920916])

HSP 1 Score: 49.6766 bits (117), Expect = 4.125e-6
Identity = 27/73 (36.99%), Postives = 39/73 (53.42%), Query Frame = 2
Query: 1136 AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKF 1354
             H   ++ + W+P NP++FVT S D   ++WD R  K   A V+   E I  C WS DG+ +AV   D  + F
Sbjct:   97 GHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCI-ATVNTKGENINIC-WSPDGQTIAVGNKDDVVTF 167          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|Q7QJ33|WDR12_ANOGA (Ribosome biogenesis protein WDR12 homolog OS=Anopheles gambiae OX=7165 GN=AGAP007244 PE=3 SV=3)

HSP 1 Score: 92.4337 bits (228), Expect = 7.710e-23
Identity = 83/334 (24.85%), Postives = 150/334 (44.91%), Query Frame = 2
Query:  368 EEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHE--VNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++ V  ++ K  W+L  T D  +    +  K  ++I      ++ V W+S +E +   V  +      +  W+ ++   T       KGH   +  IAV+ ++  +ASG  D MLKIWST     +L A+ G  P   K    ++  +R P++TL  H E +  ++W+D     A    D ++K    S+  I  + T     G +S           F  + ++    +I+    D  LR +D R +KH   V      H + +   +W+  N  +FV+ +YD   KLWD R+ K+    +    + +  CDWS+   +L+   +D +++ F+
Sbjct:  111 DDWVSAVQAKDGWILTGTYDNTVNLWNTKGKHKLTIPGHVAAVKGVAWISLNEQT--GVFASASHDQTIMIWEWNMTTNTAECVHVCKGHERGVGCIAVNPAKTQMASGSMDTMLKIWST-----ELQADKGE-PSATKKAKLEQDNVRTPVVTLAGHREFVSGVQWID-NTTIATCSWDHTIKLWDLSMGGIKTEFT-----GNKS-----------FFDLSYSPLNGMIITASPDKNLRLYDPR-SKHGNFVKNTYLGHSQWVQTCRWSTTNEYLFVSGAYDNRVKLWDYRSPKAPIFELIGHEDKVLACDWSNPKYILSGG-SDNAVRVFK 417          

HSP 2 Score: 37.3502 bits (85), Expect = 7.710e-23
Identity = 23/71 (32.39%), Postives = 35/71 (49.30%), Query Frame = 1
Query:   43 RFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNG-IDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
             FT+   +YAV   P     + G  +LN  + ++LKD G      V F+F +NGE +   L   L+ + IS
Sbjct:   16 HFTTKQKQYAVPDVPYSIRANVGCSELNTLLGTVLKDAGNKQGAKVAFDFLLNGEFVRSTLSQHLKERDIS 86          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|Q17BB0|WDR12_AEDAE (Ribosome biogenesis protein WDR12 homolog OS=Aedes aegypti OX=7159 GN=AAEL005041 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.054e-22
Identity = 86/336 (25.60%), Postives = 152/336 (45.24%), Query Frame = 2
Query:  368 EEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHI--NGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEV--NTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++ V  ++ K  W+L    D  +   T+  K  ++I      ++ V W+S DE+  + V  +      +  W+ ++K  +V      KGH   +  IA + S+  +A+G  D MLKIWST     D+  +    P   K +       R P+LTL  H E +  ++W+D      N ++ SS   T          I +W +  +G +S     I     F  + ++    LI+    D  LR +D +  +  +  NT  G H + +  V+W+  N  +FV+ +YD   KLWD R+ K+    +    + +  CDWS+   +L+   +D S++ F+
Sbjct:  111 DDWVSAVEAKDNWILTGCYDNTLNIWTTKGKHKLTIPGHIAPVKGVTWISLDEE--KGVFASASQDQTVMLWEWNVKANSVECVQVCKGHERGVDCIAANRSKTRMATGSWDTMLKIWST-----DVRNDGDSQPSTSKRQKLDTEKARTPVLTLAGHRECISGVQWIDD-----NTLVTSSWDHT----------IKIWDLALSGIKS----EICGHKSFFDLSYSHLNGLIIAASPDKNLRLYDPKSNQGTIVKNTYLG-HTQWVQSVRWSTTNEYLFVSGAYDNHVKLWDYRSPKAPIFELIGHEDKVLACDWSNPKFILS-GGSDNSVRVFK 418          

HSP 2 Score: 35.8094 bits (81), Expect = 1.054e-22
Identity = 21/64 (32.81%), Postives = 35/64 (54.69%), Query Frame = 1
Query:   64 KYAVESEPIVFPISFGPVQLNKTVKSLLKDNG-IDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++AV   P     +    +LN  + +LLKD+G  +   V+F+F +NGE +  PL   L+ + IS
Sbjct:   23 QFAVPDVPYSIRANVSNKELNVLINTLLKDSGNSEAGKVEFDFLLNGEFVKIPLGQHLKEREIS 86          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|P61480|WDR12_RAT (Ribosome biogenesis protein WDR12 OS=Rattus norvegicus OX=10116 GN=Wdr12 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.779e-20
Identity = 81/346 (23.41%), Postives = 150/346 (43.35%), Query Frame = 2
Query:  341 PNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIP--IRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            P  E     ++ +  +K   +W+L  + D      +   K +++I    D+++ V W+   +DS   +++   +   +  W+ +++   V      +GH   +  IAV +S     SG  D MLKIWST    TD   E     + P+ K   +     R PL+TL  H+E++  + W D     A+ V  +S   T          + +W +   ES  L+      K F  + ++   + +  G +D  +R +D R     + +++  +H   +  VKW+P +    ++ S D   KLWD R+ K+    +    + +   DW+  G LL+    D  L  +R+
Sbjct:   92 PQPEQCMFHDDWISSIKGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVK--KDSLSCLLLTASMDQTILLWEWNIERNKVKALHCCRGHAGSVDAIAVDSSGTKFCSGSWDKMLKIWSTVP--TDEEDEIQEPTNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSD-----ADEVCSASWDHT----------VRVWDV---ESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKWSPTHDQQLISGSLDNMVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLS-GGADNKLYSYRY 414          

HSP 2 Score: 40.817 bits (94), Expect = 1.779e-20
Identity = 23/72 (31.94%), Postives = 38/72 (52.78%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   KYAV+  P   P +     L+  +  LL+      K+V+F+F I G+ +  PL   +EL+ IS
Sbjct:    5 QARFYTENKKYAVDDVPFSIPATSEVADLSNIINKLLETKNELHKHVEFDFLIKGQFLRMPLVKHMELEDIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|B4MU54|WDR12_DROWI (Ribosome biogenesis protein WDR12 homolog OS=Drosophila willistoni OX=7260 GN=GK23981 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.008e-20
Identity = 82/338 (24.26%), Postives = 149/338 (44.08%), Query Frame = 2
Query:  368 EEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITL--WHIN--GFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEV--NTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            ++ V  +K   KW+L    D  +   T   K +++I      ++ V+W+S D D    V  +      ++ W  D  +  V      KGH   +  I+VS      A+G  D MLK+WS +++      + GG      +K PK+  +R P++TL  H ES+  ++W+D                 + +L+T   D T+  W ++  G ++     I+         ++   +LI+   +D  LR +D R  +  +  NT  G H+  +  V W+     +FV+ +YD   KLWD R+ K+    +    E +   DWS + + +     D +++ F+
Sbjct:  107 DDWVSAVKVSGKWILTGCYDNTLNIWTHKGKHILTIPGHTAPIKAVDWISLDNDIGRFVSSSQDQTVMLWQWNVD--SNAVECVSICKGHERGVDSISVSPDATRFATGSWDTMLKVWSAAED------DAGG--DAASSKRPKENGVRTPIMTLQGHRESISAVQWID-----------------TSTLLTTSWDHTMKIWDLSLEGIKT----EISTNKSIFDASYSNLNRLIVTASADKNLRLYDPRTNQGSIVRNTYLG-HNAWVQTVMWSTTEEFLFVSGAYDNQNKLWDCRSPKAPLYDLLGHGEKVLDIDWS-NPKYICSGGADNTVRVFK 411          

HSP 2 Score: 31.5722 bits (70), Expect = 5.008e-20
Identity = 19/63 (30.16%), Postives = 30/63 (47.62%), Query Frame = 1
Query:   64 KYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
             YAV   P     +   V+LN  + +LL++   D   + F+F +  E +   L D L+ K IS
Sbjct:   20 HYAVPDVPYAIDGTMTTVELNTFLNALLRNKSGDESAIDFDFLVFDEYLRGRLCDHLKEKAIS 82          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Match: sp|B0W517|WDR12_CULQU (Ribosome biogenesis protein WDR12 homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ001500 PE=3 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 3.058e-19
Identity = 78/291 (26.80%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  500 VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHI--NGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEV--NTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFR 1360
            V W+S DE+  + V  +      +  W+ ++   +V      KGH   +  IA + S+  +A+G  D MLKIWST        +E    P   K +   +   R PL+TL  H E +  ++W+D      N ++ SS   T          I +W +  NG +S     I+    F  + +++   LI+    D  LR +D +  +  +  NT  G H + +  V+W+  N  +FV+ +YD   KLWD R+ K+    +    + +  CDWS+   +L+   +D S++ F+
Sbjct:  153 VTWISLDEE--KGVFASASQDQTVMLWEWNVAANSVECVQVCKGHERGVDCIAANGSKTKMATGSWDTMLKIWSTDVRSGGGDSE----PSTSKRQKLDQGSARTPLMTLAGHRECISGVQWIDD-----NTLVTSSWDHT----------IKIWDLALNGIKS----EISGNKSFFDLSYSKLNGLIITASPDKNLRLYDPKSNQGTLVKNTYLG-HTQWVQSVRWSTTNEYLFVSGAYDNHVKLWDYRSPKAPIFELIGHEDKVLACDWSNPRFILS-GGSDNSVRVFK 416          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A5J4N915 (Ribosome biogenesis protein YTM1 OS=Paragonimus westermani OX=34504 GN=DEA37_0008293 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.693e-30
Identity = 107/370 (28.92%), Postives = 165/370 (44.59%), Query Frame = 2
Query:  320 YDIDIKPPNLENETKFEEQVYGMKFKSKWLLCAT--GDLEIIDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIA------VSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITL--WHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWS---HDG--------ELLAVSYTDGSLKFFRF 1363
            Y +  + P        E+ +  +K    ++L  +  G ++I  + +P K + SI  +  +  VEWL+ D D  +A    GG       W  ++K  T T     +GH+  +  IA      V     L ASG  DG +K+WS S + TDLS ETGGI H  K+ +  KIP RIP +T+  H E++  + WL       +     S  +    L+++  D TL  W       + LR I       + D +   Q IL   SD R+R +D R A+  +  I    H   +  V W P   N FVT S D + +LWD RN +++   +    + +   DW+   H G          +  S  DGS+K +R+
Sbjct:   85 YCVKQQAPTYVAGIDQEDLISSVKRYKDYVLTGSYDGTVQIWTAETP-KQLQSIQLEDRVKCVEWLTVDSD--QATFATGGFDQTAQIWVWNIKTNTTTCAAVCRGHSETVMTIAAQPVSAVGVDSQLFASGSWDGTIKLWSASAKETDLSEETGGIVHTRKSTN--KIPTRIPRVTMAGHRETVTRVCWLPVSSSYTSNTDRPSGSAVHSQLLSVSWDHTLRVWECQSGAGSELRSIV--SSHAIHDADAALQGILTASSDNRVRIYDLR-AREALALIGFHGHTAWLTSVAWAPHRDNQFVTGSIDRSVRLWDTRNTRASLYDLMGHTDMVTDVDWAAPIHTGTGKAEDARHYILSSSADGSVKIYRY 446          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A4S2LAN3 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009900 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.004e-28
Identity = 103/367 (28.07%), Postives = 163/367 (44.41%), Query Frame = 2
Query:  335 KPPNLENETKFEEQVYGMKFKSKWLLCAT--GDLEIIDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRG-----LIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITL--WHINGFESTALRRITLPCKFMVMDH-----NQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDW---------SHDGELLAVSYTDGSLKFFRF 1363
            + P+   E K ++ +  +K K   +L  +  G +++    +P KP+ S+  D  +  VEWL+ DE  ++A  + GG       W  D K+  VT     +GH+  +   A   S       + A+G  DG +K+WS S + TDLS ETGGI H    K   K P RIP LTL  H E++  + WL P +       + S   ++  L+++  D TL  W     +           + +V  H     +   Q IL   SD R+R +D R A+  +  I    H   +  + W P   N FVT S D + +LWD RN K++   +    + +   DW         S     +  S  DG++K + +
Sbjct:   89 RAPSFSGEIKQDDLISSVKRKGDLVLTGSYDGTVQLWTVENP-KPIFSLELDEKVKCVEWLALDE--HQATFVTGGFDQTAQLWVHDRKSNEVTCVAVCRGHSETVMTAAALFSDSNCEPCVFATGSWDGTIKLWSASPKATDLSEETGGIAHT--RKSTSKTPTRIPRLTLAGHRETITRVCWL-PTLPTD----EKSSTPSNPKLISVSWDHTLRVWDCQVGQPQQQNTGGSEVRCIVSSHAINDADATLQGILTASSDNRVRMYDLR-AREALALIGFPGHTAWLTAISWAPHRDNHFVTGSIDRSVRLWDTRNPKASLYDLMGHTDMVTDVDWAAPLIRHQPSDRRHYILSSSADGTVKIYNY 444          

HSP 2 Score: 35.8094 bits (81), Expect = 1.004e-28
Identity = 20/61 (32.79%), Postives = 31/61 (50.82%), Query Frame = 1
Query:   67 YAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGI 249
            Y+V S PI    S   V+LN  + +LL++        +F F INGE ++  + D L  + I
Sbjct:   15 YSVPSTPITLAASSSSVELNGLLFNLLEETQACLAKTEFVFLINGEYLNGSVGDHLSERQI 75          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A4S2LAW1 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009900 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.004e-28
Identity = 103/367 (28.07%), Postives = 163/367 (44.41%), Query Frame = 2
Query:  335 KPPNLENETKFEEQVYGMKFKSKWLLCAT--GDLEIIDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRG-----LIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITL--WHINGFESTALRRITLPCKFMVMDH-----NQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDW---------SHDGELLAVSYTDGSLKFFRF 1363
            + P+   E K ++ +  +K K   +L  +  G +++    +P KP+ S+  D  +  VEWL+ DE  ++A  + GG       W  D K+  VT     +GH+  +   A   S       + A+G  DG +K+WS S + TDLS ETGGI H    K   K P RIP LTL  H E++  + WL P +       + S   ++  L+++  D TL  W     +           + +V  H     +   Q IL   SD R+R +D R A+  +  I    H   +  + W P   N FVT S D + +LWD RN K++   +    + +   DW         S     +  S  DG++K + +
Sbjct:   80 RAPSFSGEIKQDDLISSVKRKGDLVLTGSYDGTVQLWTVENP-KPIFSLELDEKVKCVEWLALDE--HQATFVTGGFDQTAQLWVHDRKSNEVTCVAVCRGHSETVMTAAALFSDSNCEPCVFATGSWDGTIKLWSASPKATDLSEETGGIAHT--RKSTSKTPTRIPRLTLAGHRETITRVCWL-PTLPTD----EKSSTPSNPKLISVSWDHTLRVWDCQVGQPQQQNTGGSEVRCIVSSHAINDADATLQGILTASSDNRVRMYDLR-AREALALIGFPGHTAWLTAISWAPHRDNHFVTGSIDRSVRLWDTRNPKASLYDLMGHTDMVTDVDWAAPLIRHQPSDRRHYILSSSADGTVKIYNY 435          

HSP 2 Score: 35.8094 bits (81), Expect = 1.004e-28
Identity = 20/62 (32.26%), Postives = 31/62 (50.00%), Query Frame = 1
Query:   64 KYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGI 249
             Y+V S PI    S   V+LN  + +LL++        +F F INGE ++  + D L  + I
Sbjct:    5 SYSVPSTPITLAASSSSVELNGLLFNLLEETQACLAKTEFVFLINGEYLNGSVGDHLSERQI 66          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A4S2L5R8 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009900 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.434e-28
Identity = 98/338 (28.99%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  335 KPPNLENETKFEEQVYGMKFKSKWLLCAT--GDLEIIDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRG-----LIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITL--WHINGFESTALRRITLPCKFMVMDH-----NQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWS 1303
            + P+   E K ++ +  +K K   +L  +  G +++    +P KP+ S+  D  +  VEWL+ DE  ++A  + GG       W  D K+  VT     +GH+  +   A   S       + A+G  DG +K+WS S + TDLS ETGGI H    K   K P RIP LTL  H E++  + WL P +       + S   ++  L+++  D TL  W     +           + +V  H     +   Q IL   SD R+R +D R A+  +  I    H   +  + W P   N FVT S D + +LWD RN K++   +    + +   DW+
Sbjct:   89 RAPSFSGEIKQDDLISSVKRKGDLVLTGSYDGTVQLWTVENP-KPIFSLELDEKVKCVEWLALDE--HQATFVTGGFDQTAQLWVHDRKSNEVTCVAVCRGHSETVMTAAALFSDSNCEPCVFATGSWDGTIKLWSASPKATDLSEETGGIAHT--RKSTSKTPTRIPRLTLAGHRETITRVCWL-PTLPTD----EKSSTPSNPKLISVSWDHTLRVWDCQVGQPQQQNTGGSEVRCIVSSHAINDADATLQGILTASSDNRVRMYDLR-AREALALIGFPGHTAWLTAISWAPHRDNHFVTGSIDRSVRLWDTRNPKASLYDLMGHTDMVTDVDWA 415          

HSP 2 Score: 35.4242 bits (80), Expect = 4.434e-28
Identity = 20/61 (32.79%), Postives = 31/61 (50.82%), Query Frame = 1
Query:   67 YAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGI 249
            Y+V S PI    S   V+LN  + +LL++        +F F INGE ++  + D L  + I
Sbjct:   15 YSVPSTPITLAASSSSVELNGLLFNLLEETQACLAKTEFVFLINGEYLNGSVGDHLSERQI 75          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Match: A0A095AQF1 (Ribosome biogenesis protein WDR12-like protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_04847 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.837e-27
Identity = 105/365 (28.77%), Postives = 163/365 (44.66%), Query Frame = 2
Query:  335 KPPNLENETKFEEQVYGMKFKSKWLLCA--TGDLEI--IDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAV------STSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGND--ITLWHINGFE-STALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLA---------VSYTDGSLKFFRF 1363
            +PP  E E   ++ +  +K   K++L     G L I  +DS S V   +S+  +  +  VEW+S D+  NEAV + GG       W  DL +  V      +GH+  +   A        T     A+G  D  +KIWS   E TDLS ETGGI HV K+    K P RIPL TL  H E++  I WL      + +  DS +K     L++I  D  + +W     + +T      +     + D + +++ IL   SD  +R FD R     V +    H   +  V W P   + F++ S D + +LWD RN +S+   +    + +   DW+   +LL           S  D ++K + +
Sbjct:   12 EPPKYEREYVQDDLISCVKRCDKYILTGGYDGTLHIWSLDSKSAV---LSMELEEKVKCVEWISLDQTKNEAVFVTGGFDQTAQIWHWDLSSNKVNCIAVCRGHSETVMTAASRFSNNSDTHTTHFATGSWDTTIKIWSAGIEPTDLSEETGGIVHVRKST--SKTPTRIPLFTLAGHRETVTRICWL-----PSTLTNDSEIKPGGNQLLSISWDHSLRIWDCEAAKGNTGAEVRCILSNHALHDADVNSRGILTASSDNCIRIFDPRAEAPLVLSGFQGHTGWLTSVAWAPHRQDQFISGSIDRSVRLWDTRNPRSSLYDLMGHADIVTDVDWAPAIKLLTNDKPIHYILSSSADSTVKVYHY 366          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:103025900])

HSP 1 Score: 76.2554 bits (186), Expect = 1.326e-18
Identity = 78/351 (22.22%), Postives = 149/351 (42.45%), Query Frame = 2
Query:  320 YDIDIKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHIN-GFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            Y      P  E     ++ +  ++  S+W+L  + D      +   K V++++   D+++ V W+  D  S+  +  +      ++ W  + +N+ V  +   +GH   +  IAV  +R    SG  D MLKIWS      +   E    P   K K  +    R PL+TL  H E++  + W D E +  +   D +++              LW    G + + L   T    F  + ++   + +  G +D  +R +D R     +  ++  +H   +  V+W+  N +  V+ S+D   KLWD R+ K+    +    + + C DW+  G +L+    D  L  +++
Sbjct:   85 YVQKFTAPQPEECIMHDDWISSVEADSEWILTGSYDKTARIWSLEGKAVMTVAGHTDVVKDVAWVKRDGLSSLLLTASLDQTVLLWEWNSE-RNK-VKARHCCRGHAGSVDTIAVDPTRTKFCSGSWDKMLKIWSAVPTEEEDEVEEPNRPR-KKQKTEQMGLTRTPLMTLSGHGEAVSSVLWTDAE-ELCSASWDHTIR--------------LWDAETGVQKSML---TGSKVFNCISYSPLCRRLASGSTDRHVRLWDPRSKDGSLVLLSLTSHTGWVTAVRWSLSNNHQLVSGSFDNVVKLWDIRSCKAPLYDLAAHEDRVMCADWTESGLILS-GGADNKLYTYKY 413          

HSP 2 Score: 36.1946 bits (82), Expect = 1.326e-18
Identity = 19/72 (26.39%), Postives = 38/72 (52.78%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   K+A++  P   P +     L+  +  LL+    D K+V+F+F + G+ +   L + +E + IS
Sbjct:    5 QARFFTEYKKFAIDDVPFSIPAASEVKDLSNVINKLLEFKIADHKHVEFDFLVRGQFLRTSLANHMETENIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:103025900])

HSP 1 Score: 76.6406 bits (187), Expect = 8.424e-15
Identity = 78/351 (22.22%), Postives = 149/351 (42.45%), Query Frame = 2
Query:  320 YDIDIKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHI-NGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            Y      P  E     ++ +  ++  S+W+L  + D      +   K V++++   D+++ V W+  D  S+  +  +      ++ W  + +N+ V  +   +GH   +  IAV  +R    SG  D MLKIWS      +   E    P   K K  +    R PL+TL  H E++  + W D E +  +   D +++              LW    G + + L   T    F  + ++   + +  G +D  +R +D R     +  ++  +H   +  V+W+  N +  V+ S+D   KLWD R+ K+    +    + + C DW+  G +L+    D  L  +++
Sbjct:   83 YVQKFTAPQPEECIMHDDWISSVEADSEWILTGSYDKTARIWSLEGKAVMTVAGHTDVVKDVAWVKRDGLSSLLLTASLDQTVLLWEWNSE-RNK-VKARHCCRGHAGSVDTIAVDPTRTKFCSGSWDKMLKIWSAVPTEEEDEVEEPNRPR-KKQKTEQMGLTRTPLMTLSGHGEAVSSVLWTDAE-ELCSASWDHTIR--------------LWDAETGVQKSML---TGSKVFNCISYSPLCRRLASGSTDRHVRLWDPRSKDGSLVLLSLTSHTGWVTAVRWSLSNNHQLVSGSFDNVVKLWDIRSCKAPLYDLAAHEDRVMCADWTESGLILS-GGADNKLYTYKY 411          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:103025900])

HSP 1 Score: 55.8398 bits (133), Expect = 1.192e-12
Identity = 70/353 (19.83%), Postives = 144/353 (40.79%), Query Frame = 2
Query:  320 YDIDIKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVP--KNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHI-NGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            Y      P  E     ++ +  ++  S+W+L  + D      +   K V++++   D+++ V W+  D  S+  +  +      ++ W  + +N+ V  +   +GH   +  IAV  +R            K+      +     +    P+ P  K K  +    R PL+TL  H E++  + W D E +  +   D +++              LW    G + + L   T    F  + ++   + +  G +D  +R +D R     +  ++  +H   +  V+W+  N +  V+ S+D   KLWD R+ K+    +    + + C DW+  G +L+    D  L  +++
Sbjct:   85 YVQKFTAPQPEECIMHDDWISSVEADSEWILTGSYDKTARIWSLEGKAVMTVAGHTDVVKDVAWVKRDGLSSLLLTASLDQTVLLWEWNSE-RNK-VKARHCCRGHAGSVDTIAVDPTR-----------TKVLVFYLSVPTEEEDEVEEPNRPRKKQKTEQMGLTRTPLMTLSGHGEAVSSVLWTDAE-ELCSASWDHTIR--------------LWDAETGVQKSML---TGSKVFNCISYSPLCRRLASGSTDRHVRLWDPRSKDGSLVLLSLTSHTGWVTAVRWSLSNNHQLVSGSFDNVVKLWDIRSCKAPLYDLAAHEDRVMCADWTESGLILS-GGADNKLYTYKY 405          

HSP 2 Score: 36.5798 bits (83), Expect = 1.192e-12
Identity = 19/72 (26.39%), Postives = 38/72 (52.78%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   K+A++  P   P +     L+  +  LL+    D K+V+F+F + G+ +   L + +E + IS
Sbjct:    5 QARFFTEYKKFAIDDVPFSIPAASEVKDLSNVINKLLEFKIADHKHVEFDFLVRGQFLRTSLANHMETENIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:103032799])

HSP 1 Score: 51.6026 bits (122), Expect = 1.044e-6
Identity = 30/101 (29.70%), Postives = 49/101 (48.51%), Query Frame = 2
Query: 1055 ILIGCS-DTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIV----HKSPEAIRCCDWSH-DGELLAVSYTD 1339
            +   CS D  +R +D R   + + ++N AH   +NV+ WN   P   ++   DG  K+WD R  KS RA+     H +P  +   +W+  D  + A +  D
Sbjct:  290 VFASCSVDQSIRVWDIRAPPNSMLSVNEAHSSDVNVISWNRTEP-FLLSGGDDGLLKVWDLRQFKSGRAVASFKQHSAP--VTSVEWNPVDSSVFAAAGAD 387          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Match: thoc3 (THO complex 3 [Source:NCBI gene;Acc:103024749])

HSP 1 Score: 50.447 bits (119), Expect = 1.890e-6
Identity = 27/73 (36.99%), Postives = 38/73 (52.05%), Query Frame = 2
Query: 1136 AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKF 1354
             H   ++ + W+P NP++FVT S D   ++WD R  K   A V    E I  C WS DG+ +AV   D  + F
Sbjct:  113 GHGDSVDQLCWHPTNPDLFVTASGDKTIRIWDVRTTK-CMATVSTKGENINIC-WSPDGQTIAVGNKDDVVTF 183          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:321652])

HSP 1 Score: 78.5666 bits (192), Expect = 6.583e-20
Identity = 73/346 (21.10%), Postives = 151/346 (43.64%), Query Frame = 2
Query:  341 PNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPI-RIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMV--MDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            P  E     ++ V  +K    W+L  + D      T+  KP+ ++S   ++++ VEW++  E+S   +++          W+ +++      +   +GH   +  +AV+ +     SG  D M+KIWS      +   E G      K +  +K+ + R P++T+  H+E++  + W + +++  +   D +++              LW       T  ++ +L    +V  + ++   + I  G +D  +R +D R     +  ++  +H   +  VKW+P N    ++ + D   KLWD R+ K+    +    E I C +W+ +  LL+    D  L  F +
Sbjct:   92 PQPEECILHDDWVSAVKVCDDWILSGSYDKTGRVWTTDGKPLTTLSGHTEVVKDVEWINKGEES--CLLLTASQDQTAIIWEWNVRRNKAKPRHCCRGHAGSVEAVAVNNTYTKFCSGSWDKMIKIWSAVPNDQEDVVEEGSSARPKKKQKMEKLGLTRTPIMTISGHNEAVSSVLWSE-DLEICSASWDHTIR--------------LWDAE----TGEQKASLGGNKVVNSISYSPLCKRIASGSTDRHIRIWDPRSKGGSLVQLSLTSHTGWVTSVKWSPHNDKQLISGAIDKMVKLWDTRSPKAPLYDMAAHEEKILCVEWAENNMLLS-GGADNKLVTFNY 415          

HSP 2 Score: 35.8094 bits (81), Expect = 6.583e-20
Identity = 20/72 (27.78%), Postives = 36/72 (50.00%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   KY V++ P           L+  +  LL+    + K+V+F+F I G+ +   L   +E +GIS
Sbjct:    5 QARFVTKNKKYEVDAVPFSVVAQAEVTDLSNLINKLLEAQAGEHKHVEFDFLIGGQFLRMTLGKHMEQEGIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 51.9878 bits (123), Expect = 1.213e-7
Identity = 57/256 (22.27%), Postives = 96/256 (37.50%), Query Frame = 2
Query:  488 DMLQVEW------LSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRG--LIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWD 1231
            ++ + EW      +++ ED NE V++ G   G +  W        +     Y+GHT ++  +  S +RG  L+ SG  D   ++W  +  L+ L+   G                         H   +    W        +  I S   S SG       D+   H       A +   L C +   D N    L++    D  +R +D R  +  V ++ G H   I  V+ +P  P +  +CSYD + + WD
Sbjct:   60 ELRRFEWNDSLFDVAWSED-NEHVLVTGSGDGSLQLWDASQPEGPLR---VYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPA-FLSSLAEYRG-------------------------HEGVVYSTVW--------SPHIPSCFASASGDQTLRVWDVKSPHAARIVIPAHQEEVLSCDWCKYDQN----LLVSAAVDCGIRGWDLRNIRQPVFSLLG-HSYAIRRVRCSPFQPTVLASCSYDFSVRFWD 272          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Match: thoc3 (THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14])

HSP 1 Score: 50.8322 bits (120), Expect = 2.618e-7
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 2
Query: 1136 AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKF 1354
             H   ++ + W+P+NP +FVT S D   ++WD R+ K A A V+   E I  C WS DG+ +AV   +  + F
Sbjct:   68 GHGDSVDQLCWHPLNPELFVTASGDKTVRIWDVRSNKCA-ATVNTKGENINIC-WSPDGQTIAVGNKEDVVTF 138          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Match: GLE2 (RNA export factor associated with the nuclear pore complex (NPC); associates with NUP116p; required for polyadenylated RNA export but not for protein import; homologous to S. pombe Rae1p and human RAE1 [Source:SGD;Acc:S000000909])

HSP 1 Score: 47.3654 bits (111), Expect = 2.420e-6
Identity = 25/78 (32.05%), Postives = 41/78 (52.56%), Query Frame = 2
Query: 1127 INGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARN-IKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            IN   +  I+ + ++P    MF   S+DG  ++WD +N +   RA  H+S   + C  WS+DG  +A    D +LK +
Sbjct:   31 INSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRA-QHESSSPVLCTRWSNDGTKVASGGCDNALKLY 107          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO48980 (Ribosome biogenesis protein WDR12 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7RHG8])

HSP 1 Score: 58.5362 bits (140), Expect = 2.661e-9
Identity = 76/311 (24.44%), Postives = 123/311 (39.55%), Query Frame = 2
Query:  446 TSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWST--SQELTDLSAETGGIPHVPKNKD-PKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGND--ITLWHI-NGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFR-EAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            TSPVK             VEW+S DE   + V ++      +   +  + +   +     KGHT  +  I+++ S     SG  D  LK+WS   + E  D   E G +    K     KK   R PL+T   H++++  + W+D                   ++ + G D  I LW   +G     L    + C+      NQ    +  G +D  +R +D R E    V  I  +H   ++ V W+P N     + SYD   K+WD R+  +    +    + + C  WS    L++   TD  L  +
Sbjct:  142 TSPVK------------DVEWVSKDE--QKGVFLSSSQDQSIRVMEWSIGSGEASCVHVCKGHTQSVDSISINPSATKFCSGSWDKTLKLWSAVVNPEGGD-EGENGSLSKKQKTTGVKKKATTRTPLMTFTGHTQAVSSVVWMDRT-----------------TICSAGWDHCIRLWDAESGVNKQTLTGSKVFCEIAYSALNQ---CLASGSADKYIRLWDHRAEDGQVVRGILTSHQGWVSSVSWSPSNQFELASASYDTTVKIWDTRSPYTPLYTLTGHQDKVMCVRWSSSRHLMS-GGTDNQLILY 416          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO34790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNF3])

HSP 1 Score: 55.8398 bits (133), Expect = 1.284e-8
Identity = 32/97 (32.99%), Postives = 51/97 (52.58%), Query Frame = 2
Query: 1064 GCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKF 1354
            G  D     F   + +  ++ I   H++ ++ + W+P NP++FVT S D   ++WDAR+IK    +V+   E I  C WS DG  +AV   D  + F
Sbjct:   47 GSFDRTASVFVLDKDRLTLDHIYKGHNESVDQLCWHPSNPDLFVTASGDKTIRIWDARSIKCVH-VVNTKGENINIC-WSPDGNTIAVGNKDDLITF 141          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO47633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM8])

HSP 1 Score: 54.6842 bits (130), Expect = 5.770e-8
Identity = 60/262 (22.90%), Postives = 106/262 (40.46%), Query Frame = 2
Query:  596 NRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTS----GSLMTIG--------NDITLWHINGF--ESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTD 1339
            ++T  +   YKGH      + +S     + SG  D  +KIW+  ++    +A+   +      +D   + +          S+ L   +  D  + A    +DS + S +    G  + +G         D +   +  F     A+RR    C F     +Q  QL+L    D   + F+ +EA+  + T+ G  +K    + +N  N    +T S DG+ K+WDA+         H S + +  CD SHD + L  +  D
Sbjct:  844 SKTFARLGVYKGHKGWAHSVGISKDSSKLVSGSEDETVKIWTIDRDAAKDAAKLRRVFDAHFGEDSLGVAVA-------DSSDRLLIFQGQDGVLTAEGEAMDSKIHSVTFSPRGEAIAVGCESGTISIQDRSCKVLQSFSEHKGAVRR----CYF-----SQDGQLLLSASDDKTAKVFNLQEAR-VMYTLAGHTNKLRRCMFFN--NDTRILTASLDGSLKVWDAKTGNLEFTCCHSSTDYVLTCDVSHDSQRLISASAD 1086          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO49914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF91])

HSP 1 Score: 51.6026 bits (122), Expect = 1.555e-7
Identity = 49/185 (26.49%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  815 PLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMV-MDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINP-NMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            P LT   H+E +  + W              + KS  G L T  +D T+   N      L  +T    +++  D N   +L+     D  +   D    K  VNT+ G H  G+    +NP    ++  + + DG+ KLWD R+     ++V    + ++ C WS +GE +A S  DG +  F F
Sbjct:   49 PSLTFRHHTEPVTSLSWQKL-----------TSKSELGILATTSSDKTVALWNSDNGNLLNNLTHHSSWVLGSDFNNDGKLLASASWDKFVIISDVPTGK-PVNTLAG-HTTGVWTCAFNPERTGDILCSGADDGSLKLWDIRSNSVVMSLVGGHDDRVKSCAWSPNGEYVASSSADGRVGIFFF 220          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Match: EDO40986 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J4])

HSP 1 Score: 52.373 bits (124), Expect = 2.095e-7
Identity = 61/285 (21.40%), Postives = 107/285 (37.54%), Query Frame = 2
Query:  524 DSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAV----STSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHI---NGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFF 1357
            + +++ +++    G +  W+ ++ N  +     Y+ H    SR  +    S +    AS   DG++KIW   + + +                           TL  H   +KCI W  P     ++++  S  S           I LW     NG  +  L + T+    M +  NQ+   +L    D  L+ FD R  K E+    G H +    + W+PI+ N+F +   DGA   W + + K    +       +    W   G +L     D + KF+
Sbjct:  130 NHHDSWLLSADHSGIVKYWQSNMNNVQM-----YEAHKEPQSRTLIISSFSPTDNKYASCADDGLVKIWDFYRCMEEK--------------------------TLRGHGADVKCIDW-HPH---KSLLVSGSKDSQQ--------PIKLWDTRTGNGLATLHLHKSTV----MSIKWNQNGNWLLTASRDHLLKLFDIRAMK-ELQAFRG-HKREATAIAWHPIHENLFASGGSDGAIMFWMSGSDKDVGNMESAHEGMVWSLAWHPLGHILCSGSNDHTSKFW 365          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:101160390])

HSP 1 Score: 76.2554 bits (186), Expect = 7.704e-19
Identity = 77/349 (22.06%), Postives = 149/349 (42.69%), Query Frame = 2
Query:  332 IKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIP--IRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRF 1363
            I  P  E     ++ +  +   S+W+L  + D      +   K V++++   D+++   W+  D  ++  +  +      ++ W  + +N+ V  +   +GHT  +  ++   +     SG  D MLKIWS     TD + E       P+ K   +     R PL+TL  H+E++  + W D E      V  +S   T          I +W +   E+ A++      K F  + ++   + +  G +D  +R +D R     +  ++  +H   +  VKW P + +  V+ S D   KLWD R+ K+    +    + + C DW+  G +L+    D  L  +++
Sbjct:   89 ITAPEPEECMMHDDWISSIDADSEWILTGSYDKTARIWSVDGKAVMTVAGHLDVVKDATWVKRDGLTSLLLTASLDQTVLLWEWNSE-RNK-VKARHCCRGHTGSVDTVSTDPTGSKFCSGSWDKMLKIWSAVP--TDEADEVEEAADRPRKKQKTQQLGLTRTPLMTLSGHNEAVSSVLWSDAEE-----VCSASWDHT----------IRVWDV---EAGAMKTTLTGSKVFNCISYSPLCRRLASGSTDRHIRLWDPRTKDGALVLLSLTSHTGWVTAVKWAPTHEHQLVSGSLDNLVKLWDIRSCKAPLYDLAAHEDKVFCVDWTESGLMLS-GGADNKLYSYKY 414          

HSP 2 Score: 37.3502 bits (85), Expect = 7.704e-19
Identity = 19/72 (26.39%), Postives = 36/72 (50.00%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   +YAV+  P   P +     L+  +  LL+        V+F+F + G+ +  PL   ++ +GIS
Sbjct:    5 QARFFTENKRYAVDDVPFSIPAASEVGDLSNIINKLLEAKHASHSKVEFDFLVRGQFLRMPLSAHMDTEGIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:101160390])

HSP 1 Score: 45.8246 bits (107), Expect = 5.597e-10
Identity = 64/314 (20.38%), Postives = 128/314 (40.76%), Query Frame = 2
Query:  332 IKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQ-VEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCK-FMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTIN-GAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIV 1264
            I  P  E     ++ +  +   S+W+L  + D      +   K V++++   D+++   W+  D  ++  +  +      ++ W  + +N+ V  +   +GHT  +  ++   +    +S        +     +  D   E    P   K K  +    R PL+TL  H+E++  + W D E      V  +S   T          I +W +   E+ A++      K F  + ++   + +  G +D  +R +D R     +  ++  +H   +  VKW P + +  V+ S D   KLWD R  +S R I+
Sbjct:   89 ITAPEPEECMMHDDWISSIDADSEWILTGSYDKTARIWSVDGKAVMTVAGHLDVVKDATWVKRDGLTSLLLTASLDQTVLLWEWNSE-RNK-VKARHCCRGHTGSVDTVSTDPTGSKFSS--------LLPVPTDEADEVEEAADRPR-KKQKTQQLGLTRTPLMTLSGHNEAVSSVLWSDAEE-----VCSASWDHT----------IRVWDV---EAGAMKTTLTGSKVFNCISYSPLCRRLASGSTDRHIRLWDPRTKDGALVLLSLTSHTGWVTAVKWAPTHEHQLVSGSLDNLVKLWDIR--RSLRHIL 371          

HSP 2 Score: 37.3502 bits (85), Expect = 5.597e-10
Identity = 19/72 (26.39%), Postives = 36/72 (50.00%), Query Frame = 1
Query:   37 RSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGIS 252
            ++RF +   +YAV+  P   P +     L+  +  LL+        V+F+F + G+ +  PL   ++ +GIS
Sbjct:    5 QARFFTENKRYAVDDVPFSIPAASEVGDLSNIINKLLEAKHASHSKVEFDFLVRGQFLRMPLSAHMDTEGIS 76          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: pex7 (peroxisomal biogenesis factor 7 [Source:NCBI gene;Acc:101156454])

HSP 1 Score: 55.8398 bits (133), Expect = 3.116e-8
Identity = 59/261 (22.61%), Postives = 103/261 (39.46%), Query Frame = 2
Query:  491 MLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRG--LIASGCSDGMLKIW--STSQELTDLSAETGGI------PHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLP---CKFMVMDHNQHTQ-LILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWD 1231
            +  V W     ++NE +++AGG  G +  W  D  N+    + + K HT ++  ++ S +RG  LI SG  D  +K+W  S S+ LT L    G +      PH+P                                            + S SG        + +W +      A+ R+ +P    + +  D  ++ Q ++  G  D  +  +D R  +  VN + G H   I  +K++P +  +  +CSYD   + WD
Sbjct:   63 LFDVAW----SEANEHLLVAGGGDGSLQLW--DTANQHAPLKVA-KEHTQEVYSVSWSQTRGENLIVSGSWDHTVKVWDPSLSRSLTTLRGHEGVVYSTIWSPHIP------------------------------------------GCIASASGD-----GTLRIWDVK----AAVCRLAVPAHQAEILACDWCKYDQNIVATGSVDCSINVWDLRNIRQPVNHLLG-HTYAIRRLKFSPFSQTVLASCSYDFTVRFWD 264          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:101163517])

HSP 1 Score: 54.6842 bits (130), Expect = 1.101e-7
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 2
Query: 1055 ILIGCS-DTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIV----HKSPEAIRCCDWS-HDGELLAVSYTD 1339
            +   CS D  +R +D R   + + +++GAH   INV+ WN   P   ++   DG  K+WD R  K+ RA+     H +P  I   +WS  D  + A S  D
Sbjct:  282 VFASCSVDQSIRVWDIRAPPNSMLSVDGAHASDINVISWNRSEP-FLLSGGDDGLLKVWDLRQFKTGRAVANFKQHSAP--ITSVEWSPADSSVFAASGAD 379          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Match: wdr59 (WD repeat domain 59 [Source:NCBI gene;Acc:101168349])

HSP 1 Score: 53.5286 bits (127), Expect = 4.016e-7
Identity = 33/106 (31.13%), Postives = 53/106 (50.00%), Query Frame = 2
Query: 1049 QLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGE-LLAVSYTDGSLKFFRF 1363
            +L++    DT +  +D R+A+     ++     G + VKWN  N N+  + S+DG  ++WD R   +A   V      I   DW  DGE + A S  D S++F+ F
Sbjct:  119 ELLVTSSVDTYIYIWDTRDARKPTVALSAV--AGASQVKWNRKNQNLLAS-SHDGDVRIWDKRKPNTAVEYVAAHLSKIHGLDWHPDGEFVFATSSQDNSVRFWDF 221          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000068152.1 (SMESG000068152.1)

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 346/350 (98.86%), Postives = 347/350 (99.14%), Query Frame = 2
Query:  317 VYDIDIKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAIRCCDWSHDGELLAVSYTDGSLKFFRFD 1366
            VYDIDIKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCD DMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSG+LMTIGNDITLWHINGFEST LRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKS EAIRCCDWSHDGELLAVSYTDGSLKFFRFD
Sbjct:   81 VYDIDIKPPNLENETKFEEQVYGMKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDVDMLQVEWLSFDEDSNEAVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIASGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKWLDPEMDAANVVIDSSVKSTSGNLMTIGNDITLWHINGFESTVLRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTINGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSTEAIRCCDWSHDGELLAVSYTDGSLKFFRFD 430          

HSP 2 Score: 153.68 bits (387), Expect = 1.135e-41
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
Query:   31 MPRSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGISE 255
            MPRSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGISE
Sbjct:    1 MPRSRFTSSVLKYAVESEPIVFPISFGPVQLNKTVKSLLKDNGIDTKNVKFNFFINGEVIDCPLKDFLELKGISE 75          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000059911.1 (SMESG000059911.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.065e-9
Identity = 53/184 (28.80%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  893 VVIDSSVKSTSGSLMTIGNDIT--LWHINGFESTALRRITL-PCKFMV--MDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTING-----------AHDKGINVVKWNPINPNMFVTCSYDGATKLW---DARNIKSARAIV-HKS---PEAIR-------CCDWSHDGELLAVSYTDGSLKF 1354
            ++  +S++ST   L+T   D T  LW  NG  STA    T+ PC+  +  ++ + + + IL+  +D +    D RE +  + TI G            H+K +N   WNP       TCS DG+ ++W   D   I S R I  HKS   P+++R        C ++  G ++  + +DGS++ 
Sbjct:   38 MITSTSIESTGNRLITANKDCTMNLWDFNGMNSTASSFKTVTPCEQEIKKIEFSANGEHILVISNDIQAFILD-REGERVLETIKGNPYLFDPRSTKGHNKMLNYGCWNPRVAEDMATCSGDGSVRIWNILDFEKILSDRRIKNHKSCIVPKSVRGKKIIPVTCAYASSGLMVGAACSDGSIQL 220          
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Match: SMESG000009269.1 (SMESG000009269.1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.342e-7
Identity = 45/189 (23.81%), Postives = 81/189 (42.86%), Query Frame = 2
Query:  677 LIASGCSDGMLKIWSTSQELTDLSAETGG-IPHVPKNKDPKKIPIRIPLLTLLAHSESLKCIKW-LDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFESTALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTI-NGAHDKGINVVKWNPINPNMFVTCSYDGATKLWDA 1234
            L+A+G  D  +KI    + L    A++GG I ++ +    +++     + TL  H   + C+ +  DP +     ++ S  K  +  L    N             A + I        +  +     +L+G     LR +D    +  V+ +    H+  IN+V W+P N +MF +CS DG+ K+WD 
Sbjct:  116 LVATGSEDSSIKILDVERML----AKSGGPIDNMGQENQQQQMETHPVIRTLYDHQAEVSCVDFHPDPNLQ----ILASGSKDYTIKLFDFSNPSV--------KKAFKSIPEASPVRTIKFHSSGDCLLVGTYHKTLRIYDVNTTQCFVSAVPEDQHNGAINMVTWSP-NSSMFASCSVDGSFKIWDG 287          
The following BLAST results are available for this feature:
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR122.668e-1324.53WD repeat domain 12 [Source:HGNC Symbol;Acc:HGNC:1... [more]
APAF14.608e-724.29apoptotic peptidase activating factor 1 [Source:HG... [more]
APAF14.989e-724.29apoptotic peptidase activating factor 1 [Source:HG... [more]
APAF13.095e-623.88apoptotic peptidase activating factor 1 [Source:HG... [more]
APAF13.192e-623.88apoptotic peptidase activating factor 1 [Source:HG... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr-126.601e-1422.39Ribosome biogenesis protein WDR12 homolog [Source... [more]
wdr-126.601e-1422.39Ribosome biogenesis protein WDR12 homolog [Source... [more]
pfs-21.232e-719.78Polyadenylation Factor Subunit homolog [Source:Un... [more]
pfs-28.431e-728.57Polyadenylation Factor Subunit homolog [Source:Un... [more]
gad-13.640e-628.57Gastrulation defective protein 1 [Source:UniProtK... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG67244.850e-1825.82gene:FBgn0032298 transcript:FBtr0080191[more]
CG67241.021e-1625.22gene:FBgn0032298 transcript:FBtr0333491[more]
Wdr333.913e-920.65gene:FBgn0046222 transcript:FBtr0078713[more]
Wdr333.913e-920.65gene:FBgn0046222 transcript:FBtr0078714[more]
Ciao12.094e-622.59gene:FBgn0033972 transcript:FBtr0087460[more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr123.105e-1822.90WD repeat domain 12 [Source:NCBI gene;Acc:321652][more]
WDR701.644e-624.55WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
WDR702.012e-624.55WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
WDR702.070e-624.55WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
WDR702.753e-624.55WD repeat domain 70 [Source:NCBI gene;Acc:10188483... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr121.425e-1822.41WD repeat domain 12 [Source:NCBI gene;Acc:595016][more]
wdr121.475e-1722.41WD repeat domain 12 [Source:NCBI gene;Acc:595016][more]
wdr121.160e-1324.15WD repeat domain 12 [Source:NCBI gene;Acc:595016][more]
wdr121.348e-1221.75WD repeat domain 12 [Source:NCBI gene;Acc:595016][more]
THOC31.041e-638.36THO complex 3 [Source:NCBI gene;Acc:100490375][more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Wdr123.854e-1522.52WD repeat domain 12 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr123.854e-1522.52WD repeat domain 12 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr123.854e-1522.52WD repeat domain 12 [Source:MGI Symbol;Acc:MGI:192... [more]
Thoc34.125e-636.99THO complex 3 [Source:MGI Symbol;Acc:MGI:1920916][more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7QJ33|WDR12_ANOGA7.710e-2324.85Ribosome biogenesis protein WDR12 homolog OS=Anoph... [more]
sp|Q17BB0|WDR12_AEDAE1.054e-2225.60Ribosome biogenesis protein WDR12 homolog OS=Aedes... [more]
sp|P61480|WDR12_RAT1.779e-2023.41Ribosome biogenesis protein WDR12 OS=Rattus norveg... [more]
sp|B4MU54|WDR12_DROWI5.008e-2024.26Ribosome biogenesis protein WDR12 homolog OS=Droso... [more]
sp|B0W517|WDR12_CULQU3.058e-1926.80Ribosome biogenesis protein WDR12 homolog OS=Culex... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N9152.693e-3028.92Ribosome biogenesis protein YTM1 OS=Paragonimus we... [more]
A0A4S2LAN31.004e-2828.07WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A4S2LAW11.004e-2828.07WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A4S2L5R84.434e-2828.99WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A095AQF11.837e-2728.77Ribosome biogenesis protein WDR12-like protein (Fr... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr121.326e-1822.22WD repeat domain 12 [Source:NCBI gene;Acc:10302590... [more]
wdr128.424e-1522.22WD repeat domain 12 [Source:NCBI gene;Acc:10302590... [more]
wdr121.192e-1219.83WD repeat domain 12 [Source:NCBI gene;Acc:10302590... [more]
grwd11.044e-629.70glutamate rich WD repeat containing 1 [Source:NCBI... [more]
thoc31.890e-636.99THO complex 3 [Source:NCBI gene;Acc:103024749][more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wdr126.583e-2021.10WD repeat domain 12 [Source:NCBI gene;Acc:321652][more]
pex71.213e-722.27peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
thoc32.618e-736.99THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14][more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GLE22.420e-632.05RNA export factor associated with the nuclear pore... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489802.661e-924.44Ribosome biogenesis protein WDR12 homolog [Source... [more]
EDO347901.284e-832.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476335.770e-822.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499141.555e-726.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409862.095e-721.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr127.704e-1922.06WD repeat domain 12 [Source:NCBI gene;Acc:10116039... [more]
wdr125.597e-1020.38WD repeat domain 12 [Source:NCBI gene;Acc:10116039... [more]
pex73.116e-822.61peroxisomal biogenesis factor 7 [Source:NCBI gene;... [more]
grwd11.101e-732.67glutamate rich WD repeat containing 1 [Source:NCBI... [more]
wdr594.016e-731.13WD repeat domain 59 [Source:NCBI gene;Acc:10116834... [more]
back to top
BLAST of Ribosome biogenesis protein WDR12 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000068152.11.135e-4198.86SMESG000068152.1[more]
SMESG000059911.12.065e-928.80SMESG000059911.1[more]
SMESG000009269.13.342e-723.81SMESG000009269.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000887 ID=SMED30000887|Name=Ribosome biogenesis protein WDR12 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1378bp
GGTTTAATATTCGGTTATTTTAGATTTAAAATGCCGAGATCAAGATTTAC
CTCATCAGTTTTAAAATACGCAGTTGAATCAGAACCTATCGTATTCCCTA
TCAGTTTTGGACCAGTTCAGTTAAATAAAACTGTTAAAAGTTTATTAAAA
GATAATGGAATTGACACAAAAAATGTCAAATTTAACTTTTTTATAAATGG
CGAAGTAATTGACTGTCCATTAAAGGATTTTTTAGAACTAAAAGGAATTT
CTGAAGTTAGGAAAATGAAGATTTTTATGGAGATATAATTGATTATGTTA
GGAAATAGAAGAAATTGTTTATGACATTGACATCAAACCTCCTAACTTAG
AAAATGAAACTAAGTTCGAAGAACAGGTATATGGAATGAAATTTAAATCA
AAATGGCTTCTCTGTGCTACTGGTGATTTGGAAATTATCGATTCGACTTC
ACCAGTAAAGCCAGTTGTGTCAATTTCATGTGACTTTGACATGCTACAAG
TTGAATGGCTTTCATTCGATGAAGACTCTAACGAAGCGGTAATAATTGCC
GGTGGAATAAAAGGGTATATGTACTCATGGAAATGCGACTTGAAAAATAG
AACTGTCACGCAACAATTCAGTTACAAAGGCCACACGAATGATATCTCTC
GTATTGCAGTTTCTACCAGTAGAGGTCTCATTGCTAGTGGATGTTCCGAT
GGAATGTTAAAGATTTGGTCAACAAGCCAAGAATTAACGGATTTATCGGC
AGAAACCGGGGGTATTCCACACGTGCCTAAAAATAAAGATCCTAAAAAAA
TCCCAATAAGAATCCCGCTATTAACACTTCTAGCCCACTCAGAATCGTTA
AAATGTATTAAATGGCTCGATCCAGAAATGGATGCGGCAAATGTCGTGAT
CGACAGTAGCGTGAAATCAACGAGCGGAAGTTTGATGACGATTGGCAATG
ACATTACGCTCTGGCACATCAATGGCTTTGAGTCGACGGCTCTCAGGCGT
ATCACGTTACCATGCAAATTCATGGTTATGGACCATAACCAGCACACTCA
ATTGATATTGATTGGCTGTAGTGACACCCGACTGAGGTGTTTTGATTTCC
GGGAAGCCAAACATGAGGTGAATACCATTAACGGAGCTCATGACAAAGGC
ATTAACGTTGTCAAGTGGAATCCGATCAATCCCAATATGTTTGTGACTTG
CAGCTACGATGGCGCTACGAAACTCTGGGACGCCAGGAACATAAAATCAG
CCCGAGCGATAGTGCACAAATCTCCCGAAGCTATCAGATGTTGCGATTGG
AGCCATGATGGAGAATTGCTGGCTGTTTCTTATACCGACGGCTCTCTGAA
ATTTTTTCGATTTGATTAATAAATAACT
back to top

protein sequence of SMED30000887-orf-1

>SMED30000887-orf-1 ID=SMED30000887-orf-1|Name=SMED30000887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
MKFKSKWLLCATGDLEIIDSTSPVKPVVSISCDFDMLQVEWLSFDEDSNE
AVIIAGGIKGYMYSWKCDLKNRTVTQQFSYKGHTNDISRIAVSTSRGLIA
SGCSDGMLKIWSTSQELTDLSAETGGIPHVPKNKDPKKIPIRIPLLTLLA
HSESLKCIKWLDPEMDAANVVIDSSVKSTSGSLMTIGNDITLWHINGFES
TALRRITLPCKFMVMDHNQHTQLILIGCSDTRLRCFDFREAKHEVNTING
AHDKGINVVKWNPINPNMFVTCSYDGATKLWDARNIKSARAIVHKSPEAI
RCCDWSHDGELLAVSYTDGSLKFFRFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000463maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364rRNA processing
GO:0042254ribosome biogenesis
GO:0042273ribosomal large subunit biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0030687preribosome, large subunit precursor
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: molecular function
TermDefinition
GO:0043021ribonucleoprotein complex binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR012972NLE
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 285..325
e-value: 0.0018
score: 27.5
coord: 241..282
e-value: 2.8E-6
score: 36.9
coord: 73..112
e-value: 3.5E-7
score: 39.8
coord: 23..66
e-value: 460.0
score: 0.2
coord: 196..237
e-value: 180.0
score: 2.8
IPR001680WD40 repeatPFAMPF00400WD40coord: 250..282
e-value: 0.11
score: 13.4
coord: 294..324
e-value: 0.0038
score: 18.0
coord: 77..112
e-value: 1.4E-5
score: 25.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 249..291
score: 10.742
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 80..112
score: 12.046
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 4..203
e-value: 1.1E-14
score: 56.5
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 213..327
e-value: 2.0E-22
score: 81.7
NoneNo IPR availablePANTHERPTHR22850WD40 REPEAT FAMILYcoord: 217..324
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 249..327
score: 14.397
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 80..121
score: 11.287
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 44..324