Kynurenine 3-monooxygenase

Overview
NameKynurenine 3-monooxygenase
Smed IDSMED30000867
Length (bp)1486
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kynurenine 3-monooxygenase (SMED30000867) t-SNE clustered cells

Violin plots show distribution of expression levels for Kynurenine 3-monooxygenase (SMED30000867) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kynurenine 3-monooxygenase (SMED30000867) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kynurenine 3-monooxygenase (SMED30000867) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000867

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30000867h1SMcG0007671 SmedASXL_012208SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30000867h1SMcG0007671 Contig42275uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000867h1SMcG0007671 Contig42275newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000867h1SMcG0007671 Contig35070uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000867h1SMcG0007671 Contig35070newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000867h1SMcG0007671 Contig29247uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000867h1SMcG0007671 Contig29247newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30000867h1SMcG0007671 dd_7884dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30000867h1SMcG0007671 dd_Smed_v4_7884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000867h1SMcG0007671 dd_Smed_v4_7884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30000867h1SMcG0007671 dd_Smed_v6_7884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 327.405 bits (838), Expect = 1.636e-106
Identity = 171/408 (41.91%), Postives = 259/408 (63.48%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEK-IAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            +L A F A+ + F + +YE   D R      GR+INL+LS+RG  ALK V LE++++ + IPM ARMIH  SG      YG  SQ I ++ R  L   LL  AE + +++++FN +L   N  E  I    + K  +D+    DL+VG DGAYS VR  + K  R D+SQ+YIPHGY+E+T PP +G+ ++M+ N LHIWPRN +M+ ALPN++ SF+ TLFMPF+ FE + +  D+++ F+K FPDA+ +IG+  L   F       M++++C+ ++    CV++GDAAHA+VPF+GQGMN+GFED  +F E++ K   +L      FS  R  D  A+ +L+ YNY+E+R +V    F  +K ++  ++++ PS +IPLYTMV FS+I Y + V+    Q K++++
Sbjct:   21 SLQACFLAKRN-FQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVT--CDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGD-YAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINK 424          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 314.309 bits (804), Expect = 1.235e-101
Identity = 168/408 (41.18%), Postives = 253/408 (62.01%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEK-IAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            +L A F A+ + F + +YE   D R      GR+INL+LS+RG  ALK V LE++++ + IPM ARMIH  SG      YG  SQ I ++ R  L   LL  AE + +++++FN +L   N  E  I    + K  +D+    DL+VG DGAYS VR  + K  R D+SQ+YIPHGY+E+T PP +G+ ++M+ N LHIWPRN +M+ ALPN++ SF+ TLFMPF+ FE + +  D+++ F+K FPDA+ +IG+  L   F       M++++C+ ++    CV++GDAAHA+VPF+GQGMN+GFED  +F E++ K   +L      FS  R  D  A+ +L+ YNY+E             K ++  ++++ PS +IPLYTMV FS+I Y + V+    Q K++++
Sbjct:   21 SLQACFLAKRN-FQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDV--TCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGD-YAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIE-------------KNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINK 411          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 288.115 bits (736), Expect = 9.032e-92
Identity = 151/351 (43.02%), Postives = 223/351 (63.53%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEK-IAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLEL 1165
            +L A F A+ + F + +YE   D R      GR+INL+LS+RG  ALK V LE++++ + IPM ARMIH  SG      YG  SQ I ++ R  L   LL  AE + +++++FN +L   N  E  I    + K  +D+    DL+VG DGAYS VR  + K  R D+SQ+YIPHGY+E+T PP +G+ ++M+ N LHIWPRN +M+ ALPN++ SF+ TLFMPF+ FE + +  D+++ F+K FPDA+ +IG+  L   F       M++++C+ ++    CV++GDAAHA+VPF+GQGMN+GFED  +F E++ K   +L      FS  R  D  A+ +L+ YNY+E+
Sbjct:   21 SLQACFLAKRN-FQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVT--CDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGD-YAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEV 367          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 82.0333 bits (201), Expect = 1.358e-17
Identity = 41/109 (37.61%), Postives = 67/109 (61.47%), Query Frame = 2
Query: 1010 GMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            GMN+GFED  +F E++ K   +L      FS  R  D  A+ +L+ YNY+E+R +V    F  +K ++  ++++ PS +IPLYTMV FS+I Y + V+    Q K++++
Sbjct:    2 GMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKKVINK 110          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-1 (Kynurenine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:Q21795])

HSP 1 Score: 344.739 bits (883), Expect = 5.321e-114
Identity = 180/441 (40.82%), Postives = 273/441 (61.90%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSG-PLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEK------------IAKFKN---LKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFES-IHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGI 1387
             LNA FFAQ   ++V++YE   D RT+    GR+INL+LS RG  AL+ V L+E ++ + +P+YAR+IH + G    R  YGK  + I ++ RR L  +++ +AE   +++  F  K+ +V++++K            I  F N    +   +   + DL++  DGAYS VR  +    R DFSQEYI HGY+E+     + N+ + ++N  H+WPR  + L AL N D +F+ T+F PF  FE  + + +D+L  FE+ FPDA  ++GK H+ D F + K   +V+I+C+P++  +  V+MGDAAHAMVPFYGQGMN GFED  +F E L++   ++ K    +S+ R NDA ++ +LA YNY EL+  V   S+++RK  D +MNS+FP  WIPLY+MV FS+IPY + +E +++QDKILSRI + +  + L     GI
Sbjct:   14 ALNACFFAQ-KGWDVSVYEFRKDIRTMKHVQGRSINLALSQRGKSALEAVGLKEYIVNQGVPLYARLIHNKDGKTYSRQPYGKPGEHIVSINRRHLNEVMITQAEKSPNVKFFFEHKVKNVDYDKKQLVVQCTSQPSKIPTFGNKSPPQEHAEFHVEADLILACDGAYSAVRRSLMTIPRFDFSQEYIEHGYVELNIM-ANNNEFAFEENVFHLWPRGHFTLIALANRDKTFTVTIFAPFSEFEKHMSTSEDVLSFFEENFPDAFLLLGKEHIADTFNRVKPQPLVSIKCSPHSFFDNLVLMGDAAHAMVPFYGQGMNCGFEDCLVFSETLEEYGNDIAKAVKVYSDGRVNDAHSINDLAMYNYEELKDLVNKSSYKLRKKFDTIMNSIFPKSWIPLYSMVTFSRIPYSEVIERRKRQDKILSRIMTTTSTLALIGAAAGI 452          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-2 (Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q21794])

HSP 1 Score: 169.088 bits (427), Expect = 7.620e-47
Identity = 123/434 (28.34%), Postives = 218/434 (50.23%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIH--ERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHI-WPRNEYMLTALPNLDGSFSGTLFMPFKMFES-IHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEIL-QKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSF---------RMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSI 1375
            + NA FF Q   + V +YE   D R  H + G++INL+L  R +  +K + L+E+V+   +P+  ++ H  +  G LKR         I  + R+ L  IL+ +AE + +++ +FN K    +   +    +N  N+  ++   DL +  DGA+S +R  + K    +FSQ+Y   GYI+++   V+  +    K   H  W R   +L A+ N D S + ++F  F  FES +    + +  F+  F +  +I+G+ H+ +   ++K   +++++C+ +   +K V+MGDAAHAMVPF GQG+N GFED  +  EI+ Q  +  L      +S+ R N+   +      N +E   N+T+ S           +R  +  L+  +FPS     +T+  FS+  Y +   + Q  +K  S   ++ I  ++  I
Sbjct:   14 SANACFFGQ-KGWIVDVYESRFDPRGNHMENGKSINLALGVRAMSTMKRIGLKEKVIHIGVPIRDQIAHFGDTKGKLKRLPVLNDDDFILTINRQELSQILINEAEKYNNVKFHFNCKATKFDLKSESLIVQNSDNLSTVDG--DLFLACDGAHSSIRRSLLKAPGFNFSQKYSEFGYIDLS---VNSTQQCDLKLGTHYSWRRRGIILVAIVNKDQSLTVSMFATFSEFESNLVGPVESVLFFKNNFYEIFKILGEDHIRNTIARNKPQAIISVQCSQHVFFDKLVLMGDAAHAMVPFNGQGVNCGFEDCLVLQEIMDQYEEDELEDVIKEYSKVRTNETNII------NQMEWDVNLTLTSSVHGSLGWIREIRAHIKLLLCFIFPSS----FTLAAFSREKYSEIARKAQIVEKCTSLFTNVFIVFIISVI 431          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-2 (Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q21794])

HSP 1 Score: 155.221 bits (391), Expect = 3.698e-42
Identity = 112/403 (27.79%), Postives = 203/403 (50.37%), Query Frame = 2
Query:  209 GRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIH--ERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHI-WPRNEYMLTALPNLDGSFSGTLFMPFKMFES-IHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEIL-QKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSF---------RMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSI 1375
            G++INL+L  R +  +K + L+E+V+   +P+  ++ H  +  G LKR         I  + R+ L  IL+ +AE + +++ +FN K    +   +    +N  N+  ++   DL +  DGA+S +R  + K    +FSQ+Y   GYI+++   V+  +    K   H  W R   +L A+ N D S + ++F  F  FES +    + +  F+  F +  +I+G+ H+ +   ++K   +++++C+ +   +K V+MGDAAHAMVPF GQG+N GFED  +  EI+ Q  +  L      +S+ R N+   +      N +E   N+T+ S           +R  +  L+  +FPS     +T+  FS+  Y +   + Q  +K  S   ++ I  ++  I
Sbjct:    4 GKSINLALGVRAMSTMKRIGLKEKVIHIGVPIRDQIAHFGDTKGKLKRLPVLNDDDFILTINRQELSQILINEAEKYNNVKFHFNCKATKFDLKSESLIVQNSDNLSTVDG--DLFLACDGAHSSIRRSLLKAPGFNFSQKYSEFGYIDLS---VNSTQQCDLKLGTHYSWRRRGIILVAIVNKDQSLTVSMFATFSEFESNLVGPVESVLFFKNNFYEIFKILGEDHIRNTIARNKPQAIISVQCSQHVFFDKLVLMGDAAHAMVPFNGQGVNCGFEDCLVLQEIMDQYEEDELEDVIKEYSKVRTNETNII------NQMEWDVNLTLTSSVHGSLGWIREIRAHIKLLLCFIFPSS----FTLAAFSREKYSEIARKAQIVEKCTSLFTNVFIVFIISVI 391          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Match: kmo-2 (Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEMBL;Acc:Q21794])

HSP 1 Score: 155.221 bits (391), Expect = 3.698e-42
Identity = 112/403 (27.79%), Postives = 203/403 (50.37%), Query Frame = 2
Query:  209 GRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIH--ERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHI-WPRNEYMLTALPNLDGSFSGTLFMPFKMFES-IHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEIL-QKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSF---------RMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSI 1375
            G++INL+L  R +  +K + L+E+V+   +P+  ++ H  +  G LKR         I  + R+ L  IL+ +AE + +++ +FN K    +   +    +N  N+  ++   DL +  DGA+S +R  + K    +FSQ+Y   GYI+++   V+  +    K   H  W R   +L A+ N D S + ++F  F  FES +    + +  F+  F +  +I+G+ H+ +   ++K   +++++C+ +   +K V+MGDAAHAMVPF GQG+N GFED  +  EI+ Q  +  L      +S+ R N+   +      N +E   N+T+ S           +R  +  L+  +FPS     +T+  FS+  Y +   + Q  +K  S   ++ I  ++  I
Sbjct:    4 GKSINLALGVRAMSTMKRIGLKEKVIHIGVPIRDQIAHFGDTKGKLKRLPVLNDDDFILTINRQELSQILINEAEKYNNVKFHFNCKATKFDLKSESLIVQNSDNLSTVDG--DLFLACDGAHSSIRRSLLKAPGFNFSQKYSEFGYIDLS---VNSTQQCDLKLGTHYSWRRRGIILVAIVNKDQSLTVSMFATFSEFESNLVGPVESVLFFKNNFYEIFKILGEDHIRNTIARNKPQAIISVQCSQHVFFDKLVLMGDAAHAMVPFNGQGVNCGFEDCLVLQEIMDQYEEDELEDVIKEYSKVRTNETNII------NQMEWDVNLTLTSSVHGSLGWIREIRAHIKLLLCFIFPSS----FTLAAFSREKYSEIARKAQIVEKCTSLFTNVFIVFIISVI 391          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Fly
Match: cn (gene:FBgn0000337 transcript:FBtr0344723)

HSP 1 Score: 330.872 bits (847), Expect = 1.825e-108
Identity = 184/424 (43.40%), Postives = 256/424 (60.38%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGK-SSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIG 1384
            +L AL FA+    +V +YE   D R      GR+INL+LS RG  AL  V LE+EVL   IPM  RM+H+  G      Y   ++QC++++ RR L  +LL   +   +I+ +F  KL   N  E   +F+N    E +    DL+VG DGA+S VR    +    ++SQEYI  GY+E+  P   G+   M  N LHIWPRN +M+ ALPN D SF+ TL MPF++F  I ++ DLLE F+  F DAL +IG+  L   F K++   +V+I+C PY+  +K +I+GDAAHAMVP+YGQGMN+G EDVT+  +IL K    L +T   F+E R  DA A+C+LA YNY+E+R      +FR+RK LD L+  LFP  WIPLY  V FS +PY +C+  ++ QD++L RI        L +I+ G
Sbjct:   41 SLAALNFARMGN-HVDLYEYREDIRQALVVQGRSINLALSQRGRKALAAVGLEQEVLATAIPMRGRMLHDVRGNSSVVLYDPINNQCLYSVGRRQLNEVLLNACDKLPNIRCHFEHKLTSANLREGSMEFRNPAK-EAVAAHADLIVGCDGAFSSVRQNNVRLPGFNYSQEYIETGYLELCIPSKSGD-FQMPANYLHIWPRNTFMMIALPNQDKSFTVTLSMPFEIFAGIQNQNDLLEFFKLNFRDALPLIGEQQLIKDFFKTRPQFLVSIKCRPYHYADKALILGDAAHAMVPYYGQGMNAGMEDVTLLTDILAKQ-LPLDETLALFTESRWQDAFAICDLAMYNYVEMRDLTKRWTFRLRKWLDTLLFRLFPG-WIPLYNSVSFSSMPYRQCIANRKWQDQLLKRIFG---ATFLAAIVTG 456          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Zebrafish
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:368242])

HSP 1 Score: 348.591 bits (893), Expect = 4.863e-115
Identity = 182/407 (44.72%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            +LNA F A+   F+V +YE   D R      GR+INL+LS+RG  ALK V +E++++ K IPM+ARMIH  +G      YGK  Q I +++R  L   LL  AE + + ++NFN KL+D +       F    + +  E + DL+VG DGA+S VR    +  R ++SQ YIPHGY+E+T PP DG+  +M+ N LHIWPRN +M+ ALPNLD +F+ TLFMPF+ FE I +  +LL  F K FPD++ +IG   L   F +     MV+++C PY+L EKCV+MGDAAHA+VPFYGQGMN+GFED  +F EI+ + + NL      ++  R  D  A+ +LA YNY+E+R +V    F  RK LDNL++   P   +PLYTMV F++  Y   V     Q+K+++R
Sbjct:   29 SLNACFLAK-RGFDVEVYESREDIRQAKVVKGRSINLALSHRGRQALKHVGMEDKIVSKGIPMHARMIHNVNGKRSPIPYGKKGQYILSVDRANLNKELLTAAEAYPNTRLNFNHKLHDWSPKTGTMTFIG-SDGQKTETQADLIVGCDGAFSAVRKQFLRQSRFNYSQTYIPHGYMELTMPPKDGD-FAMEPNYLHIWPRNTFMMIALPNLDRTFTCTLFMPFEDFEKIRTGDELLRFFHKYFPDSVPLIGVEALKQDFFRLPAQAMVSVKCCPYHLFEKCVLMGDAAHAVVPFYGQGMNAGFEDCLVFDEIMDQFNENLAAVLQEYTRVRVPDDHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPQTIVPLYTMVTFTRTRYNDAVNRWHWQNKVITR 432          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 344.354 bits (882), Expect = 2.374e-113
Identity = 188/419 (44.87%), Postives = 266/419 (63.48%), Query Frame = 2
Query:  122 NALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDI-EKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSI 1375
            NA FFA+   F V +YE   D R      GR+INL+LS+RGL ALK V L+E++    IPM ARMIH   G      YGK  Q I +++R  L   LL+ AE + ++ ++F  KL D N +     F  L NME+I EKK DL+VG DGA+S VR    +  R ++S  YIPHGY E+T PP  G + +M+ N LHIWPRN +M+ ALPNLD SF+ TLFMPF+ FE + +   +L+ F+  FPD++E+IG+  L + F       M++++C+ + +  KCVIMGDAAHA+VPFYGQGMN+GFED  +F E++++   NL    + FS  R  DA A+ +LA YNY E+R +V    F  RK +DN++N++ P+ +IPLYTMV FS+I Y + +   + Q KI++ +   ++G   GS+
Sbjct:   23 NACFFAK-KGFQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTF--LNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKG-EFAMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKKIIN-VGLFTVGTT-GSV 435          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 341.658 bits (875), Expect = 1.092e-112
Identity = 184/402 (45.77%), Postives = 256/402 (63.68%), Query Frame = 2
Query:  122 NALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDI-EKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDK 1324
            NA FFA+   F V +YE   D R      GR+INL+LS+RGL ALK V L+E++    IPM ARMIH   G      YGK  Q I +++R  L   LL+ AE + ++ ++F  KL D N +     F  L NME+I EKK DL+VG DGA+S VR    +  R ++S  YIPHGY E+T PP  G + +M+ N LHIWPRN +M+ ALPNLD SF+ TLFMPF+ FE + +   +L+ F+  FPD++E+IG+  L + F       M++++C+ + +  KCVIMGDAAHA+VPFYGQGMN+GFED  +F E++++   NL    + FS  R  DA A+ +LA YNY E+R +V    F  RK +DN++N++ P+ +IPLYTMV FS+I Y + +   + Q K
Sbjct:   23 NACFFAK-KGFQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTF--LNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKG-EFAMEPNYLHIWPRNTFMMIALPNLDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKK 420          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 302.753 bits (774), Expect = 4.986e-97
Identity = 177/426 (41.55%), Postives = 255/426 (59.86%), Query Frame = 2
Query:  122 NALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDI-EKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGN-KHSM------DKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSI 1375
            NA FFA+   F V +YE   D R      GR+INL+LS+RGL ALK V L+E++    IPM ARMIH   G      YGK  Q I +++R  L   LL+ AE + ++ ++F  KL D N +     F  L NME+I EKK DL+VG DGA+S VR    +  R ++S  YIPHGY E+T PP  G  + S+       K C        +++  L   D SF+ TLFMPF+ FE + +   +L+ F+  FPD++E+IG+  L + F       M++++C+ + +  KCVIMGDAAHA+VPFYGQGMN+GFED  +F E++++   NL    + FS  R  DA A+ +LA YNY E+R +V    F  RK +DN++N++ P+ +IPLYTMV FS+I Y + +   + Q KI++ +   ++G   GS+
Sbjct:   23 NACFFAK-KGFQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTF--LNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGEVRFSVVFLFLDAKMCK---KNKTFLMVCLFQQDKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVTFSRIRYHEVILRWKWQKKIIN-VGLFTVGTT-GSV 440          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Match: bend3 (BEN domain containing 3 [Source:Xenbase;Acc:XB-GENE-6051071])

HSP 1 Score: 287.73 bits (735), Expect = 2.075e-92
Identity = 164/386 (42.49%), Postives = 227/386 (58.81%), Query Frame = 2
Query:  122 NALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDI-EKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFS 1276
            NA FFA+   F V +YE   D R      GR+INL+LS+RGL ALK V L+E++    IPM ARMIH   G      YGK  Q I +++R  L   LL+ AE + ++ ++F  KL D N +     F  L NME+I EKK DL+VG DGA+S VR    +  R ++S  YIPHGY E+T PP  G                          D SF+ TLFMPF+ FE + +   +L+ F+  FPD++E+IG+  L + F       M++++C+ + +  KCVIMGDAAHA+VPFYGQGMN+GFED  +F E++++   NL    + FS  R  DA A+ +LA YNY E+R +V    F  RK +DN++N++ P+ +IPLYTMV  S
Sbjct:   23 NACFFAK-KGFQVELYEAREDIRYARMVSGRSINLALSHRGLQALKAVGLDEKIAAMGIPMRARMIHSVKGRKSSIPYGKQHQYILSVDRANLNKELLSAAEKYSNVTMHFEHKLRDCNVDSGTMTF--LNNMENIIEKKADLIVGCDGAFSVVRKQFMRKSRFNYSHVYIPHGYKELTIPPRKGE-------------------------DKSFTCTLFMPFEDFEKLTTGDQVLDFFKTYFPDSIELIGEKKLTEDFFLLPPQAMISVKCSSFCIDHKCVIMGDAAHAVVPFYGQGMNAGFEDCLVFSELMEQYQNNLRICLHEFSRLRVPDAHAISDLAMYNYKEMRAHVNSKWFIFRKQVDNILNAIMPTTFIPLYTMVRIS 380          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Match: Kmo (kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [Source:MGI Symbol;Acc:MGI:2138151])

HSP 1 Score: 345.125 bits (884), Expect = 1.049e-113
Identity = 176/407 (43.24%), Postives = 257/407 (63.14%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
             LNA F A+ + F V +YE   D R      GR+INL+LSYRG  ALK + LE++++ K +PM ARMIH  SG      YG  SQ I ++ R  L   LL   E + + +++F  KL      E +        +   +   DL+VG DGAYS VR  + K  R D++Q+YIPHGY+E+T PP +G +++M+ NCLHIWPRN YM+ ALPN+D SF+ TLFMPF+ FE + ++ D+L+ F+K FPDA+ ++G+  L   F       M++++C+P++L   CV+MGDAAHA+VPF+GQGMN+GFED  +F E++ K + NL      FS  R  D  A+ +L+ YNY+E+R +V    F  +K+LD  ++++ PS +IPLYTMV F++I Y + V     Q K+++R
Sbjct:   21 ALNACFLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPR-DVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPPKNG-EYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKKVINR 424          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Match: Kmo (kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [Source:MGI Symbol;Acc:MGI:2138151])

HSP 1 Score: 302.368 bits (773), Expect = 2.105e-97
Identity = 154/350 (44.00%), Postives = 221/350 (63.14%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLEL 1165
             LNA F A+ + F V +YE   D R      GR+INL+LSYRG  ALK + LE++++ K +PM ARMIH  SG      YG  SQ I ++ R  L   LL   E + + +++F  KL      E +        +   +   DL+VG DGAYS VR  + K  R D++Q+YIPHGY+E+T PP +G +++M+ NCLHIWPRN YM+ ALPN+D SF+ TLFMPF+ FE + ++ D+L+ F+K FPDA+ ++G+  L   F       M++++C+P++L   CV+MGDAAHA+VPF+GQGMN+GFED  +F E++ K + NL      FS  R  D  A+ +L+ YNY+E+
Sbjct:   21 ALNACFLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPR-DVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPPKNG-EYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNYIEV 367          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Match: Kmo (kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [Source:MGI Symbol;Acc:MGI:2138151])

HSP 1 Score: 137.502 bits (345), Expect = 6.961e-37
Identity = 77/188 (40.96%), Postives = 106/188 (56.38%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNK 679
             LNA F A+ + F V +YE   D R      GR+INL+LSYRG  ALK + LE++++ K +PM ARMIH  SG      YG  SQ I ++ R  L   LL   E + + +++F  KL      E +        +   +   DL+VG DGAYS VR  + K  R D++Q+YIPHGY+E+T PP +G K
Sbjct:   48 ALNACFLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPR-DVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPPKNGEK 233          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q7Q6A7|KMO_ANOGA (Kynurenine 3-monooxygenase OS=Anopheles gambiae OX=7165 GN=kh PE=3 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 2.911e-119
Identity = 183/400 (45.75%), Postives = 255/400 (63.75%), Query Frame = 2
Query:  158 VTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFY-GKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEK-----KFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRI 1339
            V +YE   D RT    +GR+INL+LS RG  AL  V LE+ +L   IPM  RM+H+ +G  K   Y   ++QCI+++ R+ L  +LL  AE + +I ++FN KL   N +E      NL  ++ + K     + DL+VG DGAYS VR  + K  R DFSQ YI HGY+E+  PP  G + +M  N LHIWPR ++M+ ALPN D +++ TLFMPF  F SI  +  LL+ F + FPDA+E+IG+  L   F K+K   +V I+C PY++G K +I+GDAAHAMVPFYGQGMN+GFED ++  E+  +   +L +    FSEKR  DA A+C+LA YNY+E+R  VT  S+ +RK LD L+  + P+ W+PLY  V FS + Y KC+  +  QDKIL+R+
Sbjct:   47 VNLYEYREDIRTAELVIGRSINLALSARGRRALAEVGLEDALLNHGIPMSGRMLHDVNGKCKIVPYDANTNQCIYSVGRKHLNEVLLNAAEKYPNIHLHFNHKLVSANLDEG-----NLSMVDPVTKDVKSARADLIVGCDGAYSAVRKEIVKRPRYDFSQTYIEHGYLELCIPPTAGGEFAMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIELIGRERLVKDFFKTKAQPLVMIKCRPYHIGAKALIIGDAAHAMVPFYGQGMNAGFEDCSVLTELFNQYGTDLARILPEFSEKRWEDAHAICDLAMYNYIEMRDLVTKRSYLLRKKLDELLFWMMPNTWVPLYNSVSFSHMRYSKCIANRAWQDKILTRV 441          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q86PM2|KMO_AEDAE (Kynurenine 3-monooxygenase OS=Aedes aegypti OX=7159 GN=kh PE=1 SV=2)

HSP 1 Score: 354.369 bits (908), Expect = 2.206e-116
Identity = 178/396 (44.95%), Postives = 247/396 (62.37%), Query Frame = 2
Query:  155 NVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFY-GKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRI 1339
             V +YE   D RT    +GR+INL+LS RG  AL  V LE+ +L+  IPM  RM+H+  G  K   Y   ++QCI+++ R+ L  +LL  AE + +I + FN KL   N +E    F +    E    K DL+VG DGAYS VR  + K    D+SQ YI HGY+E+  PP      +M  N LHIWPR ++M+ ALPN D +++ TLFMPF  F SI    DLL+ F   FPDA+++IG+  L   F K++   +V I+C PYN+G K VI+GDAAHAMVPFYGQGMN+GFED T+  E+  ++  ++ +    FS+ R  DA ++C+LA YNY+E+R  VT  S+  RK LD L+  + P+ W+PLY  V FS + Y KC+  ++ QDKIL+R+
Sbjct:   42 TVDLYEYREDIRTAELVIGRSINLALSARGRKALAEVGLEDALLQHGIPMKGRMLHDLKGNRKIVPYDANTNQCIYSVGRKHLNEVLLDAAEKYPNIHLYFNKKLQSANLDEGEMSFIDPTTKESTHTKADLIVGCDGAYSAVRKEIVKRPGYDYSQTYIEHGYLELCIPPTKDGDFAMPHNYLHIWPRGKFMMIALPNQDRTWTVTLFMPFTNFNSIKCDGDLLKFFRTYFPDAIDLIGRERLVKDFFKTRPQSLVMIKCKPYNVGGKAVIIGDAAHAMVPFYGQGMNAGFEDCTVLTELFNQHGSDVDRILAEFSDTRWEDAHSICDLAMYNYVEMRDLVTKRSYLFRKKLDELLYWMLPNTWVPLYNSVSFSHMRYSKCIANRKWQDKILTRV 437          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q1RLY6|KMO_DANRE (Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 GN=kmo PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 1.105e-113
Identity = 182/407 (44.72%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            +LNA F A+   F+V +YE   D R      GR+INL+LS+RG  ALK V +E++++ K IPM+ARMIH  +G      YGK  Q I +++R  L   LL  AE + + ++NFN KL+D +       F    + +  E + DL+VG DGA+S VR    +  R ++SQ YIPHGY+E+T PP DG+  +M+ N LHIWPRN +M+ ALPNLD +F+ TLFMPF+ FE I +  +LL  F K FPD++ +IG   L   F +     MV+++C PY+L EKCV+MGDAAHA+VPFYGQGMN+GFED  +F EI+ + + NL      ++  R  D  A+ +LA YNY+E+R +V    F  RK LDNL++   P   +PLYTMV F++  Y   V     Q+K+++R
Sbjct:   29 SLNACFLAK-RGFDVEVYESREDIRQAKVVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHNVNGKRSPIPYGKKGQYILSVDRANLNKELLTAAEAYPNTRLNFNHKLHDWSPKTGTMTFIG-SDGQKTETQADLIVGCDGAFSAVRKQFLRQSRFNYSQTYIPHGYMELTMPPKDGD-FAMEPNYLHIWPRNTFMMIALPNLDRTFTCTLFMPFEDFEKIRTGDELLRFFHKYFPDSVPLIGVEALKQDFFRLPAQAMVSVKCCPYHLFEKCVLMGDAAHAVVPFYGQGMNAGFEDCLVFDEIMDQFNENLVAVLQEYTRVRVPDDHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPKTIVPLYTMVTFTRTRYNDAVNRWHWQNKVITR 432          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q21795|KMO_CAEEL (Kynurenine 3-monooxygenase OS=Caenorhabditis elegans OX=6239 GN=kmo-1 PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 6.769e-113
Identity = 180/441 (40.82%), Postives = 273/441 (61.90%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSG-PLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEK------------IAKFKN---LKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFES-IHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGI 1387
             LNA FFAQ   ++V++YE   D RT+    GR+INL+LS RG  AL+ V L+E ++ + +P+YAR+IH + G    R  YGK  + I ++ RR L  +++ +AE   +++  F  K+ +V++++K            I  F N    +   +   + DL++  DGAYS VR  +    R DFSQEYI HGY+E+     + N+ + ++N  H+WPR  + L AL N D +F+ T+F PF  FE  + + +D+L  FE+ FPDA  ++GK H+ D F + K   +V+I+C+P++  +  V+MGDAAHAMVPFYGQGMN GFED  +F E L++   ++ K    +S+ R NDA ++ +LA YNY EL+  V   S+++RK  D +MNS+FP  WIPLY+MV FS+IPY + +E +++QDKILSRI + +  + L     GI
Sbjct:   14 ALNACFFAQ-KGWDVSVYEFRKDIRTMKHVQGRSINLALSQRGKSALEAVGLKEYIVNQGVPLYARLIHNKDGKTYSRQPYGKPGEHIVSINRRHLNEVMITQAEKSPNVKFFFEHKVKNVDYDKKQLVVQCTSQPSKIPTFGNKSPPQEHAEFHVEADLILACDGAYSAVRRSLMTIPRFDFSQEYIEHGYVELNIM-ANNNEFAFEENVFHLWPRGHFTLIALANRDKTFTVTIFAPFSEFEKHMSTSEDVLSFFEENFPDAFLLLGKEHIADTFNRVKPQPLVSIKCSPHSFFDNLVLMGDAAHAMVPFYGQGMNCGFEDCLVFSETLEEYGNDIAKAVKVYSDGRVNDAHSINDLAMYNYEELKDLVNKSSYKLRKKFDTIMNSIFPKSWIPLYSMVTFSRIPYSEVIERRKRQDKILSRIMTTTSTLALIGAAAGI 452          
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Match: sp|Q91WN4|KMO_MOUSE (Kynurenine 3-monooxygenase OS=Mus musculus OX=10090 GN=Kmo PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 7.336e-113
Identity = 176/407 (43.24%), Postives = 257/407 (63.14%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
             LNA F A+ + F V +YE   D R      GR+INL+LSYRG  ALK + LE++++ K +PM ARMIH  SG      YG  SQ I ++ R  L   LL   E + + +++F  KL      E +        +   +   DL+VG DGAYS VR  + K  R D++Q+YIPHGY+E+T PP +G +++M+ NCLHIWPRN YM+ ALPN+D SF+ TLFMPF+ FE + ++ D+L+ F+K FPDA+ ++G+  L   F       M++++C+P++L   CV+MGDAAHA+VPF+GQGMN+GFED  +F E++ K + NL      FS  R  D  A+ +L+ YNY+E+R +V    F  +K+LD  ++++ PS +IPLYTMV F++I Y + V     Q K+++R
Sbjct:   21 ALNACFLAKRN-FQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPR-DVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPPKNG-EYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKKVINR 424          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A1S3JIN9 (Kynurenine 3-monooxygenase OS=Lingula unguis OX=7574 GN=LOC106173625 PE=3 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 1.024e-138
Identity = 207/424 (48.82%), Postives = 285/424 (67.22%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGI 1387
             LNA +F+Q   F V +YE+ PD RT+    GR+INL+LS RG  ALK V +EE V    IPMYARMIH   G  K   YGK  Q I +++RR L   LL +AE H  ++++F+ KL   N +     FK+    +D+  + DL+VG DGAYS VR  M K++R DFSQEYIPHGY+E+  PP    KH+M+ N LHIWPRN YM+ ALPN DGSF+ T+FMPF++FE+I +++DL+  F+++FPD+L ++G+  L + F  +K   MV+++C PY+  +K VIMGDAAHAMVPFYGQGMN GFED  IF++IL + + + G+    F+  RN DA+AMC+LA YNY+E+R +V    F +RK +DN ++ L P  WIPLYTMV F++  Y KC+  ++KQD IL R   L   V+  S+ +G+
Sbjct:   18 ALNACYFSQRG-FEVDLYERRPDIRTLEHVRGRSINLALSCRGREALKGVGMEEMVTATGIPMYARMIHNTDGTRKPILYGKKDQYIMSVDRRKLNEDLLTEAEKHPGVRLHFSHKLVSCNVDTGEMHFKDASG-KDLHTRSDLIVGCDGAYSAVRQQMMKSMRFDFSQEYIPHGYMELHMPPSANGKHAMETNYLHIWPRNAYMMIALPNQDGSFTVTMFMPFEVFEAIQTEEDLMRFFKEKFPDSLPLLGEQALKETFFNNKALPMVSVKCGPYHHKDKLVIMGDAAHAMVPFYGQGMNCGFEDCLIFNDILDQTNNDFGEALKKFTAYRNVDARAMCDLAMYNYIEMRASVNSKLFLLRKKVDNFLHWLLPDRWIPLYTMVSFTRTRYHKCINGRKKQDMILERGAVLL--VLGSSLFVGV 437          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A2C9JJ57 (Kynurenine 3-monooxygenase OS=Biomphalaria glabrata OX=6526 GN=KMO PE=3 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.958e-133
Identity = 199/424 (46.93%), Postives = 285/424 (67.22%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGI 1387
             LNA + A+   + V +YE  PD RT+    G++INL+LS RG  ALK V LE+ V K  IPM+ARMIH+ +G  +   YG   Q I +++RR+L  I+L+  E    ++I+F+ KL   NF    A F+N +    + K+FDL++G DGAYS VR  M K  R D+ Q YIPHGY+E+  PP   N+ +M+ N LHIWPRNEYM+ ALPNLD SF+ TLFMPF+MFE+I +++ L++ F++EFPDAL ++G+  L   F  SK   ++T++C+PY++  K V++GDAAHAMVPFYGQGMN G ED  I  EIL   D +  K    +++KRN DAKA+C+LA YNY+E+R  V   SF +RK LDNL+  +FP  W+PLYTMV F++I Y + ++ ++ QD++L+R   L++  + G + +G+
Sbjct:   21 ALNACYMAR-RGYKVDLYEMRPDIRTMKVVRGKSINLALSCRGREALKRVGLEDAVTKYGIPMHARMIHDLNGRRRPILYGTKDQYIMSIDRRLLNEIMLSAVEKFPDVEIHFSHKLTTCNFETGEATFENEQG-HKVTKQFDLIIGCDGAYSAVRKQMMKLSRFDYQQTYIPHGYMELNIPPNSQNEFAMEINYLHIWPRNEYMMIALPNLDKSFTTTLFMPFEMFEAITTEEKLIQFFKEEFPDALPLLGQEELIKTFMSSKALPLITVKCHPYHVNNKAVLLGDAAHAMVPFYGQGMNCGMEDCIILDEILDAYDNDFSKALPAYTKKRNPDAKAICDLAMYNYIEMRSKVNTTSFLIRKKLDNLLFKIFPKTWVPLYTMVSFTRIGYQEAIKRREWQDQVLTR--CLTVLGITGVVGLGV 440          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: R7TPA4 (Kynurenine 3-monooxygenase OS=Capitella teleta OX=283909 GN=KMO PE=3 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 7.689e-133
Identity = 203/424 (47.88%), Postives = 276/424 (65.09%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNL-DGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIG 1384
             LNA F ++   F+V I+E  PD R      GR+INL+LS RGL ALK V L+EE+ +  IP+++RMIH+  G  +   YG   QCI +++R+ L  +LL  AE + S+ I+F  K    +F    + FK   +   +  K DL++G DGAYS VRH + K  RMDF Q YIPHGYIE+  PP   NK +M+ N LHIWPRNE+M+ ALPN+ D SF  TLFMPF++FE+  +++ +LE F K FPD++E+IG+  + + F   K   +VT++C PY++G+ CVIMGDAAHAMVPFYGQGMN GFED  +F + + K D +  K    +SE RN DAKAMCELA YNY E+R++V    F  RK  DN ++ L PS W+PLYT V FSQ+ Y KC+  +  QDKIL+ + S   G+  G+I+  
Sbjct:   18 ALNACFLSKRG-FDVHIHELRPDIRKQELVRGRSINLTLSTRGLEALKAVGLDEEMKQSGIPLHSRMIHDLDGTRRPISYGTKDQCIMSVDRKYLNGLLLTAAERNPSVNIHFEHKFVSCDFQAGTSIFKK-PDGSKVTAKSDLIIGCDGAYSSVRHQIMKATRMDFQQAYIPHGYIELRIPPTADNKFAMEVNYLHIWPRNEFMMIALPNVQDNSFVLTLFMPFEIFEAKKTREQVLEFFNKTFPDSIELIGREEIVNTFLSLKPLPLVTVKCQPYHVGDNCVIMGDAAHAMVPFYGQGMNCGFEDCLVFDQFMGKFDNDFAKVLPEYSEYRNPDAKAMCELALYNYTEMRESVNSKFFLARKHFDNFLHWLMPSTWVPLYTSVSFSQMRYHKCIHNRAWQDKILTIVIS-GAGIACGAIMFA 438          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A2C9K8S6 (Kynurenine 3-monooxygenase OS=Biomphalaria glabrata OX=6526 GN=KMO PE=3 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 1.770e-131
Identity = 197/419 (47.02%), Postives = 282/419 (67.30%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR-IQSLSIGVMLG 1369
             LNA + A+   + V ++EK PD RT+    G++INL+LS RG+ ALK V L+E V K CIPM+ARMIH+  G      YG   Q I +++RRVL  I+L+ +E   +++++F+ KL   NF    A F N +  + + K+FDL++G DGAYS VR  M K  R D+ Q YIPHGY+E+   P   N+ +M+KN L IWPR+EYM+ A+PNLD SF+ TL MPF+M ESI +++ L++ F+ EFPDA+ +IG+  L + F   K    +TI+C+PY++ +K VI+GDAAHAMVPFYGQG+N G ED  I  E+L + + +  K    ++ KRN DAKA+C+LA YNY+E+R  V   SF +RK LDNL+  +FP  W+PLYTMV F++I Y + ++ ++ QDKIL+R +  L+I  M+G
Sbjct:   24 ALNACYMAR-RGYKVDVFEKRPDIRTMKVVSGKSINLTLSCRGIEALKYVGLDEVVTKCCIPMHARMIHDLDGKQSPIMYGTKDQYIMSIDRRVLNEIMLSASEKFPNVEMHFSHKLTTCNFETGEATFDNEQG-QKVSKQFDLIIGCDGAYSAVRKQMMKLSRFDYQQTYIPHGYMELKILPNSRNEFAMEKNYLRIWPRHEYMMIAMPNLDKSFTTTLIMPFEMLESITTEEQLIQFFKAEFPDAVPLIGQQSLIETFMSRKALPFITIKCHPYHVNDKAVILGDAAHAMVPFYGQGINCGMEDCIILDELLDQYNNDFSKALPAYTNKRNPDAKAICDLAMYNYIEMRSKVNTTSFLIRKNLDNLLFKIFPKTWVPLYTMVSFTRIGYQEAIQRREWQDKILTRCLAVLAISGMVG 440          
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Match: A0A0L8H1W3 (Kynurenine 3-monooxygenase OS=Octopus bimaculoides OX=37653 GN=KMO PE=3 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 7.658e-131
Identity = 195/405 (48.15%), Postives = 277/405 (68.40%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQ--KNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDK 1324
            +LNA F A+   F V++YE   D R      GR+INL+LS RGL AL  V L E+V    IPMYARMIH R    +R  YG+ +Q I +++RR L  +LL  +E   +++++F  KL   +FN K        + E +E+ FD++ GNDGA+S VR+ + K  + DF Q++IPHGY+E++ PP +  + +M+ NCLHIWPR+E+M+ +LPNLD SF+ TLFMPF++FE++H+K DLL  FEK FPD+L +IG+  L + F   K   MVT++C+PYN+G K  IMGDAAHAMVPFYGQGMN+GFED  +  + L   KNDF+  +    ++E R+ DA ++C+LA YNY+E+R  V    F +RK++DNL+N LFP +WIPLY+MV FS+I Y +C+ +K+ QD+
Sbjct:   19 SLNACFMAKRG-FKVSLYELRKDIRKEAHVSGRSINLALSERGLSALNEVGLREKVRPFGIPMYARMIHNRDSTKRRIPYGRENQFIMSIDRRKLNELLLTVSESQPNVELHFEHKLKQCSFNGKPKAIFETPSKETVEQDFDVVFGNDGAFSAVRNQIMKTTKFDFQQKFIPHGYMELSIPPNEEGQFAMESNCLHIWPRDEFMMISLPNLDKSFTTTLFMPFELFETLHTKDDLLNFFEKTFPDSLPLIGRKSLVETFFSRKALPMVTVKCHPYNVGGKAAIMGDAAHAMVPFYGQGMNAGFEDCIVMSQFLDEYKNDFD--EALPKYTEFRHVDAVSICDLAMYNYVEMRSLVNSKLFLVRKLVDNLLNKLFPHHWIPLYSMVSFSRIRYHECIAKKKWQDQ 420          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Cavefish
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:103038724])

HSP 1 Score: 336.265 bits (861), Expect = 2.482e-110
Identity = 177/405 (43.70%), Postives = 251/405 (61.98%), Query Frame = 2
Query:  125 ALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNME-DIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            A FFA+   F+V ++E   D R      GR+INL+LS+RG  ALK + +EE+++   IPM ARMIH  SG      YG+  Q I ++ R  L   LL+  E + + ++NF+ KL D +       F      E D E   DL+VG DGA+S  R    +  R D+SQ YIPHGYIE+T PP +G+  +M+ N LHIWPRN +M+ ALPN+D +F+ TLFMPF+ FE I +  +L+  F+K FPD++ +IG   L   F       +V ++C+PY++ ++CV+MGDAAHAMVPFYGQGMN+GFED  +F+EI+ + + +       FS  R  D  AMCELA YNY+E+R +V    F  RK LD  +N + P   IPLYTM+ F++  Y + V + Q Q+K+++R
Sbjct:   34 ASFFAK-RGFDVALFEYREDIRCAKVVKGRSINLALSHRGRQALKHIGIEEKIVSMGIPMRARMIHSLSGKCSPIPYGRKGQYILSVGRANLNKELLSVVETYPNTELNFSHKLLDWSPETGTMTFHGPDGAERDFEA--DLIVGCDGAFSTTRKQFLRRSRFDYSQTYIPHGYIELTMPPRNGD-FAMEPNFLHIWPRNTFMMIALPNVDKTFTCTLFMPFEDFEKITTGDELIAFFQKHFPDSIPLIGVEALKRDFFLLPAQALVWVKCSPYHMLDRCVLMGDAAHAMVPFYGQGMNAGFEDCLVFNEIMDQFNEDFAAVLPEFSRVRAPDDHAMCELAMYNYIEMRSHVNSRYFLFRKYLDGALNYIMPKTIIPLYTMITFTRTRYHEAVIQWQWQNKVITR 434          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Cavefish
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:103038724])

HSP 1 Score: 321.627 bits (823), Expect = 3.820e-105
Identity = 172/401 (42.89%), Postives = 243/401 (60.60%), Query Frame = 2
Query:  152 FNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCI-----FAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNME-DIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSR 1336
            F+V ++E   D R      GR+INL+LS+RG  ALK + +EE+++   IPM ARMIH  SG      YG+  Q        A   +VL    L   E + + ++NF+ KL D +       F      E D E   DL+VG DGA+S  R    +  R D+SQ YIPHGYIE+T PP +G+  +M+ N LHIWPRN +M+ ALPN+D +F+ TLFMPF+ FE I +  +L+  F+K FPD++ +IG   L   F       +V ++C+PY++ ++CV+MGDAAHAMVPFYGQGMN+GFED  +F+EI+ + + +       FS  R  D  AMCELA YNY+E+R +V    F  RK LD  +N + P   IPLYTM+ F++  Y + V + Q Q+K+++R
Sbjct:    2 FDVALFEYREDIRCAKVVKGRSINLALSHRGRQALKHIGIEEKIVSMGIPMRARMIHSLSGKCSPIPYGRKGQVKPLFVKLANPYQVLGA--LKMVETYPNTELNFSHKLLDWSPETGTMTFHGPDGAERDFEA--DLIVGCDGAFSTTRKQFLRRSRFDYSQTYIPHGYIELTMPPRNGD-FAMEPNFLHIWPRNTFMMIALPNVDKTFTCTLFMPFEDFEKITTGDELIAFFQKHFPDSIPLIGVEALKRDFFLLPAQALVWVKCSPYHMLDRCVLMGDAAHAMVPFYGQGMNAGFEDCLVFNEIMDQFNEDFAAVLPEFSRVRAPDDHAMCELAMYNYIEMRSHVNSRYFLFRKYLDGALNYIMPKTIIPLYTMITFTRTRYHEAVIQWQWQNKVITR 397          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Sea Lamprey
Match: KMO (kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc:HGNC:6381])

HSP 1 Score: 221.861 bits (564), Expect = 9.021e-70
Identity = 107/227 (47.14%), Postives = 156/227 (68.72%), Query Frame = 2
Query:  683 SMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVM 1363
            +M+KN LHIWPRN +M+ ALPN D SF+ TLFMPF+ FE I   + +L+ F + FPDA+ +IG   L   F       +V+I+C+PY++G + VIMGDAAHAMVPFYGQGMN+GFED  +F E++++ + +LG+    FS  R  D +A+ +LA YNY+E+R +V    F  RK +DNL+  L P  ++PLYTMV F++I Y + V++ + Q+K+++    L IGV+
Sbjct:    2 AMEKNYLHIWPRNTFMMIALPNNDHSFTCTLFMPFEEFECITEPEHVLDFFSRYFPDAIPLIGAAELQRDFFLLPAQALVSIKCSPYHVGRRVVIMGDAAHAMVPFYGQGMNAGFEDCLVFDELMEEFNCDLGRVLPEFSRLRTPDDQAIVDLAMYNYIEMRAHVNSRWFLFRKRVDNLLYLLMPGTFVPLYTMVTFTRIRYHEVVKKCKLQNKVVNS-ALLGIGVL 227          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Yeast
Match: BNA4 (Kynurenine 3-monooxygenase; required for the de novo biosynthesis of NAD from tryptophan via kynurenine; expression regulated by Hst1p; putative therapeutic target for Huntington disease [Source:SGD;Acc:S000000194])

HSP 1 Score: 266.544 bits (680), Expect = 1.913e-84
Identity = 160/431 (37.12%), Postives = 249/431 (57.77%), Query Frame = 2
Query:  119 LNALFFAQYDKFNVTIYEKSPDNR--TIHQDVGRNINLSLSYRGLLALKIVDLE--EEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNF--NEKIAKFKNLKNMEDIE-KKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVD------GNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPF-KMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNL-GEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCF-SQIPYMKCVEEKQKQDKILSRIQSLSIGVM 1363
            L AL F++ + +NVT+Y+   D R  T      ++INL++S RG+ ALK +D +  E +L+  IPM  RMIH+  G  +   YG   + I ++ R VL N LL + E   + ++ F  KL  + +  +++I  F   ++++    +K+D ++G DGAYS  R  M + + MDFSQEY+   YIE+  PP +      G   ++  + LHIWPR+++ML AL N DGSF+ T F    ++ + I SK  + E   + FPD + I+        F       +V + C PY++ G K +++GDAAHAMVPFYGQGMN GFEDV I   +L+K+  +  +    +++ R+ D  ++ ELA  NY E+  +VT   F +RK LD L + +    WIPLYTM+ F S I Y + +E   KQ +IL  ++SL++G++
Sbjct:   16 LAALAFSK-EGYNVTLYDFRQDPRLDTTKNKNLKSINLAISARGIDALKSIDPDACEHILQDMIPMKGRMIHDLKGRQESQLYGLHGEAINSINRSVLNNSLLDELE-KSTTELKFGHKLVKIEWTDDKQICHFAIGEDLKTPHTEKYDFVIGCDGAYSATRSQMQRKVEMDFSQEYMNLRYIELYIPPTEEFKPNYGGNFAIAPDHLHIWPRHKFMLIALANSDGSFTSTFFGSKDQISDLITSKSRVREFLIENFPDIINIMDLDDAVKRFITYPKESLVCVNCKPYDVPGGKAILLGDAAHAMVPFYGQGMNCGFEDVRILMALLKKHSGDRSRAFTEYTQTRHKDLVSITELAKRNYKEMSHDVTSKRFLLRKKLDALFSIIMKDKWIPLYTMISFRSDISYSRALERAGKQTRILKFLESLTLGML 444          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO45190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTD3])

HSP 1 Score: 358.992 bits (920), Expect = 2.041e-120
Identity = 184/412 (44.66%), Postives = 255/412 (61.89%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLS 1351
             L+A+FFA+   + V +YE   D R +     R+INL+LS RG+ AL  V  E  +++  IPM+ARMIH   G      YGK  Q I ++ERR +   LL  AE H ++ ++F  KL  V+  +    +K     E ++   DLLVG DGAYS VR  + +  R D+SQEYIPHGY E+  PP    KH M+ N LHIWPRN +M+ ALPN DG+F+ TLF PF  F+ I +  D+L  F KEFPD + +IG+  L   +  + +  MV+++C PY++ +K VI+GDAAHAMVPFYGQGMN GFED  + +EIL K++ NLG     +S  RN DA+AMC+LA YNY+E+R +V    F ++K   + ++ L P   IPLYTMV FS+IPY   ++  + QD +     SL+
Sbjct:    3 ALSAVFFAK-RGYKVDLYESRQDPRKLQFVSLRSINLALSVRGISALAAVGCERPMVESGIPMHARMIHTLKGSKYAIPYGKKGQYIMSVERRKMNEHLLTVAESHPNVTLHFGHKLKKVDVEKAHMTYKTSSAGEVVDVDADLLVGCDGAYSAVRKEIMRRPRFDYSQEYIPHGYKEICLPPDANGKHIMELNYLHIWPRNTFMMIALPNQDGTFTCTLFAPFDTFDKIKTNDDVLNFFNKEFPDFIPLIGEEKLLSDWFTNPVGSMVSVKCKPYHVADKVVILGDAAHAMVPFYGQGMNCGFEDCLVLNEILDKHNDNLGAALEEYSMLRNPDAEAMCDLAMYNYIEMRSSVNSTLFLVKKYFFSFLHWLMPKTIIPLYTMVTFSRIPYHTVIKRSKLQDNVSGTWSSLA 413          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO43899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX40])

HSP 1 Score: 308.916 bits (790), Expect = 3.150e-100
Identity = 173/434 (39.86%), Postives = 263/434 (60.60%), Query Frame = 2
Query:   56 NMNENKDKLEXXXXXXXXXXTLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFK-NLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPP-VDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKL-------HLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKIL 1330
            ++ ++K + EI I+G GLVG+L A++ A++  + V IYE   D R +     R+INL+LS+RG+ AL +V  +E++L+  + M AR IH R+       YG + +CI+++ERR +   LL  AE + ++  +F  KL   + +   A F     +   +    DLLVG DGA+S +R  M    R D+SQ YIPH Y E++ PP  DG  H ++ + LHIWPR  +M+ A  N D SF+ TLF P++ FE I++K+D+L  F  EFPD ++ + ++       H C L        ++ + C+PY+  +K VI+GDAAHAMVPFY QGMN GFED  +  E+L K+  ++G   + ++  RN D KA+C+LA YNY E+R +VT   F  R+ L  L++  FP   +PLYTMV FS+IPY + +   ++QD+I+
Sbjct:   25 SLGDDKKRTEIAIIGAGLVGSLCAIYLARH-GYRVDIYEARKDPRLVKTVSQRSINLALSHRGIAALAVVGCDEQLLEDSVAMSARYIHARNRQTYSMQYGTNGECIYSVERRKVNEFLLNVAESYMNVTFHFEHKLRSADLD--CASFICTSPDGSALRVNADLLVGCDGAFSALRREMMARTRFDYSQAYIPHWYKEISLPPRPDGEPH-IEPSYLHIWPRTSFMMIAQANKDNSFTCTLFAPYEHFERINTKEDVLGFFNSEFPDFMDHLEEVNSDHSSNHFCHL-------GLILLPCSPYHYKDKAVILGDAAHAMVPFYAQGMNCGFEDCLVLDELLVKHKKDIGAALSEYTSVRNPDGKAICDLAMYNYTEMRSSVTSKIFIWRRTLYLLLHKCFPRLLLPLYTMVTFSRIPYHEVIIRTRRQDRIV 447          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO45186 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC7])

HSP 1 Score: 277.33 bits (708), Expect = 9.314e-90
Identity = 149/357 (41.74%), Postives = 203/357 (56.86%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTML 1186
             L+A+FFA+   + V +YE   D R +     R+INL+LS RG+ AL  V  E  +++  IPM+ARMIH   G      YGK  Q              ++  E+                                ++   DLLVG DGAYS VR  + +  R D+SQEYIPHGY E+  PP    KH M+ N LHIWPRN +M+ ALPN DG+F+ TLF PF  F+ I +  D+L  F KEFPD + +IG+  L   +  + +  MV+++C PY++ +K VI+GDAAHAMVPFYGQGMN GFED  + +EIL K++ NLG     +S  RN DA+AMC+LA YNY+E+   + M+
Sbjct:   24 ALSAVFFAKR-GYKVDLYESRQDPRKLQFVSLRSINLALSVRGISALAAVGCERPMVESGIPMHARMIHTLKGSKYAIPYGKKGQ--------------ISAGEV--------------------------------VDVDADLLVGCDGAYSAVRKEIMRRPRFDYSQEYIPHGYKEICLPPDANGKHIMELNYLHIWPRNTFMMIALPNQDGTFTCTLFAPFDTFDEIKTNDDVLNFFNKEFPDFIPLIGEEKLLSDWFTNPVGAMVSVKCKPYHVADKVVILGDAAHAMVPFYGQGMNCGFEDCLVLNEILDKHNDNLGAALEEYSMVRNPDAEAMCDLAMYNYIEVSIMLMMI 333          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Match: EDO26830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAY7])

HSP 1 Score: 238.81 bits (608), Expect = 5.425e-74
Identity = 139/383 (36.29%), Postives = 218/383 (56.92%), Query Frame = 2
Query:  302 MYARMIHE-RSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVR--HIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKM----FESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNN-------FSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQ-IPYMKCVEEKQKQDK-ILSRIQSLSIGVMLGSIIIGINRILQ 1402
            MY R+IH+         + G++++ I ++ R  L  ILL +AE HK++ I+FNTK   V+    IA FKN K  E+     D++ G DGA S +R  + + K     +SQ+Y+ HGY E+  P      H + K+ LHIWPR +YML ALPN+DGSF+ TLF+  +     F+ + S++ +   F+K+FPDAL +I   ++ D F  +    + T++C+P+      +IMGDAAHA+VPFYGQGMN+ FEDV +F EIL  N F      N+       + + R  +A A+ +LA  NY E+R +V    F+ ++ML+  +   FP+ +   Y+MV F++ + Y + + + + QDK +L+ I    I   L   I  +  +L+
Sbjct:    1 MYGRLIHDLEENTFASNYSGRANEYINSISRGDLNGILLTEAEKHKNVTIHFNTKCSSVDIENTIAHFKNDKTNEEFAIDADVIFGTDGAGSVLRKSYYLEKKFLFSYSQDYLTHGYKELEIPADANGNHQLSKDHLHIWPRGDYMLIALPNMDGSFTVTLFLGHEEGTYNFKELDSEEKIKNFFKKQFPDALILIP--NIADEFVNNPTGALGTVKCSPWYYKSNTMIMGDAAHAVVPFYGQGMNASFEDVVVFDEIL--NHFERSPEINSWETVFKAYEKARKANADAIGDLAVENYYEMRDHVANPLFKQKRMLEMELEKNFPTAYFSKYSMVTFNEDMGYHEAMVKGRAQDKALLNMIADKDISTSLDMTISELEIVLK 379          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:101158471])

HSP 1 Score: 347.436 bits (890), Expect = 2.505e-114
Identity = 183/437 (41.88%), Postives = 274/437 (62.70%), Query Frame = 2
Query:   65 ENKDKLEXXXXXXXXXXTLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLS-IGVMLGS 1372
            E + K+ +      +VG LNA FFA+   FNV ++E   D R      GR+INL+LS+RG  ALK V +E++++ K IPM+ARMIH  SG      YG+  Q I +++R  L   LL++AE + +  +NF  KL D + +  +  F      +D +   DL+VG DGA+S  R    +  R ++SQ YIPHGY+E+T PPV+G + +M  N LHIWPRN +M+ ALPNLD +F+ TLFMPF+ FE I +  ++++ F+  FPD + +IG   L   + +     MV+++C+PY++G+KCV+MGDAAHA+VPFYGQGMN+GFED  +F E++++ + +       ++  R  D  A+ +LA YNY+E+R +V    F  RK +DN+++   P   IPLYTMV F++IPY   VE    Q+K+++    LS +G +LG 
Sbjct:    2 ETETKITLKNQPDVVVGALNACFFAK-RGFNVHVFESREDIRKAKIVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHSLSGKQSPIPYGRKGQYILSVDRANLNKELLSEAETYPNTTLNFEHKLQDWSADTGLMTFSRSDGSKD-QIHADLIVGCDGAFSATRKQFLRRSRFNYSQTYIPHGYMELTMPPVNG-EFAMKPNYLHIWPRNTFMMIALPNLDKTFTCTLFMPFEDFEKITTGDEVIQFFQSYFPDTIPLIGVEALKKDYFRLPAQAMVSVKCSPYHIGDKCVLMGDAAHAVVPFYGQGMNAGFEDCIVFDELMEQFNEDFCAVLPEYTRVRVPDDHAIADLAMYNYVEMRAHVNSKWFLFRKYVDNVLHFFLPKTIIPLYTMVTFTRIPYHHAVERWHWQNKVINYGLLLSAVGAVLGG 435          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:101158471])

HSP 1 Score: 345.51 bits (885), Expect = 6.259e-114
Identity = 178/418 (42.58%), Postives = 265/418 (63.40%), Query Frame = 2
Query:  122 NALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLS-IGVMLGS 1372
            NA FFA+   FNV ++E   D R      GR+INL+LS+RG  ALK V +E++++ K IPM+ARMIH  SG      YG+  Q I +++R  L   LL++AE + +  +NF  KL D + +  +  F      +D +   DL+VG DGA+S  R    +  R ++SQ YIPHGY+E+T PPV+G + +M  N LHIWPRN +M+ ALPNLD +F+ TLFMPF+ FE I +  ++++ F+  FPD + +IG   L   + +     MV+++C+PY++G+KCV+MGDAAHA+VPFYGQGMN+GFED  +F E++++ + +       ++  R  D  A+ +LA YNY+E+R +V    F  RK +DN+++   P   IPLYTMV F++IPY   VE    Q+K+++    LS +G +LG 
Sbjct:   26 NACFFAK-RGFNVHVFESREDIRKAKIVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHSLSGKQSPIPYGRKGQYILSVDRANLNKELLSEAETYPNTTLNFEHKLQDWSADTGLMTFSRSDGSKD-QIHADLIVGCDGAFSATRKQFLRRSRFNYSQTYIPHGYMELTMPPVNG-EFAMKPNYLHIWPRNTFMMIALPNLDKTFTCTLFMPFEDFEKITTGDEVIQFFQSYFPDTIPLIGVEALKKDYFRLPAQAMVSVKCSPYHIGDKCVLMGDAAHAVVPFYGQGMNAGFEDCIVFDELMEQFNEDFCAVLPEYTRVRVPDDHAIADLAMYNYVEMRAHVNSKWFLFRKYVDNVLHFFLPKTIIPLYTMVTFTRIPYHHAVERWHWQNKVINYGLLLSAVGAVLGG 440          
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Match: kmo (kynurenine 3-monooxygenase [Source:NCBI gene;Acc:101158471])

HSP 1 Score: 324.709 bits (831), Expect = 4.959e-106
Identity = 173/418 (41.39%), Postives = 257/418 (61.48%), Query Frame = 2
Query:  122 NALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLS-IGVMLGS 1372
            NA FFA+   FNV ++E   D R      GR+INL+LS+RG  ALK V +E++++ K IPM+ARMIH  SG      YG+  Q I +++R  L   LL+     K  + + N +  D + ++  A               DL+VG DGA+S  R    +  R ++SQ YIPHGY+E+T PPV+G + +M  N LHIWPRN +M+ ALPNLD +F+ TLFMPF+ FE I +  ++++ F+  FPD + +IG   L   + +     MV+++C+PY++G+KCV+MGDAAHA+VPFYGQGMN+GFED  +F E++++ + +       ++  R  D  A+ +LA YNY+E+R +V    F  RK +DN+++   P   IPLYTMV F++IPY   VE    Q+K+++    LS +G +LG 
Sbjct:   26 NACFFAKRG-FNVHVFESREDIRKAKIVKGRSINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHSLSGKQSPIPYGRKGQYILSVDRANLNKELLSGKRRQKDAE-DLNDRRSDGSKDQIHA---------------DLIVGCDGAFSATRKQFLRRSRFNYSQTYIPHGYMELTMPPVNG-EFAMKPNYLHIWPRNTFMMIALPNLDKTFTCTLFMPFEDFEKITTGDEVIQFFQSYFPDTIPLIGVEALKKDYFRLPAQAMVSVKCSPYHIGDKCVLMGDAAHAVVPFYGQGMNAGFEDCIVFDELMEQFNEDFCAVLPEYTRVRVPDDHAIADLAMYNYVEMRAHVNSKWFLFRKYVDNVLHFFLPKTIIPLYTMVTFTRIPYHHAVERWHWQNKVINYGLLLSAVGAVLGG 425          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055705.1 (SMESG000055705.1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 445/451 (98.67%), Postives = 448/451 (99.33%), Query Frame = 2
Query:   59 MNENKDKLEXXXXXXXXXXTLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGINRILQIKK 1411
            MNENKDKLEIVIVGGGLVGTLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEM FPPVDGNKHSMDKNCLHIWPRNEYMLTALPNL+GSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCN+FSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKM DNLMNSLFPSYWIPLYTMVCFS+IPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGINRIL IKK
Sbjct:    1 MNENKDKLEIVIVGGGLVGTLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMPFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLNGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNDFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMFDNLMNSLFPSYWIPLYTMVCFSRIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGINRILLIKK 451          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055918.1 (SMESG000055918.1)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 263/431 (61.02%), Postives = 338/431 (78.42%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGINRILQIK 1408
             LNALFFA+  K+++ + EK+ D R  ++ +GR+INLSLS+RGL ALKIV L+EE+L   IPMYARM+H  +  LKRF YG S+QCI A++R+++  ILL K E +++IQ+ FN KL DV+F +KIAKF + K   +I   FD L+GNDGA+S VR  M+KN+RM+FS+EYIPHGYIE+ FPP   NKH MDK CLHIWPR+E+ML  LPNLDGSFSG LFMPF+ ++ I S ++L + F   FPDA  +IGK +L  +F  +K +KMVTIRCNPYN G  C+IMGDAAHAMVPFYGQGMNSGFEDV IFHEIL+ +D++L KTC  F++ RN DAKAMC+LA +NY ELR NVT+LSFR+RK++DNLMN LFPS+WIPLYTMVCF++IPY KC+EEK+KQDKIL+R++ + I V+ GSI+I  N ++  K
Sbjct:   20 ALNALFFARTQKYDIIVCEKTSDIRGTNRTIGRSINLSLSHRGLTALKIVGLDEEILAASIPMYARMVHGVNEDLKRFPYGLSNQCISAIDRKLMNEILLTKVENNENIQLFFNMKLVDVDFRKKIAKFLSEKEYHEI--AFDFLIGNDGAHSTVRQFMSKNMRMNFSEEYIPHGYIELHFPPGADNKHVMDKKCLHIWPRSEFMLIGLPNLDGSFSGILFMPFEYYDEIESNENLFKFFNFNFPDAFRLIGKSNLARMFFATKPAKMVTIRCNPYNFGGLCIIMGDAAHAMVPFYGQGMNSGFEDVIIFHEILKNHDYDLDKTCVEFTKNRNFDAKAMCDLAFFNYDELRINVTLLSFRLRKIIDNLMNYLFPSFWIPLYTMVCFTRIPYTKCLEEKEKQDKILTRLKKMIITVLFGSILILTNNLIHNK 448          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055694.1 (SMESG000055694.1)

HSP 1 Score: 488.034 bits (1255), Expect = 2.673e-170
Identity = 236/423 (55.79%), Postives = 313/423 (74.00%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIG 1384
             LNA+FF++ D+F+V + EK  D R   + VGR+INLSLS+RG  AL+ V LEE +LK  I MYARMIH+  G LKR  YG+ ++   A++R+VL  +LL +AE +K++ I F  KL DV+  ++IAKF N K +E+I+  +DLLVGNDGAYS VR +M+K LR DFSQE+I HGY E+ FPP   +   MD NCLHIWPRNE+ML  LPN  GSF+GTLFMPF++F  I +K +LL  F K FPDALE++GK +L  ++     S MVTI+CNPYN  E CVIMGDAAHAMVPFYGQGMN GFED+ IFHEIL++N++ L  TC+ F+E+RN DAK +C+LA YNY+E+RK+V+  SF +RK  DNLMN LFPS+W+PLY+MV F++IPY  C++E++KQD+IL+    +    +  S++IG
Sbjct:   21 ALNAVFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQ--YDLLVGNDGAYSTVRQLMSKGLRFDFSQEFISHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFEIFNKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIG 441          
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Match: SMESG000055694.1 (SMESG000055694.1)

HSP 1 Score: 488.034 bits (1255), Expect = 2.975e-170
Identity = 236/423 (55.79%), Postives = 313/423 (74.00%), Query Frame = 2
Query:  116 TLNALFFAQYDKFNVTIYEKSPDNRTIHQDVGRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYGKSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKNLKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTFPPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIHSKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEKCVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEKRNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLYTMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIG 1384
             LNA+FF++ D+F+V + EK  D R   + VGR+INLSLS+RG  AL+ V LEE +LK  I MYARMIH+  G LKR  YG+ ++   A++R+VL  +LL +AE +K++ I F  KL DV+  ++IAKF N K +E+I+  +DLLVGNDGAYS VR +M+K LR DFSQE+I HGY E+ FPP   +   MD NCLHIWPRNE+ML  LPN  GSF+GTLFMPF++F  I +K +LL  F K FPDALE++GK +L  ++     S MVTI+CNPYN  E CVIMGDAAHAMVPFYGQGMN GFED+ IFHEIL++N++ L  TC+ F+E+RN DAK +C+LA YNY+E+RK+V+  SF +RK  DNLMN LFPS+W+PLY+MV F++IPY  C++E++KQD+IL+    +    +  S++IG
Sbjct:   20 ALNAVFFSKTDQFDVLLCEKRSDIRMDTEHVGRSINLSLSHRGREALRAVGLEENILKSSIRMYARMIHDTHGNLKRIPYGRPNEFNNAVDRKVLNELLLTEAESNKNVTIKFGCKLVDVDLQKRIAKFSNGKFIEEIQ--YDLLVGNDGAYSTVRQLMSKGLRFDFSQEFISHGYKELYFPPGADDTFLMDMNCLHIWPRNEFMLIGLPNPGGSFTGTLFMPFEIFNKIKTKDELLTFFSKYFPDALELMGKSNLEKVYFSRTASSMVTIKCNPYNFEESCVIMGDAAHAMVPFYGQGMNCGFEDLLIFHEILKENNYKLENTCSEFTERRNRDAKTICDLAFYNYVEMRKSVSSKSFLIRKKFDNLMNFLFPSFWVPLYSMVSFTRIPYSLCLKERKKQDRILTIFGFIGRAALAISLLIG 440          
The following BLAST results are available for this feature:
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KMO1.636e-10641.91kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
KMO1.235e-10141.18kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
KMO9.032e-9243.02kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
KMO1.358e-1737.61kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kmo-15.321e-11440.82Kynurenine 3-monooxygenase [Source:UniProtKB/Swis... [more]
kmo-27.620e-4728.34Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEM... [more]
kmo-23.698e-4227.79Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEM... [more]
kmo-23.698e-4227.79Kynurenine 3-MonoOxygenase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cn1.825e-10843.40gene:FBgn0000337 transcript:FBtr0344723[more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kmo4.863e-11544.72kynurenine 3-monooxygenase [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bend32.374e-11344.87BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
bend31.092e-11245.77BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
bend34.986e-9741.55BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
bend32.075e-9242.49BEN domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Kmo1.049e-11343.24kynurenine 3-monooxygenase (kynurenine 3-hydroxyla... [more]
Kmo2.105e-9744.00kynurenine 3-monooxygenase (kynurenine 3-hydroxyla... [more]
Kmo6.961e-3740.96kynurenine 3-monooxygenase (kynurenine 3-hydroxyla... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Q6A7|KMO_ANOGA2.911e-11945.75Kynurenine 3-monooxygenase OS=Anopheles gambiae OX... [more]
sp|Q86PM2|KMO_AEDAE2.206e-11644.95Kynurenine 3-monooxygenase OS=Aedes aegypti OX=715... [more]
sp|Q1RLY6|KMO_DANRE1.105e-11344.72Kynurenine 3-monooxygenase OS=Danio rerio OX=7955 ... [more]
sp|Q21795|KMO_CAEEL6.769e-11340.82Kynurenine 3-monooxygenase OS=Caenorhabditis elega... [more]
sp|Q91WN4|KMO_MOUSE7.336e-11343.24Kynurenine 3-monooxygenase OS=Mus musculus OX=1009... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JIN91.024e-13848.82Kynurenine 3-monooxygenase OS=Lingula unguis OX=75... [more]
A0A2C9JJ571.958e-13346.93Kynurenine 3-monooxygenase OS=Biomphalaria glabrat... [more]
R7TPA47.689e-13347.88Kynurenine 3-monooxygenase OS=Capitella teleta OX=... [more]
A0A2C9K8S61.770e-13147.02Kynurenine 3-monooxygenase OS=Biomphalaria glabrat... [more]
A0A0L8H1W37.658e-13148.15Kynurenine 3-monooxygenase OS=Octopus bimaculoides... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kmo2.482e-11043.70kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
kmo3.820e-10542.89kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
KMO9.021e-7047.14kynurenine 3-monooxygenase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BNA41.913e-8437.12Kynurenine 3-monooxygenase; required for the de no... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO451902.041e-12044.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438993.150e-10039.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451869.314e-9041.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268305.425e-7436.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kmo2.505e-11441.88kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
kmo6.259e-11442.58kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
kmo4.959e-10641.39kynurenine 3-monooxygenase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kynurenine 3-monooxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000055705.10.000e+098.67SMESG000055705.1[more]
SMESG000055918.10.000e+061.02SMESG000055918.1[more]
SMESG000055694.12.673e-17055.79SMESG000055694.1[more]
SMESG000055694.12.975e-17055.79SMESG000055694.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000867 ID=SMED30000867|Name=Kynurenine 3-monooxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1486bp
TGAACTTTATGCTGAGATTTATAAATATAAGTCAGATTAAAAATTTACAT
TTTTAAACATGAATGAAAATAAAGACAAATTAGAAATTGTAATTGTCGGA
GGAGGACTAGTCGGGACACTGAATGCGTTATTTTTTGCTCAATATGATAA
ATTCAATGTGACTATTTATGAAAAATCTCCAGACAATCGAACAATCCACC
AAGATGTTGGGAGAAACATAAACTTATCTTTGTCTTACAGGGGTTTATTG
GCTTTGAAAATTGTAGATTTAGAAGAAGAAGTTCTAAAGAAATGTATTCC
AATGTACGCGAGAATGATTCACGAAAGAAGCGGACCTTTGAAACGGTTCT
TTTATGGAAAGTCTTCTCAATGCATTTTTGCGATGGAGAGAAGGGTTTTA
TTGAATATTCTTTTAGCAAAAGCCGAAATTCACAAAAGTATTCAAATAAA
TTTTAACACAAAACTTTACGACGTGAATTTCAATGAAAAAATTGCAAAAT
TTAAAAATTTAAAAAATATGGAGGATATTGAAAAAAAATTTGATCTTTTG
GTTGGAAATGATGGAGCCTATTCTCATGTCCGCCATATCATGACAAAGAA
TTTACGGATGGACTTTTCTCAAGAATACATCCCTCATGGATATATAGAAA
TGACTTTTCCCCCAGTTGATGGCAATAAACATTCAATGGATAAAAACTGC
TTACATATTTGGCCACGAAATGAATACATGCTAACTGCTCTTCCGAATCT
CGATGGATCCTTCTCTGGAACTCTTTTTATGCCATTCAAGATGTTTGAAA
GTATTCACTCGAAAAAAGATTTGTTAGAATTGTTTGAAAAAGAATTTCCA
GATGCTCTGGAAATTATTGGCAAGTTACATTTATGTGATCTGTTTCAAAA
GAGCAAACTTTCTAAAATGGTCACGATTCGATGCAACCCATACAACCTTG
GAGAAAAATGTGTAATAATGGGCGATGCAGCTCATGCAATGGTTCCATTT
TATGGTCAAGGGATGAATAGTGGATTTGAAGATGTGACTATATTTCATGA
GATTTTACAGAAAAATGATTTTAACTTGGGTAAAACATGTAATAATTTCT
CCGAAAAACGGAACAATGACGCAAAAGCAATGTGTGAATTGGCATCTTAC
AATTACTTGGAATTAAGAAAAAATGTTACAATGCTTTCGTTTCGAATGCG
AAAAATGTTAGATAATTTGATGAACTCTCTGTTTCCGTCTTACTGGATTC
CTCTCTATACTATGGTTTGTTTTTCTCAAATTCCTTATATGAAATGCGTC
GAAGAAAAGCAAAAGCAAGACAAAATTTTATCCAGAATTCAAAGTTTATC
AATTGGAGTAATGCTTGGCAGTATTATAATTGGAATAAATAGAATTCTTC
AAATTAAGAAATAGTTTTGCAGTTTCAACTATTTTCTTATTGAATAATTA
ACTGCAACCATTTTTGCAAATAAAATTTACTTGGAT
back to top

protein sequence of SMED30000867-orf-1

>SMED30000867-orf-1 ID=SMED30000867-orf-1|Name=SMED30000867-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=452bp
MNENKDKLEIVIVGGGLVGTLNALFFAQYDKFNVTIYEKSPDNRTIHQDV
GRNINLSLSYRGLLALKIVDLEEEVLKKCIPMYARMIHERSGPLKRFFYG
KSSQCIFAMERRVLLNILLAKAEIHKSIQINFNTKLYDVNFNEKIAKFKN
LKNMEDIEKKFDLLVGNDGAYSHVRHIMTKNLRMDFSQEYIPHGYIEMTF
PPVDGNKHSMDKNCLHIWPRNEYMLTALPNLDGSFSGTLFMPFKMFESIH
SKKDLLELFEKEFPDALEIIGKLHLCDLFQKSKLSKMVTIRCNPYNLGEK
CVIMGDAAHAMVPFYGQGMNSGFEDVTIFHEILQKNDFNLGKTCNNFSEK
RNNDAKAMCELASYNYLELRKNVTMLSFRMRKMLDNLMNSLFPSYWIPLY
TMVCFSQIPYMKCVEEKQKQDKILSRIQSLSIGVMLGSIIIGINRILQIK
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR002938FAD-bd
IPR023753FAD/NAD-binding_dom
Vocabulary: molecular function
TermDefinition
GO:0071949FAD binding
GO:0016491oxidoreductase activity
GO:0004502kynurenine 3-monooxygenase activity
GO:0050660flavin adenine dinucleotide binding
GO:0004497monooxygenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006569tryptophan catabolic process
GO:0009435NAD biosynthetic process
GO:0019363pyridine nucleotide biosynthetic process
GO:0019805quinolinate biosynthetic process
GO:0034354'de novo' NAD biosynthetic process from tryptophan
GO:0043420anthranilate metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00420RNGMNOXGNASEcoord: 298..313
score: 38.12
coord: 313..329
score: 34.31
coord: 9..31
score: 30.43
coord: 160..175
score: 40.21
NoneNo IPR availablePANTHERPTHR46028FAMILY NOT NAMEDcoord: 2..437
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 10..27
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 8..386
e-value: 5.6E-116
score: 389.9
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 8..397
IPR002938FAD-binding domainPFAMPF01494FAD_binding_3coord: 8..327
e-value: 2.8E-13
score: 49.8