Transmembrane adaptor Erv26

Overview
NameTransmembrane adaptor Erv26
Smed IDSMED30000866
Length (bp)776
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane adaptor Erv26 (SMED30000866) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane adaptor Erv26 (SMED30000866) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane adaptor Erv26 (SMED30000866) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane adaptor Erv26 (SMED30000866) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000866

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000866h1SMcG0022228 dd_Smed_v4_10450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000866h1SMcG0022228 dd_Smed_v4_10450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000866h1SMcG0022228 dd_Smed_v4_10450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Human
Match: TEX261 (testis expressed 261 [Source:HGNC Symbol;Acc:HGNC:30712])

HSP 1 Score: 82.0333 bits (201), Expect = 2.365e-18
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTM-------QPGDDVVSNYFTKGKRGKRLGILVVFSFIKE 186          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Human
Match: AC007040.2 (novel protein)

HSP 1 Score: 80.8777 bits (198), Expect = 5.074e-18
Identity = 53/148 (35.81%), Postives = 79/148 (53.38%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDN 591
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+         S  + D+
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGGLGLGRSTGHGDS 171          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Fly
Match: CG3500 (gene:FBgn0034849 transcript:FBtr0329860)

HSP 1 Score: 81.6481 bits (200), Expect = 1.270e-18
Identity = 51/169 (30.18%), Postives = 88/169 (52.07%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             EL E+  +   + I + I      +++ +  ++L + LII GL++  F+  ++  +P     S   +G+    V++H+ AF+  V       V + F ++L YFT+CMWIVPF   +SLSAND +LP T+         S + PD  S   ++ ++Q L  L + +KE
Sbjct:   31 AELAEEYTTAARKCILFLISFTIFVYILLLLFEDLPWSLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGSLAMLVVNHFLAFQHFVT------VYVPFTQVLAYFTICMWIVPFALFVSLSANDSVLPTTV------SDQSRRSPDVVSNYFSRNKKQGLLSLFQYLKE 187          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Fly
Match: CG3500 (gene:FBgn0034849 transcript:FBtr0072038)

HSP 1 Score: 81.6481 bits (200), Expect = 1.270e-18
Identity = 51/169 (30.18%), Postives = 88/169 (52.07%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             EL E+  +   + I + I      +++ +  ++L + LII GL++  F+  ++  +P     S   +G+    V++H+ AF+  V       V + F ++L YFT+CMWIVPF   +SLSAND +LP T+         S + PD  S   ++ ++Q L  L + +KE
Sbjct:   31 AELAEEYTTAARKCILFLISFTIFVYILLLLFEDLPWSLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGSLAMLVVNHFLAFQHFVT------VYVPFTQVLAYFTICMWIVPFALFVSLSANDSVLPTTV------SDQSRRSPDVVSNYFSRNKKQGLLSLFQYLKE 187          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Zebrafish
Match: tex261 (testis expressed 261 [Source:ZFIN;Acc:ZDB-GENE-050522-400])

HSP 1 Score: 86.6557 bits (213), Expect = 2.679e-20
Identity = 54/169 (31.95%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I+      V     +     ++ +GL ++  Y  LL+T+P     S NFI +C+  VL+HY AF+     +   P    F E+L YFT+C+W++PF F +SLSA + +LP T+       Q       N+     + +R  +  +   +KE
Sbjct:   31 AELIEEYTVATSRIIKYMIMFSTAVLVGLYLFEGFPTLMVGVGLFTNLVYFGLLQTFPYIMLTSPNFILSCVLVVLNHYMAFQYF--AEEYYP----FSEVLAYFTICLWVIPFSFFVSLSAGENVLPSTM-------QQGDDVVSNYFTKGKRGKRSGILLVFSFLKE 186          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Xenopus
Match: arhgap5 (Rho GTPase activating protein 5 [Source:Xenbase;Acc:XB-GENE-982380])

HSP 1 Score: 84.3445 bits (207), Expect = 2.394e-19
Identity = 57/170 (33.53%), Postives = 87/170 (51.18%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C+  VL+HY AF+     +   P    F E+L YFT C+W++PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTGVLICLYLF-EKFPTIMIGVGLFTNVVYFGLLQTFPFIMLTSPNFILSCVLVVLNHYLAFQYF--AEEYYP----FSEVLAYFTFCLWLIPFSFFVSLSAGENVLPSTI-------QQGDDVVSNYFTKGKRGKRSGILVIFSFIKE 186          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Xenopus
Match: arhgap5 (Rho GTPase activating protein 5 [Source:Xenbase;Acc:XB-GENE-982380])

HSP 1 Score: 83.5741 bits (205), Expect = 4.784e-19
Identity = 57/170 (33.53%), Postives = 87/170 (51.18%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C+  VL+HY AF+     +   P    F E+L YFT C+W++PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   28 AELIEEYTVATSRIIKYMIWFSTGVLICLYLF-EKFPTIMIGVGLFTNVVYFGLLQTFPFIMLTSPNFILSCVLVVLNHYLAFQYFA--EEYYP----FSEVLAYFTFCLWLIPFSFFVSLSAGENVLPSTI-------QQGDDVVSNYFTKGKRGKRSGILVIFSFIKE 183          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Mouse
Match: Tex261 (testis expressed gene 261 [Source:MGI Symbol;Acc:MGI:1096575])

HSP 1 Score: 82.0333 bits (201), Expect = 1.450e-18
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTM-------QPGDDVVSNYFTKGKRGKRLGILVVFSFIKE 186          
BLAST of Transmembrane adaptor Erv26 vs. UniProt/SwissProt
Match: sp|Q5BJW3|TX261_RAT (Protein TEX261 OS=Rattus norvegicus OX=10116 GN=Tex261 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.014e-17
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTM-------QPGDDVVSNYFTKGKRGKRLGILVVFSFIKE 186          
BLAST of Transmembrane adaptor Erv26 vs. UniProt/SwissProt
Match: sp|Q62302|TX261_MOUSE (Protein TEX261 OS=Mus musculus OX=10090 GN=Tex261 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.014e-17
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTM-------QPGDDVVSNYFTKGKRGKRLGILVVFSFIKE 186          
BLAST of Transmembrane adaptor Erv26 vs. UniProt/SwissProt
Match: sp|Q6UWH6|TX261_HUMAN (Protein TEX261 OS=Homo sapiens OX=9606 GN=TEX261 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.136e-17
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   31 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTM-------QPGDDVVSNYFTKGKRGKRLGILVVFSFIKE 186          
BLAST of Transmembrane adaptor Erv26 vs. UniProt/SwissProt
Match: sp|Q58DA4|TX261_BOVIN (Protein TEX261 OS=Bos taurus OX=9913 GN=TEX261 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.003e-17
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAI-LSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY I  S  +   +++F +     +I +GL ++  Y  LL+T+P     S NFI +C   V++HY AF+     +   P    F E+L YFT C+WI+PF F +SLSA + +LP T+       Q       N+     + +R  +  +   IKE
Sbjct:   28 AELIEEYTVATSRIIKYMIWFSTAVLIGLYVF-ERFPTYMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQ--FFAEEYYP----FSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTM-------QPGDDVVSNYFTKGKRGKRLGILVVFSFIKE 183          
BLAST of Transmembrane adaptor Erv26 vs. UniProt/SwissProt
Match: sp|P38869|SVP26_YEAST (Protein SVP26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SVP26 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.484e-16
Identity = 48/179 (26.82%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIE------------FVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAI 651
            +EL+E++   T R +  AI    +  ++ +  D   ++L +  +  +  Y   LK++P     S  F+ +C+C VL+HYF FK     D  +P Q +            F E+ ++F +C+W +PF   +SLSA DY+LP T      ++Q+  +  D+ +  +  K R+    L + +
Sbjct:   30 SELVEEHTEPTRRFLTRAIYGIILILILLLLLDGFPFKLTLFSIACYIVYYQNLKSFPFISLTSPTFLLSCVCVVLNHYFWFK--YFNDTEVPPQFKFDPNYIPRRRASFAEVASFFGICVWFIPFALFVSLSAGDYVLPTT------SEQHMAKKNDDITTNNQPKFRKRAVGLARVV 200          
BLAST of Transmembrane adaptor Erv26 vs. TrEMBL
Match: A0A5K4F625 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 9.160e-37
Identity = 80/202 (39.60%), Postives = 128/202 (63.37%), Query Frame = 1
Query:   67 ILWILTHXXXXXXXXXXXXXXXXXXXXXTELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTL----PINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEF 660
            +LWI +++  + +  +I   +++GL+Y+TEL+E+ I  TG+II+Y I +E + H I + TD++   L++ GL+ HCFY+ +LKT+PTFHY SFNF+G+    ++HH  AF+      +N P    +  ++ YFT  +W VPFLF++SLSAND++LPQT+    P+ S     S Q   +      K +R+SLY  L  ++EF
Sbjct:   20 VLWIFSYLALLFYLFVILFCITVGLFYVTELVEEYIVTTGKIIRYTIYAEIVLHFILLITDDVPVILVLTGLVCHCFYSSMLKTFPTFHYQSFNFLGSGFMLIIHHLVAFRVF----SNNPSPFSY--LIAYFTFFLWAVPFLFLISLSANDFVLPQTVEFRFPVESDFLLQSQQKKHDVVSAYFKCKRKSLYTFLAYLREF 215          
BLAST of Transmembrane adaptor Erv26 vs. TrEMBL
Match: A0A430QAZ7 (Uncharacterized protein (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0004780 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.578e-36
Identity = 81/202 (40.10%), Postives = 127/202 (62.87%), Query Frame = 1
Query:   67 ILWILTHXXXXXXXXXXXXXXXXXXXXXTELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQT----LPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEF 660
            ILWI +++  + +  +I   +++GL+Y+TEL+E+ I  TG+II+Y I +E + H I + TD++   L++ GL+ HCFY+ +LKT+P FHY SF+F+G+    ++HH  AF+  V      P    F  ++ YFT  +W VPFLF++SLSAND++LPQT    LP+ S     S Q  ++      K +R+SLY  L  ++EF
Sbjct:    2 ILWIFSYLVLLFYLFIILFCITVGLFYVTELVEEYIVTTGKIIRYTIYAEIVLHFILLITDDVPVILVLTGLICHCFYSSMLKTFPAFHYRSFSFLGSAFMLIIHHLVAFR--VFSHNPSP----FSYLIAYFTFFLWAVPFLFLISLSANDFVLPQTVEYQLPVESDYLLQSQQKKNDLVSAYFKCKRKSLYTFLAYLREF 197          
BLAST of Transmembrane adaptor Erv26 vs. TrEMBL
Match: A0A183LP84 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 3.881e-36
Identity = 70/174 (40.23%), Postives = 108/174 (62.07%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQT----LPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEF 660
            TEL+E+ I  TG+II+Y I +E + H + + TD++   L++ GL+ HCFY+ +LKT+P FHY SF+F+G+    ++HH  AF++     +       F  ++ YFT  +W VPFLF++SLSAND++LPQT    LP+ S     S Q  ++      K +R+SLY  L  ++EF
Sbjct:   28 TELVEEYIVTTGKIIRYTIYAEVVLHFVLLITDDVPVILVLTGLVCHCFYSSMLKTFPAFHYQSFSFLGSAFMLIIHHLVAFRAFSYNPS------PFSYLIAYFTFFLWAVPFLFLISLSANDFVLPQTVEYQLPVESDYLLQSQQKKNDLVSAYFKCKRKSLYTFLAYLREF 195          
BLAST of Transmembrane adaptor Erv26 vs. TrEMBL
Match: A0A3P8B546 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS5609 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.322e-36
Identity = 70/174 (40.23%), Postives = 108/174 (62.07%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQT----LPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEF 660
            TEL+E+ I  TG+II+Y I +E + H + + TD++   L++ GL+ HCFY+ +LKT+P FHY SF+F+G+    ++HH  AF++     +       F  ++ YFT  +W VPFLF++SLSAND++LPQT    LP+ S     S Q  ++      K +R+SLY  L  ++EF
Sbjct:   28 TELVEEYIVTTGKIIRYTIYAEVVLHFVLLITDDVPVILVLTGLVCHCFYSSMLKTFPAFHYQSFSFLGSAFMLIIHHLVAFRAFSYNPS------PFSYLIAYFTFFLWAVPFLFLISLSANDFVLPQTVEYQLPVESDYLLQSQQKKNDLVSAYFKCKRKSLYTFLAYLREF 195          
BLAST of Transmembrane adaptor Erv26 vs. TrEMBL
Match: A0A5J4N5U7 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0001438 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.020e-35
Identity = 80/203 (39.41%), Postives = 125/203 (61.58%), Query Frame = 1
Query:   70 LWILTHXXXXXXXXXXXXXXXXXXXXXTELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYP------DNFSRMSNKKRRQSLYRLLKAIKEF 660
            LW+L+++  +L+  +    L+ GL Y+TEL+E+    TG+II+Y I+ EF+ H + +FTD++ Y L+  GL++H  Y  LLK +P FH+ SF+FI +    VLHH  AF    + ++ +     F E+L YFT  +W VPF+F++SLSAND++LPQT+P   +   +  + P      D  S    KKRR SLY LL + +++
Sbjct:    5 LWLLSYLTILLYGFVALFCLAAGLLYVTELVEEYTVTTGKIIRYMIVGEFVLHAVLLFTDSVTYMLLGAGLVAHTLYWSLLKHFPAFHFGSFSFISSLCAFVLHHVAAFN---LFNSTL---YSFTEMLAYFTFMLWAVPFMFLISLSANDWVLPQTVPFTYHHSPSGEEQPLLVGSHDVVSAYLKKKRR-SLYSLLSSFRDY 200          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Cavefish
Match: tex261 (testis expressed 261 [Source:NCBI gene;Acc:103040910])

HSP 1 Score: 87.0409 bits (214), Expect = 1.594e-20
Identity = 56/170 (32.94%), Postives = 88/170 (51.76%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAIL-SEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY IL S  +   +++F +     +I  GL ++  Y  LL+T+P    +S NFI +CI  V++HY AF+    +         F E+L YFT+C+W++PF F +SLSA + +LP T+       Q       N+     + +R  +  +   +KE
Sbjct:   31 AELIEEYTVATSRIIKYMILFSTGVLSGLYLF-EGFPMLMIGTGLFTNLVYFGLLQTFPYIMLSSPNFILSCILVVINHYMAFQYFAEE------YYAFSEVLAYFTICLWVIPFSFFVSLSAGENVLPSTM-------QQGDDVVSNYFTKGKRGKRSGILLIFSFLKE 186          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Yeast
Match: SVP26 (Integral membrane protein of the early Golgi apparatus and ER; involved in COP II vesicle transport; may also function to promote retention of proteins in the early Golgi compartment [Source:SGD;Acc:S000001224])

HSP 1 Score: 79.7221 bits (195), Expect = 2.138e-18
Identity = 48/179 (26.82%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIE------------FVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAI 651
            +EL+E++   T R +  AI    +  ++ +  D   ++L +  +  +  Y   LK++P     S  F+ +C+C VL+HYF FK     D  +P Q +            F E+ ++F +C+W +PF   +SLSA DY+LP T      ++Q+  +  D+ +  +  K R+    L + +
Sbjct:   30 SELVEEHTEPTRRFLTRAIYGIILILILLLLLDGFPFKLTLFSIACYIVYYQNLKSFPFISLTSPTFLLSCVCVVLNHYFWFK--YFNDTEVPPQFKFDPNYIPRRRASFAEVASFFGICVWFIPFALFVSLSAGDYVLPTT------SEQHMAKKNDDITTNNQPKFRKRAVGLARVV 200          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Nematostella
Match: EDO49243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW6])

HSP 1 Score: 89.3521 bits (220), Expect = 9.398e-22
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 1
Query:  160 IEDNISLTGRIIKYAILSEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLP--QTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRL 639
            +E+   +  +IIKY ++  F+ ++     ++  + ++++GL S+  Y LLLK +P    +S  FI       ++HY AF+     D   P    F E+L+YFT+C+WIVPF F +SLSA++ +LP   +   +S ++ + F YP          RRQ +  L
Sbjct:   34 VEEYTVIAAKIIKYMLIGVFVIYLCLFIFESFPWYIVVIGLASNVIYLLLLKDFPFIELSSPVFIAAVASVFVNHYLAFQYF--ADVWYP----FSEVLSYFTICLWIVPFAFFVSLSASENVLPTSSSATTDSGSQGDKFDYPGK-----RSSRRQGILAL 184          
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Medaka
Match: tex261 (testis expressed 261 [Source:NCBI gene;Acc:101155302])

HSP 1 Score: 86.2705 bits (212), Expect = 2.503e-20
Identity = 54/170 (31.76%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  151 TELIEDNISLTGRIIKYAIL-SEFIAHVIFIFTDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKE 657
             ELIE+    T RIIKY IL S  +   +++F +     ++ +GL ++  Y  LL+T+P    +S NFI +C+  V++HY AF+    +         F E+L YFT+C+W++PF F +SLSA + +LP T+       Q       N+     + +R  +  +   +KE
Sbjct:   31 AELIEEYTVATSRIIKYMILFSTGVLAGLYVF-EGFPIIMVGVGLFTNLVYFGLLQTFPYIMLSSPNFILSCVLVVVNHYMAFQYFAQE------YYPFSEVLAYFTICLWVIPFAFFVSLSAGENVLPSTI-------QQGDDVVSNYFTKGKRGKRSGILLVFSFLKE 186          
BLAST of Transmembrane adaptor Erv26 vs. Planmine SMEST
Match: SMESG000022966.1 (SMESG000022966.1)

HSP 1 Score: 171.4 bits (433), Expect = 9.563e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
Query:  424 MPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEFFIG 669
            MPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEFFIG
Sbjct:    1 MPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYPDNFSRMSNKKRRQSLYRLLKAIKEFFIG 82          
BLAST of Transmembrane adaptor Erv26 vs. Planmine SMEST
Match: SMESG000037644.1 (SMESG000037644.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.787e-13
Identity = 46/158 (29.11%), Postives = 82/158 (51.90%), Query Frame = 1
Query:  193 IKYAILSEFIAHVIFIF--TDNLKYQLIIMGLLSHCFYALLLKTYPTFHYASFNFIGTCICCVLHHYFAFKSIVVKDANMPVQIEFVEILTYFTLCMWIVPFLFILSLSANDYLLPQTLPINSYAKQNSFQYP-DNFSRMSNKKRRQSLYRLLKAIKE 657
            I + IL E + HV+ +   TD   + ++++GLL++  Y  LL+ +PT  +   +F+   +  +LH+   F  I V        + +  +L Y TLC W+VPFL+++SLSAN++       I      NS ++   +F      K+R +LY  L +++ 
Sbjct:    5 IGFVILGELLVHVLMLIFDTDVFSFNVLVIGLLTNVSYCFLLQDFPTLKFNVKSFVIMSML-ILHNVVTF--IYVGHNFFDDLVPYDNLLAYMTLCTWLVPFLYVVSLSANEFSSDPVSSIRLSFLSNSKEFSQQDFVTNYMSKKRYNLYYFLSSLRN 159          
The following BLAST results are available for this feature:
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TEX2612.365e-1833.53testis expressed 261 [Source:HGNC Symbol;Acc:HGNC:... [more]
AC007040.25.074e-1835.81novel protein[more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG35001.270e-1830.18gene:FBgn0034849 transcript:FBtr0329860[more]
CG35001.270e-1830.18gene:FBgn0034849 transcript:FBtr0072038[more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tex2612.679e-2031.95testis expressed 261 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
arhgap52.394e-1933.53Rho GTPase activating protein 5 [Source:Xenbase;Ac... [more]
arhgap54.784e-1933.53Rho GTPase activating protein 5 [Source:Xenbase;Ac... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tex2611.450e-1833.53testis expressed gene 261 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BJW3|TX261_RAT1.014e-1733.53Protein TEX261 OS=Rattus norvegicus OX=10116 GN=Te... [more]
sp|Q62302|TX261_MOUSE1.014e-1733.53Protein TEX261 OS=Mus musculus OX=10090 GN=Tex261 ... [more]
sp|Q6UWH6|TX261_HUMAN1.136e-1733.53Protein TEX261 OS=Homo sapiens OX=9606 GN=TEX261 P... [more]
sp|Q58DA4|TX261_BOVIN2.003e-1733.53Protein TEX261 OS=Bos taurus OX=9913 GN=TEX261 PE=... [more]
sp|P38869|SVP26_YEAST1.484e-1626.82Protein SVP26 OS=Saccharomyces cerevisiae (strain ... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F6259.160e-3739.60Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A430QAZ71.578e-3640.10Uncharacterized protein (Fragment) OS=Schistosoma ... [more]
A0A183LP843.881e-3640.23Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A3P8B5464.322e-3640.23Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A5J4N5U71.020e-3539.41Uncharacterized protein OS=Paragonimus westermani ... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tex2611.594e-2032.94testis expressed 261 [Source:NCBI gene;Acc:1030409... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SVP262.138e-1826.82Integral membrane protein of the early Golgi appar... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO492439.398e-2231.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tex2612.503e-2031.76testis expressed 261 [Source:NCBI gene;Acc:1011553... [more]
back to top
BLAST of Transmembrane adaptor Erv26 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022966.19.563e-55100.00SMESG000022966.1[more]
SMESG000037644.12.787e-1329.11SMESG000037644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000866 ID=SMED30000866|Name=Transmembrane adaptor Erv26|organism=Schmidtea mediterranea sexual|type=transcript|length=776bp
TAATTACAAAAAGTTACTTTTATTAAANNNATNNTNNNATTTGACAATTA
TAGTTTTCAGATGATAATACTATGGATTCTCACACATATATGGTATATTT
TATTTTTTATTCTTATAACTTTAATTTTATCAATTGGCCTATATTACTTG
ACGGAGTTAATTGAAGACAATATAAGCTTAACTGGTCGTATTATTAAATA
TGCCATATTGTCAGAATTTATTGCACATGTCATTTTTATTTTCACAGATA
ATTTAAAGTATCAACTTATTATTATGGGTTTGCTTTCACATTGTTTTTAC
GCTTTGCTCTTAAAAACATATCCCACTTTTCATTATGCATCATTTAACTT
CATTGGGACATGTATATGCTGCGTGCTTCATCATTACTTCGCGTTTAAAT
CTATTGTAGTAAAGGATGCTAACATGCCTGTTCAAATTGAATTTGTAGAA
ATTTTGACTTATTTCACCCTTTGCATGTGGATTGTTCCATTTTTATTTAT
TTTAAGTTTATCAGCTAATGATTATTTATTGCCTCAAACGTTGCCAATTA
ATTCATATGCAAAACAAAATTCATTTCAATATCCTGATAATTTTTCCAGA
ATGAGTAATAAAAAACGAAGACAAAGCTTATATCGGTTACTTAAAGCCAT
TAAAGAATTTTTTATTGGATGATATTTTCGGTGATTTGTTAAATAAATTA
TTGGAATTTTTGAAATGTTTTTGTTAAATAAATTAAATTTAGTTGTTTTT
CCGAAAAAAAAAAAAAAAAAATGCGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006888ER to Golgi vesicle-mediated transport
Vocabulary: molecular function
TermDefinition
GO:0097020COPII adaptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR007277Svp26/Tex261
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007277Svp26/Tex261PFAMPF04148Erv26coord: 1..193
e-value: 2.7E-37
score: 128.6
IPR007277Svp26/Tex261PANTHERPTHR13144TEX261 PROTEINcoord: 1..196
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 67..84