Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30000862
Length (bp)2413
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30000862) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30000862) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30000862) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30000862) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000862

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000862SMESG000051096.1 SmedASXL_014967SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000862SMESG000051096.1 dd_Smed_v6_20146_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: IGSF10 (immunoglobulin superfamily member 10 [Source:HGNC Symbol;Acc:HGNC:26384])

HSP 1 Score: 42.743 bits (99), Expect = 5.961e-10
Identity = 32/110 (29.09%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFS------CTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSN 1185
            +K ++L  + +TS+    +E  + M  L  + L GN W CDC L+W   WI +K +   + K +R   S      C NP   +     G+ L  + +  FQC    I S+
Sbjct:  187 IKFLYLSDNFLTSLP---QEMVSYMPDLDSLYLHGNPWTCDCHLKWLSDWIQEKPDVI-KCKKDRSPSSAQQCPLCMNPRTSK-----GKPLAMVSAAAFQCAKPTIDSS 287          

HSP 2 Score: 41.9726 bits (97), Expect = 5.961e-10
Identity = 45/165 (27.27%), Postives = 73/165 (44.24%), Query Frame = 2
Query:  386 CTVILRSQQSSLKKAVCNMPEQI------LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNI-PDFFFNHVNQTLESLHLSHSKTEIILSGNSL 859
            C V     ++  ++  C MP ++      L SIP  +P  +  + + +  L  +   +F  L KLE L + S+ + TI +  F  L  L+ L +  N +         L K  F+ L SLT++ + +N+I  I P+ F+      L  L L H      L GN L
Sbjct:   19 CLVATPGGKACPRRCACYMPTEVHCTFRYLTSIPDSIPPNVERINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNKV-------RKLQKDTFYGLRSLTRLHMDHNNIEFINPEVFYG-----LNFLRLVH------LEGNQL 165          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRIG2 (leucine rich repeats and immunoglobulin like domains 2 [Source:HGNC Symbol;Acc:HGNC:20889])

HSP 1 Score: 59.3066 bits (142), Expect = 3.294e-8
Identity = 45/165 (27.27%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  925 VEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLT-SIFRNVDEKQNIFWENKGNIF--SMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFV 1410
            ++E+    + LKE+IL  +   CDC L+W L W++  NNF++ + +     SC +P  +    I   DL   +   F   P+  T   T+    G N++LT +   + D   +  W     I       NF R+           SIL + NV+  +EG ++C V
Sbjct:  425 IQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLV-DNNFQHSVNV-----SCAHPEWLAGQSILNVDLKDFVCDDF-LKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEILYDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIV 582          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: TRIL (TLR4 interactor with leucine rich repeats [Source:HGNC Symbol;Acc:HGNC:22200])

HSP 1 Score: 41.5874 bits (96), Expect = 1.356e-6
Identity = 21/78 (26.92%), Postives = 39/78 (50.00%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRN 1107
            L+ + L  + ++++S D+   F     L  + L GN W CDC+LR    W+    ++ +Q ++      C +PP +R 
Sbjct:  327 LRELSLRNNALSALSGDI---FAASPALYRLDLDGNGWTCDCRLRGLKRWM---GDWHSQGRLLTVFVQCRHPPALRG 398          

HSP 2 Score: 31.9574 bits (71), Expect = 1.356e-6
Identity = 27/98 (27.55%), Postives = 43/98 (43.88%), Query Frame = 2
Query:  515 DLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMS-LSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLE 805
            +LQ +  + F HLP+L  LS+  + +  +   AF          L     +   GN +S L   +  PL SL  +DLS N +  +    F H+ +  E
Sbjct:  240 NLQHLGPRIFQHLPRLGLLSLRGNQLTHLAPEAFW--------GLEALRELRLEGNRLSQLPTALLEPLHSLEALDLSGNELSALHPATFGHLGRLRE 329          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek1 (gene:FBgn0015399 transcript:FBtr0346702)

HSP 1 Score: 54.6842 bits (130), Expect = 3.260e-7
Identity = 44/191 (23.04%), Postives = 81/191 (42.41%), Query Frame = 1
Query:  856 SNVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRF----IITEISGKY-RKSILTILNVSKLEEGVWKCFVD 1413
            +  +  L+ + L       +S  + ++   +S+L  I L  N W CDC+LR   LW++K+N       +      C+  PE     I  R    +   +F C PE +  +  V    G+N S+T   R V    NI W   G + +    F  +    ++ ++ G + ++S L + N  + +   + C  +
Sbjct:  236 AQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPV------CSGGPE----RIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAV-PAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAE 415          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek1 (gene:FBgn0015399 transcript:FBtr0332210)

HSP 1 Score: 54.6842 bits (130), Expect = 3.260e-7
Identity = 44/191 (23.04%), Postives = 81/191 (42.41%), Query Frame = 1
Query:  856 SNVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRF----IITEISGKY-RKSILTILNVSKLEEGVWKCFVD 1413
            +  +  L+ + L       +S  + ++   +S+L  I L  N W CDC+LR   LW++K+N       +      C+  PE     I  R    +   +F C PE +  +  V    G+N S+T   R V    NI W   G + +    F  +    ++ ++ G + ++S L + N  + +   + C  +
Sbjct:  236 AQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPV------CSGGPE----RIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAV-PAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAE 415          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek5 (gene:FBgn0031016 transcript:FBtr0074707)

HSP 1 Score: 52.373 bits (124), Expect = 1.920e-6
Identity = 48/202 (23.76%), Postives = 84/202 (41.58%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWE-NKGNIFSMKINFKRFIITEISGKYRKSILT----ILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESE 1464
            L +I LE ++++ + +   E+F  + KL  + L GN WNC C+L+ F  + I K       ++      C  PP++R     G+  +++ S  F C P  + S  +       NISL         + N+ W  NK  +       +     E   +    +LT    I+ V   ++G + C  D    +   E+ L V  +
Sbjct:  197 LSAISLEQNRLSHLHK---ETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISK-------RLYTPPTDCQEPPQLR-----GKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVG-SPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSGD 382          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek5 (gene:FBgn0031016 transcript:FBtr0309224)

HSP 1 Score: 52.373 bits (124), Expect = 1.920e-6
Identity = 48/202 (23.76%), Postives = 84/202 (41.58%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWE-NKGNIFSMKINFKRFIITEISGKYRKSILT----ILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESE 1464
            L +I LE ++++ + +   E+F  + KL  + L GN WNC C+L+ F  + I K       ++      C  PP++R     G+  +++ S  F C P  + S  +       NISL         + N+ W  NK  +       +     E   +    +LT    I+ V   ++G + C  D    +   E+ L V  +
Sbjct:  197 LSAISLEQNRLSHLHK---ETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISK-------RLYTPPTDCQEPPQLR-----GKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVG-SPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSGD 382          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek5 (gene:FBgn0031016 transcript:FBtr0074708)

HSP 1 Score: 52.373 bits (124), Expect = 1.920e-6
Identity = 48/202 (23.76%), Postives = 84/202 (41.58%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWE-NKGNIFSMKINFKRFIITEISGKYRKSILT----ILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESE 1464
            L +I LE ++++ + +   E+F  + KL  + L GN WNC C+L+ F  + I K       ++      C  PP++R     G+  +++ S  F C P  + S  +       NISL         + N+ W  NK  +       +     E   +    +LT    I+ V   ++G + C  D    +   E+ L V  +
Sbjct:  197 LSAISLEQNRLSHLHK---ETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISK-------RLYTPPTDCQEPPQLR-----GKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVG-SPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSGD 382          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: mxra5a (matrix-remodelling associated 5a [Source:ZFIN;Acc:ZDB-GENE-090312-22])

HSP 1 Score: 41.5874 bits (96), Expect = 3.079e-8
Identity = 19/50 (38.00%), Postives = 31/50 (62.00%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLW 1023
            LK ++L  + +T++S+ +  S   M  L+ + L GN W CDC++RWF  W
Sbjct:  182 LKHLYLSDNILTTLSQKMLAS---MPYLESLSLHGNPWTCDCRMRWFNEW 228          

HSP 2 Score: 36.965 bits (84), Expect = 3.079e-8
Identity = 51/198 (25.76%), Postives = 81/198 (40.91%), Query Frame = 2
Query:  296 VLIFLMLLGTRIIRPIFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQI------LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNI-PDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYM 868
            + I LML+      P+ +    +PC                     C+ P ++      L ++P  +P+ +  + + F  +  I    F  L K+E L +  +NV  I +G F  L +L+ L L  N L +       LS+     L SLT++ L +N +  I PD F     Q L +L L H      L GN L  +
Sbjct:    8 IWIMLMLIAV----PVAVQCCPRPC--------------------ACHQPVEVHCTFRSLLTVPAGVPKQVERMNLGFNTIHKITYSSFAGLRKMELLLMHGNNVHQIPDGTFRDLISLQMLKLSYNKLKL-------LSRQTLMGLWSLTRLHLDHNRLEFIHPDAF-----QGLTNLRLLH------LEGNQLQQL 163          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: mxra5a (matrix-remodelling associated 5a [Source:ZFIN;Acc:ZDB-GENE-090312-22])

HSP 1 Score: 39.2762 bits (90), Expect = 3.970e-8
Identity = 41/158 (25.95%), Postives = 68/158 (43.04%), Query Frame = 2
Query:  410 QSSLKKAVCNMPEQI------LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMS-LSKYIFFPLLSLTKVDLSYNSIGNI-PDFFFNHVNQTLESLHLSHSKTEIILSGNSL 859
            Q   +   C+ P ++      L ++P  +P+ +  + + F  +  I    F  L K+E L +  +NV  I +G F          L +  ++  + N +  LS+     L SLT++ L +N +  I PD F     Q L +L L H      L GN L
Sbjct:   22 QCCPRPCACHQPVEVHCTFRSLLTVPAGVPKQVERMNLGFNTIHKITYSSFAGLRKMELLLMHGNNVHQIPDGTF--------RDLISLQMLKLSYNKLKLLSRQTLMGLWSLTRLHLDHNRLEFIHPDAF-----QGLTNLRLLH------LEGNQL 160          

HSP 2 Score: 39.2762 bits (90), Expect = 3.970e-8
Identity = 19/52 (36.54%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  868 DNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLW 1023
              LK ++L  + +T++S+ +  S   M  L+ + L GN W CDC++RWF  W
Sbjct:  180 STLKHLYLSDNILTTLSQKMLAS---MPYLESLSLHGNPWTCDCRMRWFNEW 228          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: slit3 (slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-4])

HSP 1 Score: 52.373 bits (124), Expect = 4.927e-8
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  859 NVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNK----------ILSMKFQCIPEPITSNSTV 1194
            + +D L+S+ L       +S   E +FN ++ L  + L  N   CDC+LRW   W+  K  F+ +  I R    CT PP++ +  +    LN+          ++S    C+  P  +N T 
Sbjct:  788 HAFDGLRSLRLLTLHGNDLSTVPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWV--KAGFK-EPGIAR----CTGPPDMADRLLLTTPLNRFQCKGPADLNLMSKCAPCLATPCQNNGTC 902          

HSP 2 Score: 25.409 bits (54), Expect = 4.927e-8
Identity = 15/42 (35.71%), Postives = 26/42 (61.90%), Query Frame = 2
Query:  716 LLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEII 841
            L  LT +DLS NSI ++    F+++ Q L +L LS+++   +
Sbjct:  745 LKQLTLLDLSNNSISHLAPLTFSNMTQ-LATLILSYNQIRCV 785          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: slit3 (slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-4])

HSP 1 Score: 52.373 bits (124), Expect = 5.253e-8
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  859 NVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNK----------ILSMKFQCIPEPITSNSTV 1194
            + +D L+S+ L       +S   E +FN ++ L  + L  N   CDC+LRW   W+  K  F+ +  I R    CT PP++ +  +    LN+          ++S    C+  P  +N T 
Sbjct:  810 HAFDGLRSLRLLTLHGNDLSTVPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWV--KAGFK-EPGIAR----CTGPPDMADRLLLTTPLNRFQCKGPADLNLMSKCAPCLATPCQNNGTC 924          

HSP 2 Score: 25.409 bits (54), Expect = 5.253e-8
Identity = 15/42 (35.71%), Postives = 26/42 (61.90%), Query Frame = 2
Query:  716 LLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEII 841
            L  LT +DLS NSI ++    F+++ Q L +L LS+++   +
Sbjct:  767 LKQLTLLDLSNNSISHLAPLTFSNMTQ-LATLILSYNQIRCV 807          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lgi1b (leucine-rich, glioma inactivated 1b [Source:ZFIN;Acc:ZDB-GENE-060217-1])

HSP 1 Score: 53.5286 bits (127), Expect = 7.941e-7
Identity = 32/116 (27.59%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  859 NVYDNLKS-IHL--EYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVS 1197
            + +  LKS IHL   Y+ + ++ RD+   F  M  L ++ L GNL++CDC+L+W + W+   N   +Q+        C+ P   +     G+ +N ++   F CI        T++
Sbjct:  125 HAFRGLKSLIHLSLAYNNLETLPRDI---FKGMDALTKVDLRGNLFSCDCKLKWLVEWMFSTNATVDQLY-------CSGPSPYQ-----GKKINDLMPQSFDCITAEFALKKTLA 225          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 54.299 bits (129), Expect = 2.046e-8
Identity = 50/188 (26.60%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  871 NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQC--IPEP---ITSNSTVSIYAGQNISLT-SIFRNVDEKQNIFWENKGNI-FSMKI-NFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFV 1410
            NL  + L  ++++    D  E F  +S+L  +IL  +   CDCQL+WF  W +  N F   + +     SC +P    N+ + GR    + +  F C   P+P   +   +TV++  G N+SLT +   + D   +  W   G + +  ++ NF R+    I      ++L + NV+  +EG ++C +
Sbjct:  255 NLLVLDLRNNEISWAIEDSNEVFAGLSRLHTLILNTSNLLCDCQLKWFPHW-LNDNGFHQFVNV-----SCAHP----NW-LAGRSPLSVDAEDFICDNFPKPQIKLQPETTVAL-KGMNVSLTCAAASSSDTPMSTAWRKDGEVLYDAEVENFARYHKHGIELIEYITVLHLFNVNFTDEGKYQCVI 430          

HSP 2 Score: 25.409 bits (54), Expect = 2.046e-8
Identity = 30/134 (22.39%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  449 QILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSG 850
            +I++S+     ++L  L++    +  + +  F  L  +E L +  +NV  I +G    L +L+ L +  N++   + ++    +        L  +DLSYN +  + DF F  ++ +LE ++L  ++   I  G
Sbjct:  123 KIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQ-------KLLDLDLSYNQLNRLDDFAFVGLS-SLEKINLGDNRINHIAEG 248          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: nedd4 (NEDD4 E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-478443])

HSP 1 Score: 39.2762 bits (90), Expect = 3.896e-8
Identity = 35/121 (28.93%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  455 LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHL 817
            L ++P+ +P+ +  + + F  +Q+I    F  L KLE L I S++V+ +  GAF  L +L+   +  N L        +++ +    LL LT++ + +N I  I    FN +  +L  LHL
Sbjct:   50 LAAVPSRIPKHVERINLGFNSIQSIGEDSFAGLSKLELLLIHSNDVRNVPNGAFRDLVSLQVFKMSYNKLK-------TITSHTLHGLLGLTRLHIDHNQIEFIHPNAFNGL-MSLRLLHL 162          

HSP 2 Score: 39.2762 bits (90), Expect = 3.896e-8
Identity = 17/50 (34.00%), Postives = 27/50 (54.00%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLW 1023
            LK ++L  + + S+  D+      M  L+ + L GN W CDC ++W L W
Sbjct:  189 LKHLYLSENMIQSLPADM---IKTMPLLENLYLHGNPWVCDCNIKWLLDW 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lgi1 (leucine-rich, glioma inactivated 1 [Source:NCBI gene;Acc:779819])

HSP 1 Score: 55.4546 bits (132), Expect = 3.096e-7
Identity = 35/105 (33.33%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  859 NVYDNLKS-IHLEYSQ--MTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LKS IHL  +   + S+ +DV   F  +  L  + L GN ++CDC+L+W + W+ K N    QI        C +PPE +     GR +N + +  F CI
Sbjct:  128 NAFRGLKSLIHLSLANNNLQSLPKDV---FKGLDSLTNVDLRGNAFHCDCKLKWLVEWLDKTNATVEQIH-------CESPPEYK-----GRKINSLSAKDFDCI 217          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lgi1 (leucine-rich, glioma inactivated 1 [Source:NCBI gene;Acc:779819])

HSP 1 Score: 55.4546 bits (132), Expect = 3.123e-7
Identity = 35/105 (33.33%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  859 NVYDNLKS-IHLEYSQ--MTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LKS IHL  +   + S+ +DV   F  +  L  + L GN ++CDC+L+W + W+ K N    QI        C +PPE +     GR +N + +  F CI
Sbjct:  114 NAFRGLKSLIHLSLANNNLQSLPKDV---FKGLDSLTNVDLRGNAFHCDCKLKWLVEWLDKTNATVEQIH-------CESPPEYK-----GRKINSLSAKDFDCI 203          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lgi1 (leucine-rich, glioma inactivated 1 [Source:NCBI gene;Acc:779819])

HSP 1 Score: 55.4546 bits (132), Expect = 3.218e-7
Identity = 35/105 (33.33%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  859 NVYDNLKS-IHLEYSQ--MTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LKS IHL  +   + S+ +DV   F  +  L  + L GN ++CDC+L+W + W+ K N    QI        C +PPE +     GR +N + +  F CI
Sbjct:  104 NAFRGLKSLIHLSLANNNLQSLPKDV---FKGLDSLTNVDLRGNAFHCDCKLKWLVEWLDKTNATVEQIH-------CESPPEYK-----GRKINSLSAKDFDCI 193          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Tril (TLR4 interactor with leucine-rich repeats [Source:MGI Symbol;Acc:MGI:1914123])

HSP 1 Score: 43.1282 bits (100), Expect = 9.637e-7
Identity = 22/78 (28.21%), Postives = 39/78 (50.00%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRN 1107
            L+ + L  + ++++S D+   F     L  + L GN W CDC+LR    W+    N+ +Q ++      C +PP +R 
Sbjct:  327 LRELSLRDNALSALSGDI---FAASPALYRLDLDGNGWTCDCRLRGLKRWM---GNWHSQGRLLTVFVQCRHPPALRG 398          

HSP 2 Score: 30.4166 bits (67), Expect = 9.637e-7
Identity = 36/133 (27.07%), Postives = 56/133 (42.11%), Query Frame = 2
Query:  410 QSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMS-LSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLE 805
            Q SL+ A   +P   L+S+ T        L +S   LQ +  + F HLP+L  LS+  + +  +   AF          L     +   GN ++ L   +  PL SL  +DLS N +  +    F H  +  E
Sbjct:  216 QPSLRHAATFVP---LRSLST--------LILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFW--------GLEALRELRLEGNRLNQLPLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLRE 329          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 52.7582 bits (125), Expect = 1.837e-6
Identity = 41/165 (24.85%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  925 VEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLT-SIFRNVDEKQNIFWENKGNI-FSMKI-NFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFV 1410
            ++E+    + LK ++L  +   CDC L+W L W++  NNF + + +     SC +P  +    I   DL   +   F   P+  T   +     G N++LT +   + D   +  W     I + + I NF R+   +       S+L + +V+  +EG ++C V
Sbjct:  424 IQENAFSQTHLKGLVLNTSSLLCDCHLKWLLQWLV-DNNFHHSVNV-----SCAHPEWLAGQSILNVDLKDFVCDDF-LKPQIRTHPESTIALRGVNVTLTCTAVSSSDSPMSTIWRKDSEILYDVDIENFVRYRQQDGEALEYTSVLRLFSVNFTDEGKYQCIV 581          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 52.7582 bits (125), Expect = 1.840e-6
Identity = 41/165 (24.85%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  925 VEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLT-SIFRNVDEKQNIFWENKGNI-FSMKI-NFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFV 1410
            ++E+    + LK ++L  +   CDC L+W L W++  NNF + + +     SC +P  +    I   DL   +   F   P+  T   +     G N++LT +   + D   +  W     I + + I NF R+   +       S+L + +V+  +EG ++C V
Sbjct:  424 IQENAFSQTHLKGLVLNTSSLLCDCHLKWLLQWLV-DNNFHHSVNV-----SCAHPEWLAGQSILNVDLKDFVCDDF-LKPQIRTHPESTIALRGVNVTLTCTAVSSSDSPMSTIWRKDSEILYDVDIENFVRYRQQDGEALEYTSVLRLFSVNFTDEGKYQCIV 581          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 51.2174 bits (121), Expect = 5.368e-6
Identity = 40/162 (24.69%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  934 SFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLT-SIFRNVDEKQNIFWENKGNI-FSMKI-NFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFV 1410
            S  + S +  ++L  +   CDC L+W L W++  NNF + + +     SC +P  +    I   DL   +   F   P+  T   +     G N++LT +   + D   +  W     I + + I NF R+   +       S+L + +V+  +EG ++C V
Sbjct:   69 SGPLPSDISSLVLNTSSLLCDCHLKWLLQWLV-DNNFHHSVNV-----SCAHPEWLAGQSILNVDLKDFVCDDF-LKPQIRTHPESTIALRGVNVTLTCTAVSSSDSPMSTIWRKDSEILYDVDIENFVRYRQQDGEALEYTSVLRLFSVNFTDEGKYQCIV 223          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6WRI0|IGS10_HUMAN (Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1)

HSP 1 Score: 42.743 bits (99), Expect = 2.642e-9
Identity = 32/110 (29.09%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFS------CTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSN 1185
            +K ++L  + +TS+    +E  + M  L  + L GN W CDC L+W   WI +K +   + K +R   S      C NP   +     G+ L  + +  FQC    I S+
Sbjct:  187 IKFLYLSDNFLTSLP---QEMVSYMPDLDSLYLHGNPWTCDCHLKWLSDWIQEKPDVI-KCKKDRSPSSAQQCPLCMNPRTSK-----GKPLAMVSAAAFQCAKPTIDSS 287          

HSP 2 Score: 41.9726 bits (97), Expect = 2.642e-9
Identity = 45/165 (27.27%), Postives = 73/165 (44.24%), Query Frame = 2
Query:  386 CTVILRSQQSSLKKAVCNMPEQI------LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNI-PDFFFNHVNQTLESLHLSHSKTEIILSGNSL 859
            C V     ++  ++  C MP ++      L SIP  +P  +  + + +  L  +   +F  L KLE L + S+ + TI +  F  L  L+ L +  N +         L K  F+ L SLT++ + +N+I  I P+ F+      L  L L H      L GN L
Sbjct:   19 CLVATPGGKACPRRCACYMPTEVHCTFRYLTSIPDSIPPNVERINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNKV-------RKLQKDTFYGLRSLTRLHMDHNNIEFINPEVFYG-----LNFLRLVH------LEGNQL 165          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O94898|LRIG2_HUMAN (Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 1.582e-7
Identity = 45/165 (27.27%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  925 VEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLT-SIFRNVDEKQNIFWENKGNIF--SMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFV 1410
            ++E+    + LKE+IL  +   CDC L+W L W++  NNF++ + +     SC +P  +    I   DL   +   F   P+  T   T+    G N++LT +   + D   +  W     I       NF R+           SIL + NV+  +EG ++C V
Sbjct:  425 IQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLV-DNNFQHSVNV-----SCAHPEWLAGQSILNVDLKDFVCDDF-LKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEILYDVDTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIV 582          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6WRH9|IGS10_RAT (Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1)

HSP 1 Score: 38.5058 bits (88), Expect = 6.426e-7
Identity = 43/165 (26.06%), Postives = 75/165 (45.45%), Query Frame = 2
Query:  386 CTVILRSQQSSLKKAVCNMPEQI------LKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNI-PDFFFNHVNQTLESLHLSHSKTEIILSGNSL 859
            C V+    ++  ++  C +P ++      L SIP  +P  +  + + +  L  +   +F  L KLE L + S+ +  + +  F  L +L+ L +  N + I       + K  F+ L SL ++ L +N+I  I P+ F+      L SL L H      L GN L
Sbjct:   19 CLVVTPGSRACPRRCACYVPTEVHCTFRYLTSIPDGIPANVERINLGYNSLTRLTENDFDGLSKLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-------IRKDTFYGLGSLVRLHLDHNNIEFINPEAFYG-----LTSLRLVH------LEGNRL 165          

HSP 2 Score: 38.1206 bits (87), Expect = 6.426e-7
Identity = 17/51 (33.33%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWI 1026
            +K + L  + +TS+ +   E  + M  L+ + L GN W CDC L+W   W+
Sbjct:  187 IKYLFLSDNFLTSLPK---EMVSYMPNLESLYLHGNPWTCDCHLKWLSEWM 234          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183A877 (Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.415e-29
Identity = 58/236 (24.58%), Postives = 105/236 (44.49%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNN---FRNQIK--INR-------------------KGFSCTNPPEIRNYDIFGR---------DLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENNAENS 1482
            L+ + L Y+ + S+    E + + M +LKE+ L GN W CDC LRW  +W +K N+   +   +   +NR                    G S   P     Y +FGR          L  + +  F C+P+ +T+N  V +  G N +LT  F   D    + W   G +   +  + R  + + +G+  ++ LT+ +V   + G + CF+D  + ++   + + V S++   +S
Sbjct:  263 LQLLDLSYNHLESLPESFESTLHHM-QLKELYLYGNPWRCDCNLRWLKVWFLKYNSKLIYSRPVPEGVNRNLLDPSAQRWYDYNYDGTGDGPSLLQPRCASPYALFGRPLFSHQTLAGLQPVRTTDFHCLPQALTANQPVQLTLGSNATLTCEFF-ADPTGIVVWYRNGTLIQQR--WARMSMHQTTGRTFQAELTVQDVQPSDAGTYVCFLDTGHGRVNTTFSVQVNSDDQTVSS 494          

HSP 2 Score: 70.0922 bits (170), Expect = 3.415e-29
Identity = 48/183 (26.23%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  341 IFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFP-----LLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTI 874
            + ++ L K  FSV+GC   +  +  S+++++C+ P+    +IP  LP  +V+L ++ QD+  + + +F HLP L YL + S+ +  I    F          L +   +    N +  S   F P     L+ L  ++L  N +G +P   F  +  +L SL LS    +  L   +L  +T+
Sbjct:   88 LIVITLPKAAFSVRGCVTYVAGEDYSMRQSICDKPDTHFTTIPAALPSQVVKLTVNHQDITELNSTQFKHLPNLTYLDLDSNKIVRIHPNTF--------HVLKHLQTLSLRFNLLIFSVDSFHPDVTHGLIGLENLNLLQNPMGYVPKRIFAPIGSSLRSLVLSGGSEDFQLDPGALDGLTM 262          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P8EXC8 (Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3162 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.443e-29
Identity = 58/236 (24.58%), Postives = 105/236 (44.49%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNN---FRNQIK--INR-------------------KGFSCTNPPEIRNYDIFGR---------DLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENNAENS 1482
            L+ + L Y+ + S+    E + + M +LKE+ L GN W CDC LRW  +W +K N+   +   +   +NR                    G S   P     Y +FGR          L  + +  F C+P+ +T+N  V +  G N +LT  F   D    + W   G +   +  + R  + + +G+  ++ LT+ +V   + G + CF+D  + ++   + + V S++   +S
Sbjct:  263 LQLLDLSYNHLESLPESFESTLHHM-QLKELYLYGNPWRCDCNLRWLKVWFLKYNSKLIYSRPVPEGVNRNLLDPSAQRWYDYNYDGTGDGPSLLQPRCASPYALFGRPLFSHQTLAGLQPVRTTDFHCLPQALTANQPVQLTLGSNATLTCEFF-ADPTGIVVWYRNGTLIQQR--WARMSMHQTTGRTFQAELTVQDVQPSDAGTYVCFLDTGHGRVNTTFSVQVNSDDQTVSS 494          

HSP 2 Score: 70.4774 bits (171), Expect = 3.443e-29
Identity = 48/183 (26.23%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  341 IFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFP-----LLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTI 874
            + ++ L K  FSV+GC   +  +  S+++++C+ P+    +IP  LP  +V+L ++ QD+  + + +F HLP L YL + S+ +  I    F          L +   +    N +  S   F P     L+ L  ++L  N +G +P   F  +  +L SL LS    +  L   +L  +T+
Sbjct:   88 LIVITLPKAAFSVRGCVTYVAGEDYSMRQSICDKPDTHFTTIPAALPSQVVKLTVNHQDITELNSTQFKHLPNLTYLDLDSNKIVRIHPNTF--------HVLKHLQTLSLRFNLLIFSVDSFHPDVTHGLIGLENLNLLQNPMGYVPKRIFAPIGSSLRSLVLSGGSEDFQLDPGALDGLTM 262          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A2H1CPY5 (Immunoglobulin I-set domain protein OS=Fasciola hepatica OX=6192 GN=D915_002068 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.966e-26
Identity = 57/236 (24.15%), Postives = 102/236 (43.22%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNF------------RNQIKI------------NRKGFSCTNPPEIRNYDIFGRD---------LNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENNAENS 1482
            L+ + L Y+ + ++    E + + M +LKE+ L GN W CDC LRW  +W +K N              RN +              N    S   P     Y +FGR          L  + +  F C+P+ +T N  + I  G N ++T  F   D    + W   G +   +  ++R  + + +G+  ++ LTI +V  ++ G + CF+D  + ++   + + V +E+    S
Sbjct:  224 LQVLDLSYNHLETLHESFETTIHHM-QLKELYLYGNPWRCDCNLRWLKVWFLKVNTKLIYSRPVPEGVNRNLLDPSAQRWYDYNYGGNGDAPSLLQPRCASPYALFGRPLFSHQTLSGLQPVRTTDFHCLPQALTPNQPIQIMKGSNATITCEFF-ADPTGIVVWYRNGTLIQQR--WERMSMHQTTGRTFQAELTIKDVQSIDAGTYVCFLDTGHGRVNTTFSVQVSTEDQHAPS 455          

HSP 2 Score: 62.003 bits (149), Expect = 4.966e-26
Identity = 48/184 (26.09%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  344 FILILVK---PCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTI*KVF 886
            +ILI++    P   V+GC   +  +  S+++++C+ P+    +IP  LP  +V+L ++ QD+  +   +F HLP L YL + S+ +  I    F     LK L + +    + T    S    +   L+ L  ++L  N +G +P   F  +  +L  L LS    +  L   +L  +T+ +V 
Sbjct:   47 YILIVISLPTPATPVRGCVTYVAGEDYSMRQSICDKPDTHFLTIPASLPSQVVKLTVNHQDISELNASQFRHLPNLTYLDLDSNKIIRIHPNTF---HVLKHLRILSLRFNLLTFGVNSFHPDVPHGLIYLESLNLLQNPMGYVPKRIFAPLGSSLRVLVLSGGSEDFQLDPGALEGLTMLQVL 227          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P7NYU0 (Ig-like domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6577 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.190e-26
Identity = 68/173 (39.31%), Postives = 99/173 (57.23%), Query Frame = 2
Query:  341 IFILILVK---PCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNI-PDFFFNHVNQTLESLHLSHSKTEIILS 847
            +F+L+L     P  +V+GCTVI        KKA+C+    +L S+P DLPE L+ L I+ Q+++ + +     L  LE L + SS ++ +   AF  L+ LK LSL NNSL I  GN +S +   F  L SL  +DLSYN +G I P+FF   V +TL+ L L H+  +  L+
Sbjct:   10 VFVLLLAVYTFPVVAVRGCTVIAIQPDLRWKKAICDSTTSLLTSLPLDLPEMLINLRITQQNIRQLNDNVLKKLIYLEELCVESSGLEQVDVNAFRGLTRLKILSLRNNSLRIDEGNLLSAT---FHHLPSLEILDLSYNPLGFIPPNFFPASVGKTLKELRLEHTNGDGALN 179          

HSP 2 Score: 67.781 bits (164), Expect = 7.190e-26
Identity = 55/208 (26.44%), Postives = 89/208 (42.79%), Query Frame = 1
Query:  868 DNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGF---------SCTNPPEIRNYDIFGRDLNKILSM-KFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFW-ENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVE 1458
            + L+ + L ++   S+  D    F  M  L+E+ L GN W CDC LRW   W +       +    RK           +C+ P  +    IFG    K + + +F C     +   TVS+    N+SL       D   N+ W +NK  +  +   + RF   +I+    ++ L I NV+K + G W+C +  +  Q      LTV+
Sbjct:  189 EQLRVLDLSFAGFRSLPVDFRSVFARMENLRELQLGGNPWVCDCTLRWLKDWYLTDAPPSMRFSYTRKTLQETHVNVAPTCSEPYSVHGKQIFGSSGPKTIKLEEFLCKQWISSKVKTVSVPEQSNVSL-KCHGYSDTPVNVQWFKNKNILTKLPRRYSRF---QINSPEFQATLHISNVAKEDAGFWECALGEDGGQQRASINLTVK 392          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A504Z776 (Leucine-rich repeat-containing protein 4 OS=Fasciola gigantica OX=46835 GN=FGIG_10709 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.001e-25
Identity = 57/236 (24.15%), Postives = 104/236 (44.07%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNN---FRNQIK--INRK--------------GFSCTNPPEIR-----NYDIFGRDL---------NKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENNAENS 1482
            L+ + L Y+ + ++    E + + M +LKE+ L GN W CDC LRW  +W +K N    +   +   +NR               G S   P  ++      Y +FGR L           + +  F C+P+ +T N  + I  G N ++T  F   D    + W   G +   +  ++R    + +G+  ++ LTI +V  ++ G + CF+D    ++   + + V +E+    S
Sbjct:  224 LQVLDLSYNHLETLHESFETTISHM-QLKELYLYGNPWRCDCNLRWLKVWFLKVNTKLIYSRPVPEGVNRNLLDPSAQRWYDYNYGGSGDAPSLLQPRCASPYALFGRPLFSHQTLSGIQPVRTTDFHCLPQALTPNQPIQIMKGSNATITCEFF-ADPTGIVVWYRNGTLIQQR--WERMSTHQTTGRTFQAELTIRDVQSIDAGTYVCFLDTGQGRVNTTFSVQVSTEDQHAPS 455          

HSP 2 Score: 62.3882 bits (150), Expect = 1.001e-25
Identity = 54/203 (26.60%), Postives = 94/203 (46.31%), Query Frame = 2
Query:  281 NAQ*FVLIFLMLLGTRIIRPIFILI-LVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTI*KVF 886
            N Q   L  ++ +  RI   I I+I L  P   V+GC   +  +  S+++++C+ P+    +IP  LP  +V+L ++ QD+  +   +F HLP L YL + S+ +  I    F     LK L   +    + T    S    +   L+ L  ++L  N +G +P   F  +  +L  L LS    +  L   +L  +T+ +V 
Sbjct:   28 NIQHRALPVIIDMNCRIQFYILIVISLPTPATPVRGCVTYVAGEDYSMRQSICDKPDTHFLTIPASLPSQVVKLTVNHQDISELNASQFRHLPNLTYLDLDSNKIIRIHPNTF---HVLKHLRTLSLRFNLLTFGVNSFHPDVPHGLIYLESLNLLQNPMGYVPKRIFAPLGSSLRVLVLSGGSEDFQLDPGALDGLTMLQVL 227          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 52.373 bits (124), Expect = 4.900e-9
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  859 NVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNK----------ILSMKFQCIPEPITSNSTV 1194
            + +D L+S+ L       +S   E +FN ++ L  + L  N   CDC+LRW   W+  K  F+ +  I R    CT PP++ +  +    LN+          ++S    C+  P  +N T 
Sbjct:  794 HAFDGLRSLRLLTLHGNDLSTIPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWV--KAGFK-EPGIAR----CTGPPDMADRLLLTTPLNRFQCKGPVDLNLMSKCAPCLATPCQNNGTC 908          

HSP 2 Score: 28.4906 bits (62), Expect = 4.900e-9
Identity = 18/55 (32.73%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  677 GNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEII 841
            GN ++        L  L+ VDLS NSI ++  F F+++ Q L +L LS+++   +
Sbjct:  738 GNMLTSVPKELSSLKQLSLVDLSNNSISSLTPFIFSNMTQ-LSTLILSYNQIRCV 791          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 52.373 bits (124), Expect = 5.357e-9
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  859 NVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNK----------ILSMKFQCIPEPITSNSTV 1194
            + +D L+S+ L       +S   E +FN ++ L  + L  N   CDC+LRW   W+  K  F+ +  I R    CT PP++ +  +    LN+          ++S    C+  P  +N T 
Sbjct:  794 HAFDGLRSLRLLTLHGNDLSTIPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWV--KAGFK-EPGIAR----CTGPPDMADRLLLTTPLNRFQCKGPVDLNLMSKCAPCLATPCQNNGTC 908          

HSP 2 Score: 28.4906 bits (62), Expect = 5.357e-9
Identity = 18/55 (32.73%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  677 GNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEII 841
            GN ++        L  L+ VDLS NSI ++  F F+++ Q L +L LS+++   +
Sbjct:  738 GNMLTSVPKELSSLKQLSLVDLSNNSISSLTPFIFSNMTQ-LSTLILSYNQIRCV 791          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 52.373 bits (124), Expect = 5.397e-9
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  859 NVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNK----------ILSMKFQCIPEPITSNSTV 1194
            + +D L+S+ L       +S   E +FN ++ L  + L  N   CDC+LRW   W+  K  F+ +  I R    CT PP++ +  +    LN+          ++S    C+  P  +N T 
Sbjct:  818 HAFDGLRSLRLLTLHGNDLSTIPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWV--KAGFK-EPGIAR----CTGPPDMADRLLLTTPLNRFQCKGPVDLNLMSKCAPCLATPCQNNGTC 932          

HSP 2 Score: 28.4906 bits (62), Expect = 5.397e-9
Identity = 18/55 (32.73%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  677 GNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEII 841
            GN ++        L  L+ VDLS NSI ++  F F+++ Q L +L LS+++   +
Sbjct:  762 GNMLTSVPKELSSLKQLSLVDLSNNSISSLTPFIFSNMTQ-LSTLILSYNQIRCV 815          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 51.9878 bits (123), Expect = 5.715e-9
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  859 NVYDNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNK----------ILSMKFQCIPEPITSNSTV 1194
            + +D L+S+ L       +S   E +FN ++ L  + L  N   CDC+LRW   W+  K  F+ +  I R    CT PP++ +  +    LN+          ++S    C+  P  +N T 
Sbjct:  794 HAFDGLRSLRLLTLHGNDLSTIPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWV--KAGFK-EPGIAR----CTGPPDMADRLLLTTPLNRFQCKGPVDLNLMSKCAPCLATPCQNNGTC 908          

HSP 2 Score: 28.4906 bits (62), Expect = 5.715e-9
Identity = 18/55 (32.73%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  677 GNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEII 841
            GN ++        L  L+ VDLS NSI ++  F F+++ Q L +L LS+++   +
Sbjct:  738 GNMLTSVPKELSSLKQLSLVDLSNNSISSLTPFIFSNMTQ-LSTLILSYNQIRCV 791          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lgi1b (leucine rich glioma inactivated 1 [Source:NCBI gene;Acc:103038693])

HSP 1 Score: 55.0694 bits (131), Expect = 2.226e-7
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  871 NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            +L  + L Y+ + ++ +DV   F  M  L ++ L GN++NCDC+L+W + W+   N   +Q+        C+ PP  +     G+ +N ++   F CI
Sbjct:  136 SLLHLSLAYNNLETLPKDV---FMGMDALTKVDLRGNMFNCDCKLKWLVEWMFNTNATVDQMY-------CSGPPVYQ-----GKKINDLMPQSFDCI 218          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LGI1 (leucine rich glioma inactivated 1 [Source:HGNC Symbol;Acc:HGNC:6572])

HSP 1 Score: 49.2914 bits (116), Expect = 2.603e-6
Identity = 29/105 (27.62%), Postives = 51/105 (48.57%), Query Frame = 1
Query:  859 NVYDNLKSI-HLEYS--QMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LK++ HL  +  ++ S+ RDV   F  +  + ++ L GN  +CDC+++W + W+   N   + I       +C +PPE       GR    + +  F CI
Sbjct:  116 NAFRGLKTLTHLSLANNKLRSLPRDV---FKGLDAMTDVDLRGNALHCDCKMKWLVSWLHSTNASVHDI-------TCASPPEFA-----GRSTRSLSASDFSCI 205          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrtm1 (leucine rich repeats and transmembrane domains 1 [Source:NCBI gene;Acc:105354381])

HSP 1 Score: 43.8986 bits (102), Expect = 1.311e-8
Identity = 25/85 (29.41%), Postives = 44/85 (51.76%), Query Frame = 1
Query:  871 NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWI---IKKNNFRNQIKINRKGFSCTNPPEIRNYDI 1116
            NL  + L Y+++T + R + E+   M+ L  + L GN W CDCQ+    LW+   + K    +++        C+ P E++N D+
Sbjct:  153 NLSFLGLAYNRLTRLDRSLMEA---MTLLDGLTLQGNPWRCDCQMIGLKLWLETYVFKGGAIDEVL-------CSQPEEMKNKDL 227          

HSP 2 Score: 35.4242 bits (80), Expect = 1.311e-8
Identity = 36/147 (24.49%), Postives = 69/147 (46.94%), Query Frame = 2
Query:  332 IRPIFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSM-SLSKYIFFPLLSLTKVDLSYNSIGNIP 769
            +R I +  L+ P    + C      ++ S    V +   + L  IP  L     EL +    ++ I +  F  +P +  L + ++++ +I   A + L  L+ LSL +        NS+    + +  P+ SL+++DLS+NS+G +P
Sbjct:   11 MRVILVCALLSPLSLAQAC-----PKECSCNNKVVDCRGRGLYDIPRRLHPETQELYLQDNRIRGIVSMAFREIPLVRILDLSNNSITSISPTALLGLRTLQRLSLAH--------NSLREFDRRLLIPIHSLSRLDLSHNSLGGLP 144          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lgi1b (leucine rich glioma inactivated 1 [Source:NCBI gene;Acc:101163854])

HSP 1 Score: 55.4546 bits (132), Expect = 1.810e-7
Identity = 37/105 (35.24%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  859 NVYDNLKS-IHLE--YSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LK+ IHL   Y+ + ++ RDV   F  M  L ++ L GN   CDC+L+W + W+ + N   +QI        C+ PP   NY   GR +N +L   F CI
Sbjct:  135 NAFRGLKALIHLSLAYNNLDTLPRDV---FKGMDALNKVDLRGNNLICDCKLKWLVEWMHQTNATLDQIH-------CSGPP---NYQ--GRKINDLLPHSFDCI 224          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lgi1b (leucine rich glioma inactivated 1 [Source:NCBI gene;Acc:101163854])

HSP 1 Score: 55.4546 bits (132), Expect = 1.974e-7
Identity = 37/105 (35.24%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  859 NVYDNLKS-IHLE--YSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LK+ IHL   Y+ + ++ RDV   F  M  L ++ L GN   CDC+L+W + W+ + N   +QI        C+ PP   NY   GR +N +L   F CI
Sbjct:  135 NAFRGLKALIHLSLAYNNLDTLPRDV---FKGMDALNKVDLRGNNLICDCKLKWLVEWMHQTNATLDQIH-------CSGPP---NYQ--GRKINDLLPHSFDCI 224          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lgi1b (leucine rich glioma inactivated 1 [Source:NCBI gene;Acc:101163854])

HSP 1 Score: 55.0694 bits (131), Expect = 2.134e-7
Identity = 37/105 (35.24%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  859 NVYDNLKS-IHLE--YSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCI 1164
            N +  LK+ IHL   Y+ + ++ RDV   F  M  L ++ L GN   CDC+L+W + W+ + N   +QI        C+ PP   NY   GR +N +L   F CI
Sbjct:  128 NAFRGLKALIHLSLAYNNLDTLPRDV---FKGMDALNKVDLRGNNLICDCKLKWLVEWMHQTNATLDQIH-------CSGPP---NYQ--GRKINDLLPHSFDCI 217          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000051096.1 (SMESG000051096.1)

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 510/514 (99.22%), Postives = 513/514 (99.81%), Query Frame = 1
Query:  871 NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENNAENSPVLNNPTSKNAIVYAXXXXXXXXXXXXXXXXXXYYCKFYKGNLFSIIARPSFNIVSKRQSKNHFYKNIAQKSQNPFSISKDSIKLEDKIYDNVPISSGFYINFTKKKNEQNFSTLNCLDCQNYAIVDEIFTDSSDPHSNKTKSPRFWYLDDAVDGIEYLPPAASVDIGNDLTASEISDGDSAFITRIPSRTPCPIHSSHASMNNLKRSLSNIKQNSFNQINEIEPCPIHGKQNSQNSYSVHFRIPDQQLNSSKNIPNSRKPKIKTKPNRFCNSSDKSHSKNYFPVYLSTLDMQVNDDTLYRQYSCLTNSV 2412
            NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIK NNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKIN+KRFIITEISGKYRKSILTILNVSKLEEG+WKCFVDFENKQIGIEYFLTVESENNAENSPVLNNPTSKNAIVYASVSSSLILLFIIGLIIAIYYCKFYKGNLFSIIARPSFNIVSKRQSKNHFYKNIAQKSQNPFSISKDSIKLEDKIYDNVPISSGFYINFTKKKNEQNFSTLNCLDCQNYAIVDEIFTDSSDPHSNKTKSPRFWYLDDAVDGIEYLPPAASVDIGN+LTASEISDGDSAFITRIPSRTPCPIHSSHASMNNLKRSLSNIKQNSFNQINEIEPCPIHGKQNSQNSYSVHFRIPDQQLNSSKNIPNSRKPKIKTKPNRFCNSSDKSHSKNYFPVYLSTLDMQVNDDTLYRQYSCLTNSV
Sbjct:  188 NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKNNNFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINYKRFIITEISGKYRKSILTILNVSKLEEGIWKCFVDFENKQIGIEYFLTVESENNAENSPVLNNPTSKNAIVYASVSSSLILLFIIGLIIAIYYCKFYKGNLFSIIARPSFNIVSKRQSKNHFYKNIAQKSQNPFSISKDSIKLEDKIYDNVPISSGFYINFTKKKNEQNFSTLNCLDCQNYAIVDEIFTDSSDPHSNKTKSPRFWYLDDAVDGIEYLPPAASVDIGNNLTASEISDGDSAFITRIPSRTPCPIHSSHASMNNLKRSLSNIKQNSFNQINEIEPCPIHGKQNSQNSYSVHFRIPDQQLNSSKNIPNSRKPKIKTKPNRFCNSSDKSHSKNYFPVYLSTLDMQVNDDTLYRQYSCLTNSV 701          

HSP 2 Score: 335.109 bits (858), Expect = 1.408e-103
Identity = 186/187 (99.47%), Postives = 187/187 (100.00%), Query Frame = 2
Query:  311 MLLGTRIIRPIFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMT 871
            MLLGTRIIRPIFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQLSNLKSLSLFNNSLIISTGNSMS+SKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMT
Sbjct:    1 MLLGTRIIRPIFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQLSNLKSLSLFNNSLIISTGNSMSMSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMT 187          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000075643.1 (SMESG000075643.1)

HSP 1 Score: 96.2857 bits (238), Expect = 6.913e-40
Identity = 72/173 (41.62%), Postives = 108/173 (62.43%), Query Frame = 2
Query:  341 IFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSL 859
            IF+   +    +V+GCTV+L+S QS+ K A+CN P   L+ IP DL   L+ LE+ +Q+L ++   EF H+ +LE L++ S  V+ I   AF  LS L  L+L NNSL+I   N  +L   IF PL+ LT +DLS+N I  IP  FF ++ ++L+ L +S+SK+   +S +SL
Sbjct:   15 IFVTFSIPQSDAVRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDIN--NLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSL 185          

HSP 2 Score: 88.5817 bits (218), Expect = 6.913e-40
Identity = 49/196 (25.00%), Postives = 99/196 (50.51%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFS------CTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEY 1443
            L+ + + ++ +  +    E  F+ M  L+ +IL GN W CDC++RW + W           + +    S      C +P  + N  +       I S +F C P+ ++ NS   +  G+N+SL   F+++D+   I W + G +  +K N + ++I   + ++R S+LT+++ +    G+W+C++ F++  IG  +
Sbjct:  191 LERLDISHNNLIQLDSGFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGSFPAESSPSSLSHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTL--LKSNSRNYVIKSDTKRHR-SVLTLIHFTIKLSGLWRCYILFDDNIIGTNF 383          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000058478.1 (SMESG000058478.1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.817e-23
Identity = 49/204 (24.02%), Postives = 90/204 (44.12%), Query Frame = 1
Query:  874 LKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGF-------SCTNPPEIRNYDI--FGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVE 1458
            L+ + +  S +T++ R +  + N M +L +    GN W CDC L+W   W +K  + R   K +R           C +P + + Y+I  F  + + I   +  C P+  T N  + I  G+N++L   F   D    + W   G    ++ ++K+    + SG    + L+I      + G+W+C +  + +     Y L V 
Sbjct:  187 LEYLDISASHLTALDRQIHSALNNM-QLTDFYFFGNQWTCDCNLKWLKKWGLKHKDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFE-ADPGGTVEWSKNG--MRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR 386          

HSP 2 Score: 53.1434 bits (126), Expect = 8.817e-23
Identity = 47/166 (28.31%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  374 SVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMT 871
            SV GC  I+ +++   K+ +C+  E     IP DLP+ +  LE+  Q++ ++   + + +  LE L++ S+ + +I+  AF             ++ +I  GNS   +      L  L  +DL  N +G +PDFFF  + + L  L LS +     L  NSL+ +T
Sbjct:   26 SVVGCVTIMIAEKR--KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAF-NNVPKLKTLSLKSNFLILGGNSFPSA--ALLQLKHLKVLDLDNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLT 185          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000023338.1 (SMESG000023338.1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.107e-20
Identity = 52/197 (26.40%), Postives = 92/197 (46.70%), Query Frame = 1
Query:  868 DNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQIKINRKGFSCTNPPEIRNYDIF-GRDLNKILSMKFQCIPEPI----TSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVD--FENKQIGI 1437
            ++L+ + L  S + +I++ +E  F  M  L+ ++L  N W CDC LRW   ++ +   F      N+ G  C  P  + NY I  G D N+   ++F C   PI     S   V + + ++++LT    + D  + + W   G  + ++    +F I     +   S L I ++  ++ G W C VD  F+N  + I
Sbjct:  185 NSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFS-DPIKPVIWTKNG--YKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVDDVFQNFTLKI 375          

HSP 2 Score: 57.7658 bits (138), Expect = 2.107e-20
Identity = 49/140 (35.00%), Postives = 77/140 (55.00%), Query Frame = 2
Query:  362 KPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFF 781
            K   ++KGC V L +  S  ++ +C  P+  ++ IP  LP+A   L I+ Q++  I  ++F ++ +L  LS+  SN++ I   AF  LS L  L L  N LI+   N  SL  Y+   L++L  + L+ N +  IPDFFF
Sbjct:   19 KDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLIL---NDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFF 155          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 60.4622 bits (145), Expect = 6.421e-19
Identity = 52/213 (24.41%), Postives = 85/213 (39.91%), Query Frame = 1
Query:  871 NLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKK-----NNFRNQIKINRKGF------SCTNPPEIRNYDIFGRDLN--KILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKSILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENN 1470
            NL+ + L  +  T++S  +  S   M +L E  L  N WNCDC L+W   W          +    I IN           C +P  +   +IF    N   I     +C P   T +    +    NI+ T  F + +    + W   G I  ++ +++R       G   K+ LT+ NV + + G W+C +     ++   + L V S  N
Sbjct:  189 NLQVLDLTNNHFTTLSEGLSISLKAM-QLNEFYLFNNPWNCDCNLQWLKAWFTSHKVKYTKDLSKDITINGGKIIEDLQPKCESPFPLSERNIFSDSTNTDSIGINDLKCAPRIFTQDRVYEMTKDHNITFTCEF-HANPGGTVTWSKNGMI--VQNHWRRVSWNRSQGIKFKAWLTLQNVEENDSGNWRCILTTHVSKVNATFLLKVISPQN 397          

HSP 2 Score: 53.9138 bits (128), Expect = 6.421e-19
Identity = 55/178 (30.90%), Postives = 90/178 (50.56%), Query Frame = 2
Query:  341 IFILI-LVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQXXXXXXXXXXXXXXXXXTGNSMSLSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMT 871
            IFI++  V+   SV+GC  I++   S  K ++C   +     IP   P+ + E+ I  Q+L  I + +  +LP L  L++ S+ +  +   AF  +  L SL L  N + +   NSM  S  I+  L  L  +DLS N +G +PD++F  + Q L  L+LS +     +  N L  +T
Sbjct:   17 IFIVLDQVQFGLSVQGCITIMK--DSKYKMSICTNYKANFTRIPERFPDQVAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSPNAFTHVPQLISLRLSGNQIYLGE-NSMPSSSLIY--LKKLHTLDLSENPLGFVPDYYFQLLKQ-LRILNLSTANKGFYIETNGLYGLT 188          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
IGSF105.961e-1029.09immunoglobulin superfamily member 10 [Source:HGNC ... [more]
LRIG23.294e-827.27leucine rich repeats and immunoglobulin like domai... [more]
TRIL1.356e-626.92TLR4 interactor with leucine rich repeats [Source:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kek13.260e-723.04gene:FBgn0015399 transcript:FBtr0346702[more]
kek13.260e-723.04gene:FBgn0015399 transcript:FBtr0332210[more]
kek51.920e-623.76gene:FBgn0031016 transcript:FBtr0074707[more]
kek51.920e-623.76gene:FBgn0031016 transcript:FBtr0309224[more]
kek51.920e-623.76gene:FBgn0031016 transcript:FBtr0074708[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxra5a3.079e-838.00matrix-remodelling associated 5a [Source:ZFIN;Acc:... [more]
mxra5a3.970e-825.95matrix-remodelling associated 5a [Source:ZFIN;Acc:... [more]
slit34.927e-827.05slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
slit35.253e-827.05slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
lgi1b7.941e-727.59leucine-rich, glioma inactivated 1b [Source:ZFIN;A... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRIG22.046e-826.60leucine-rich repeats and immunoglobulin like domai... [more]
nedd43.896e-828.93NEDD4 E3 ubiquitin protein ligase [Source:Xenbase;... [more]
lgi13.096e-733.33leucine-rich, glioma inactivated 1 [Source:NCBI ge... [more]
lgi13.123e-733.33leucine-rich, glioma inactivated 1 [Source:NCBI ge... [more]
lgi13.218e-733.33leucine-rich, glioma inactivated 1 [Source:NCBI ge... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tril9.637e-728.21TLR4 interactor with leucine-rich repeats [Source:... [more]
Lrig21.837e-624.85leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig21.840e-624.85leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig25.368e-624.69leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6WRI0|IGS10_HUMAN2.642e-929.09Immunoglobulin superfamily member 10 OS=Homo sapie... [more]
sp|O94898|LRIG2_HUMAN1.582e-727.27Leucine-rich repeats and immunoglobulin-like domai... [more]
sp|Q6WRH9|IGS10_RAT6.426e-726.06Immunoglobulin superfamily member 10 OS=Rattus nor... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A8773.415e-2924.58Ig-like domain-containing protein OS=Echinostoma c... [more]
A0A3P8EXC83.443e-2924.58Ig-like domain-containing protein OS=Echinostoma c... [more]
A0A2H1CPY54.966e-2624.15Immunoglobulin I-set domain protein OS=Fasciola he... [more]
A0A3P7NYU07.190e-2639.31Ig-like domain-containing protein (Fragment) OS=Di... [more]
A0A504Z7761.001e-2524.15Leucine-rich repeat-containing protein 4 OS=Fascio... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slit34.900e-927.05slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
slit35.357e-927.05slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
slit35.397e-927.05slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
slit35.715e-927.05slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
lgi1b2.226e-728.57leucine rich glioma inactivated 1 [Source:NCBI gen... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LGI12.603e-627.62leucine rich glioma inactivated 1 [Source:HGNC Sym... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lrtm11.311e-829.41leucine rich repeats and transmembrane domains 1 [... [more]
lgi1b1.810e-735.24leucine rich glioma inactivated 1 [Source:NCBI gen... [more]
lgi1b1.974e-735.24leucine rich glioma inactivated 1 [Source:NCBI gen... [more]
lgi1b2.134e-735.24leucine rich glioma inactivated 1 [Source:NCBI gen... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051096.11.408e-10399.22SMESG000051096.1[more]
SMESG000075643.16.913e-4041.62SMESG000075643.1[more]
SMESG000058478.18.817e-2324.02SMESG000058478.1[more]
SMESG000023338.12.107e-2026.40SMESG000023338.1[more]
SMESG000006317.16.421e-1924.41SMESG000006317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000862 ID=SMED30000862|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2413bp
GGCATTCATATCTGTCAATAGAAAACGGATTTCTATATATAAAATTTCTA
ATCTGTAATTTTGGTTACTAATATCAAGCAAAAAACCAATCGCATTAAAA
CAATAATTATTACTACAAATCATATGACAGAGAAAAGTATTTTCAATCTG
CTTAATGATTTGACAAACAAGAGAAAAAAAATGGTTTTATTTTTTTCTCA
TTGTAATTAAATTTTTCTTCAATTTGAGAAAGCAGAAATAAATAAATCAT
GATTATTGTTAAAAAAATATCAATAAACGAAATGCACAATAATTTGTGCT
AATTTTCCTAATGTTGCTGGGCACTCGAATAATCAGGCCAATATTTATTT
TAATTCTTGTAAAACCTTGTTTCTCCGTCAAAGGATGCACAGTCATTCTA
AGAAGCCAGCAATCTTCTTTGAAAAAAGCCGTTTGTAATATGCCCGAACA
AATTCTCAAATCTATTCCGACAGATTTACCCGAAGCTTTAGTTGAATTGG
AAATATCCTTTCAGGATTTACAAACGATTTATAATAAGGAATTTATTCAT
TTGCCGAAATTGGAATATCTTTCTATTGTTTCATCGAATGTCCAGACTAT
CCAAGAAGGAGCCTTCATTCAATTGTCGAACCTAAAATCCTTATCATTGT
TTAATAATTCTTTAATCATCTCTACCGGGAATTCAATGAGCCTGTCAAAA
TATATTTTCTTTCCACTTCTCAGCCTTACAAAAGTAGATCTCTCATACAA
TAGCATTGGAAATATCCCTGATTTCTTTTTCAATCATGTCAATCAGACTT
TAGAGAGTTTACACTTATCCCATTCTAAAACCGAGATTATATTAAGCGGA
AATAGTCTAATGTATATGACAATTTAAAAAGTATTCATTTAGAGTATTCA
CAAATGACTTCAATCAGCAGGGATGTTGAAGAGTCTTTTAACATAATGTC
AAAGCTCAAAGAAATAATACTGATAGGAAATTTGTGGAACTGTGACTGTC
AGTTGAGATGGTTTCTGTTGTGGATAATAAAAAAAAATAATTTCCGAAAT
CAAATAAAAATAAACAGAAAAGGTTTCAGTTGCACCAATCCACCGGAAAT
ACGAAATTATGACATTTTCGGAAGGGATTTAAACAAAATATTAAGCATGA
AATTTCAGTGCATTCCAGAACCGATTACCTCGAATTCTACAGTTTCAATT
TACGCTGGCCAAAACATATCTTTAACGAGCATTTTCAGAAATGTCGACGA
AAAACAAAATATTTTCTGGGAAAATAAGGGAAATATTTTCTCAATGAAAA
TCAACTTTAAAAGATTTATAATCACAGAAATCAGTGGAAAATACCGAAAG
TCTATTTTAACAATATTAAACGTTTCCAAATTGGAAGAAGGAGTTTGGAA
ATGTTTCGTTGATTTTGAAAACAAACAAATTGGGATAGAATATTTTCTAA
CTGTAGAATCAGAAAACAATGCAGAGAACTCACCGGTTTTGAACAATCCC
ACCTCAAAAAATGCCATAGTTTATGCTTCAGTCTCATCTTCTTTAATTCT
CCTTTTCATTATAGGGTTAATCATAGCTATTTATTATTGTAAATTCTACA
AAGGAAATCTTTTTTCTATTATTGCCCGTCCGAGTTTCAACATAGTCTCT
AAACGGCAATCTAAGAACCATTTCTACAAAAATATCGCACAAAAATCACA
AAATCCCTTTTCCATTTCCAAAGACTCAATAAAACTGGAAGACAAAATCT
ACGATAATGTTCCGATATCATCTGGGTTTTATATAAATTTCACAAAGAAA
AAAAACGAACAAAACTTTTCAACTTTAAACTGTTTAGATTGTCAGAATTA
CGCAATTGTCGATGAGATTTTCACAGATAGTTCCGATCCCCATTCAAACA
AAACAAAATCTCCCAGGTTCTGGTATTTAGATGATGCCGTTGATGGAATT
GAATATTTGCCGCCAGCCGCCTCTGTTGATATCGGTAACGACTTGACGGC
ATCAGAAATATCAGACGGCGATTCTGCATTTATCACAAGAATCCCAAGCA
GGACACCTTGTCCGATTCATTCAAGTCACGCATCGATGAATAATTTAAAA
AGATCATTATCAAATATTAAACAAAATTCATTTAATCAAATAAATGAAAT
AGAACCCTGCCCGATTCATGGGAAACAAAATTCACAGAATTCTTATTCAG
TTCACTTTCGCATTCCTGATCAGCAGCTCAATTCTTCGAAAAATATTCCT
AATTCTAGAAAACCAAAAATTAAAACAAAACCAAATCGTTTTTGTAATTC
ATCGGACAAATCACACTCAAAAAATTATTTCCCCGTTTACTTATCCACTT
TAGATATGCAAGTTAATGATGACACTCTATATAGGCAATACTCTTGTTTA
ACTAATTCTGTCG
back to top

protein sequence of SMED30000862-orf-1

>SMED30000862-orf-1 ID=SMED30000862-orf-1|Name=SMED30000862-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
MTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKKNNFRNQ
IKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIY
AGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINFKRFIITEISGKYRKS
ILTILNVSKLEEGVWKCFVDFENKQIGIEYFLTVESENNAENSPVLNNPT
SKNAIVYASVSSSLILLFIIGLIIAIYYCKFYKGNLFSIIARPSFNIVSK
RQSKNHFYKNIAQKSQNPFSISKDSIKLEDKIYDNVPISSGFYINFTKKK
NEQNFSTLNCLDCQNYAIVDEIFTDSSDPHSNKTKSPRFWYLDDAVDGIE
YLPPAASVDIGNDLTASEISDGDSAFITRIPSRTPCPIHSSHASMNNLKR
SLSNIKQNSFNQINEIEPCPIHGKQNSQNSYSVHFRIPDQQLNSSKNIPN
SRKPKIKTKPNRFCNSSDKSHSKNYFPVYLSTLDMQVNDDTLYRQYSCLT
NSV
back to top

protein sequence of SMED30000862-orf-2

>SMED30000862-orf-2 ID=SMED30000862-orf-2|Name=SMED30000862-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MLLGTRIIRPIFILILVKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILK
SIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEG
AFIQLSNLKSLSLFNNSLIISTGNSMSLSKYIFFPLLSLTKVDLSYNSIG
NIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR013783Ig-like_fold
IPR007110Ig-like_dom
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 34..189
e-value: 5.5E-23
score: 82.9
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 60..118
e-value: 4.2E-9
score: 36.0
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 138..159
score: 7.327
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 107..127
score: 5.186
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 18..171
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 46..181