Protein YIPF

Overview
NameProtein YIPF
Smed IDSMED30000858
Length (bp)953
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein YIPF (SMED30000858) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein YIPF (SMED30000858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein YIPF (SMED30000858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein YIPF (SMED30000858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30000858h1SMcG0005699 dd_Smed_v4_3454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30000858h1SMcG0005699 dd_Smed_v4_3454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF1 (Yip1 domain family member 1 [Source:HGNC Symbol;Acc:HGNC:25231])

HSP 1 Score: 177.948 bits (450), Expect = 3.213e-53
Identity = 98/264 (37.12%), Postives = 152/264 (57.58%), Query Frame = 3
Query:   81 NVEYTKLEI-DKDEFNNDLRSQPLNANFNSSEESVADNEQ--------ITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            N + T + I D  E        P  +     +E + +++           KSSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   I   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG +L +  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   22 NPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDDSDKTELLAGQKKSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGSLLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF1 (Yip1 domain family member 1 [Source:HGNC Symbol;Acc:HGNC:25231])

HSP 1 Score: 177.948 bits (450), Expect = 3.213e-53
Identity = 98/264 (37.12%), Postives = 152/264 (57.58%), Query Frame = 3
Query:   81 NVEYTKLEI-DKDEFNNDLRSQPLNANFNSSEESVADNEQ--------ITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            N + T + I D  E        P  +     +E + +++           KSSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   I   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG +L +  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   22 NPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDDSDKTELLAGQKKSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGSLLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF2 (Yip1 domain family member 2 [Source:HGNC Symbol;Acc:HGNC:28476])

HSP 1 Score: 137.502 bits (345), Expect = 1.289e-37
Identity = 82/211 (38.86%), Postives = 127/211 (60.19%), Query Frame = 3
Query:  213 PALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKF-KMIKES----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFH 821
            P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I+IY Y W++PL +WG  ++ K ++E     +FLE + ++GYSL ++IP  +LW+I V W QWL   +AL LS   L+  +W       + V+ ++++VV L+H LLA+G  LYFF 
Sbjct:   75 PGFWTFSYYQSFFDVDTSQVLDRIKGSLLPRPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLALWGFLRWRKGVQERMGPYTFLETVCIYGYSLFVFIPMVVLWLIPVPWLQWLFGALALGLSAAGLVFTLWPVVREDTRLVATVLLSVVVLLHALLAMGCKLYFFQ 283          
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF2 (Yip1 domain family member 2 [Source:HGNC Symbol;Acc:HGNC:28476])

HSP 1 Score: 137.502 bits (345), Expect = 1.289e-37
Identity = 82/211 (38.86%), Postives = 127/211 (60.19%), Query Frame = 3
Query:  213 PALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKF-KMIKES----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFH 821
            P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I+IY Y W++PL +WG  ++ K ++E     +FLE + ++GYSL ++IP  +LW+I V W QWL   +AL LS   L+  +W       + V+ ++++VV L+H LLA+G  LYFF 
Sbjct:   75 PGFWTFSYYQSFFDVDTSQVLDRIKGSLLPRPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLALWGFLRWRKGVQERMGPYTFLETVCIYGYSLFVFIPMVVLWLIPVPWLQWLFGALALGLSAAGLVFTLWPVVREDTRLVATVLLSVVVLLHALLAMGCKLYFFQ 283          
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF2 (Yip1 domain family member 2 [Source:HGNC Symbol;Acc:HGNC:28476])

HSP 1 Score: 107.842 bits (268), Expect = 2.501e-27
Identity = 55/143 (38.46%), Postives = 87/143 (60.84%), Query Frame = 3
Query:  213 PALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKF-KMIKES----SFLELLTLFGYSLAIYIP 617
            P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I+IY Y W++PL +WG  ++ K ++E     +FLE + ++GYSL ++IP
Sbjct:   75 PGFWTFSYYQSFFDVDTSQVLDRIKGSLLPRPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLALWGFLRWRKGVQERMGPYTFLETVCIYGYSLFVFIP 215          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y25C1A.7 (pep chromosome:WBcel235:II:3065219:3071080:-1 gene:WBGene00021294.1 transcript:Y25C1A.7a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y25C1A.7)

HSP 1 Score: 133.65 bits (335), Expect = 6.555e-37
Identity = 79/231 (34.20%), Postives = 136/231 (58.87%), Query Frame = 3
Query:  177 SVADNEQITKSSPA--LWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI---SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSY-GTANKQVSFLIITVVALMHTLLAVGFMLYFF---HVPATSKP 842
             V D+ Q T S+     +SF++YQ  FD++T  V++R++ S IP+ +  Y++  +   PDL+GPFW   TL+  I I GN+A +         +  DF  ++ A+  I+ Y  I+PL ++G+    + +++    +++L+ L+GYSLAI+IP S+LW++ + WF+W L+  ++ LSG VL  A+W +     NK ++F  +  V ++H LLA  F +YFF   H+   + P
Sbjct:   47 GVFDDSQSTTSTRKGNFFSFEYYQQFFDVETDQVIKRLLNSVIPT-HRNYIQDFLQPIPDLWGPFWVSVTLVFAIGIFGNLAQFIENDGAKGTYGSDFRMVTSASTLIFLYVVIVPLLLYGLLWNRRSELLHP--YVDLVCLYGYSLAIFIPVSVLWIVDIGWFRWALIFASVGLSGTVLARAIWPAVQNDNNKMIAFGTVISVVVLHFLLAFTFKVYFFDSMHIVVVASP 274          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y25C1A.7 (pep chromosome:WBcel235:II:3065219:3071381:-1 gene:WBGene00021294.1 transcript:Y25C1A.7a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y25C1A.7)

HSP 1 Score: 133.65 bits (335), Expect = 6.555e-37
Identity = 79/231 (34.20%), Postives = 136/231 (58.87%), Query Frame = 3
Query:  177 SVADNEQITKSSPA--LWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI---SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSY-GTANKQVSFLIITVVALMHTLLAVGFMLYFF---HVPATSKP 842
             V D+ Q T S+     +SF++YQ  FD++T  V++R++ S IP+ +  Y++  +   PDL+GPFW   TL+  I I GN+A +         +  DF  ++ A+  I+ Y  I+PL ++G+    + +++    +++L+ L+GYSLAI+IP S+LW++ + WF+W L+  ++ LSG VL  A+W +     NK ++F  +  V ++H LLA  F +YFF   H+   + P
Sbjct:   47 GVFDDSQSTTSTRKGNFFSFEYYQQFFDVETDQVIKRLLNSVIPT-HRNYIQDFLQPIPDLWGPFWVSVTLVFAIGIFGNLAQFIENDGAKGTYGSDFRMVTSASTLIFLYVVIVPLLLYGLLWNRRSELLHP--YVDLVCLYGYSLAIFIPVSVLWIVDIGWFRWALIFASVGLSGTVLARAIWPAVQNDNNKMIAFGTVISVVVLHFLLAFTFKVYFFDSMHIVVVASP 274          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y25C1A.7 (pep chromosome:WBcel235:II:3064929:3071062:-1 gene:WBGene00021294.1 transcript:Y25C1A.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y25C1A.7)

HSP 1 Score: 133.65 bits (335), Expect = 6.555e-37
Identity = 79/231 (34.20%), Postives = 136/231 (58.87%), Query Frame = 3
Query:  177 SVADNEQITKSSPA--LWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI---SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSY-GTANKQVSFLIITVVALMHTLLAVGFMLYFF---HVPATSKP 842
             V D+ Q T S+     +SF++YQ  FD++T  V++R++ S IP+ +  Y++  +   PDL+GPFW   TL+  I I GN+A +         +  DF  ++ A+  I+ Y  I+PL ++G+    + +++    +++L+ L+GYSLAI+IP S+LW++ + WF+W L+  ++ LSG VL  A+W +     NK ++F  +  V ++H LLA  F +YFF   H+   + P
Sbjct:   47 GVFDDSQSTTSTRKGNFFSFEYYQQFFDVETDQVIKRLLNSVIPT-HRNYIQDFLQPIPDLWGPFWVSVTLVFAIGIFGNLAQFIENDGAKGTYGSDFRMVTSASTLIFLYVVIVPLLLYGLLWNRRSELLHP--YVDLVCLYGYSLAIFIPVSVLWIVDIGWFRWALIFASVGLSGTVLARAIWPAVQNDNNKMIAFGTVISVVVLHFLLAFTFKVYFFDSMHIVVVASP 274          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y25C1A.7 (pep chromosome:WBcel235:II:3064929:3070942:-1 gene:WBGene00021294.1 transcript:Y25C1A.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y25C1A.7)

HSP 1 Score: 133.65 bits (335), Expect = 7.246e-37
Identity = 79/231 (34.20%), Postives = 136/231 (58.87%), Query Frame = 3
Query:  177 SVADNEQITKSSPA--LWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI---SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSY-GTANKQVSFLIITVVALMHTLLAVGFMLYFF---HVPATSKP 842
             V D+ Q T S+     +SF++YQ  FD++T  V++R++ S IP+ +  Y++  +   PDL+GPFW   TL+  I I GN+A +         +  DF  ++ A+  I+ Y  I+PL ++G+    + +++    +++L+ L+GYSLAI+IP S+LW++ + WF+W L+  ++ LSG VL  A+W +     NK ++F  +  V ++H LLA  F +YFF   H+   + P
Sbjct:   57 GVFDDSQSTTSTRKGNFFSFEYYQQFFDVETDQVIKRLLNSVIPT-HRNYIQDFLQPIPDLWGPFWVSVTLVFAIGIFGNLAQFIENDGAKGTYGSDFRMVTSASTLIFLYVVIVPLLLYGLLWNRRSELLHP--YVDLVCLYGYSLAIFIPVSVLWIVDIGWFRWALIFASVGLSGTVLARAIWPAVQNDNNKMIAFGTVISVVVLHFLLAFTFKVYFFDSMHIVVVASP 284          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y25C1A.7 (pep chromosome:WBcel235:II:3062542:3071080:-1 gene:WBGene00021294.1 transcript:Y25C1A.7c.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y25C1A.7)

HSP 1 Score: 134.035 bits (336), Expect = 6.387e-36
Identity = 77/220 (35.00%), Postives = 132/220 (60.00%), Query Frame = 3
Query:  177 SVADNEQITKSSPA--LWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI---SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSS-YGTANKQVSFLIITVVALMHTLLAVGFMLYFF 818
             V D+ Q T S+     +SF++YQ  FD++T  V++R++ S IP+ +  Y++  +   PDL+GPFW   TL+  I I GN+A +         +  DF  ++ A+  I+ Y  I+PL ++G+    + +++    +++L+ L+GYSLAI+IP S+LW++ + WF+W L+  ++ LSG VL  A+W +     NK ++F  +  V ++H LLA  F +YFF
Sbjct:   47 GVFDDSQSTTSTRKGNFFSFEYYQQFFDVETDQVIKRLLNSVIPT-HRNYIQDFLQPIPDLWGPFWVSVTLVFAIGIFGNLAQFIENDGAKGTYGSDFRMVTSASTLIFLYVVIVPLLLYGLLWNRRSELLH--PYVDLVCLYGYSLAIFIPVSVLWIVDIGWFRWALIFASVGLSGTVLARAIWPAVQNDNNKMIAFGTVISVVVLHFLLAFTFKVYFF 263          
BLAST of Protein YIPF vs. Ensembl Fly
Match: CG4645 (gene:FBgn0030435 transcript:FBtr0343649)

HSP 1 Score: 155.606 bits (392), Expect = 2.825e-44
Identity = 93/217 (42.86%), Postives = 127/217 (58.53%), Query Frame = 3
Query:  222 WSFQFYQNLFDIDTRDVLRRVVYSFIPS-PNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES--------------SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            ++ ++YQ  F++DT  VL R+  S IP   +G YL+  I + PDLYGPFW   TLI +IAI+GNIA+Y   A   + W Y+F  +S AA +I+ Y  I+P  +W + K+ +                  S L L+ ++GYSLAIYIP S+LWVI +S  QWLLVI A  LSG VLI  +  +    N Q S  +I  +   H +LA GF+LYFFH P
Sbjct:  108 FTIEYYQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHYNFHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLAIYIPVSILWVINISLLQWLLVITAALLSGTVLIAVL--TPALRNSQFSLFLIVGILSAHVVLAAGFLLYFFHNP 322          
BLAST of Protein YIPF vs. Ensembl Fly
Match: CG4645 (gene:FBgn0030435 transcript:FBtr0073692)

HSP 1 Score: 155.606 bits (392), Expect = 2.825e-44
Identity = 93/217 (42.86%), Postives = 127/217 (58.53%), Query Frame = 3
Query:  222 WSFQFYQNLFDIDTRDVLRRVVYSFIPS-PNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES--------------SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            ++ ++YQ  F++DT  VL R+  S IP   +G YL+  I + PDLYGPFW   TLI +IAI+GNIA+Y   A   + W Y+F  +S AA +I+ Y  I+P  +W + K+ +                  S L L+ ++GYSLAIYIP S+LWVI +S  QWLLVI A  LSG VLI  +  +    N Q S  +I  +   H +LA GF+LYFFH P
Sbjct:  108 FTIEYYQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHYNFHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLAIYIPVSILWVINISLLQWLLVITAALLSGTVLIAVL--TPALRNSQFSLFLIVGILSAHVVLAAGFLLYFFHNP 322          
BLAST of Protein YIPF vs. Ensembl Fly
Match: CG4645 (gene:FBgn0030435 transcript:FBtr0346316)

HSP 1 Score: 155.606 bits (392), Expect = 2.825e-44
Identity = 93/217 (42.86%), Postives = 127/217 (58.53%), Query Frame = 3
Query:  222 WSFQFYQNLFDIDTRDVLRRVVYSFIPS-PNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES--------------SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            ++ ++YQ  F++DT  VL R+  S IP   +G YL+  I + PDLYGPFW   TLI +IAI+GNIA+Y   A   + W Y+F  +S AA +I+ Y  I+P  +W + K+ +                  S L L+ ++GYSLAIYIP S+LWVI +S  QWLLVI A  LSG VLI  +  +    N Q S  +I  +   H +LA GF+LYFFH P
Sbjct:  108 FTIEYYQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHYNFHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLAIYIPVSILWVINISLLQWLLVITAALLSGTVLIAVL--TPALRNSQFSLFLIVGILSAHVVLAAGFLLYFFHNP 322          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf2 (Yip1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-040724-124])

HSP 1 Score: 183.341 bits (464), Expect = 1.505e-55
Identity = 98/272 (36.03%), Postives = 154/272 (56.62%), Query Frame = 3
Query:   96 KLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSK---------PGANSSSSL 866
            +L++  DE N    S+ L                  K +   W+F++YQ+ F++DT  VL R+  S +P P   ++K  I   PDLYGPFW C TL+ ++AI+GN++ +     N  +H+R  F ++S+AA+ ++ Y W++PL VWG      S  + I   +FLE + ++GYSL IYIPTS+LW I  +W QWLL++VA+ +SG VL++  W +     K  +F  + V+  +H LLAVG  LYFFH    ++         P +N +++L
Sbjct:   46 RLDLSDDEENQQESSELLGGE---------------KKTGGFWTFEYYQSFFNVDTVQVLDRIKGSVMPLPGRNFIKHHIRSNPDLYGPFWICVTLVFSLAISGNLSTFLSEMGNPEYHYRPQFHRVSIAAVTVFLYAWLVPLGVWGFLTWRQSVERQINGYTFLETVCVYGYSLFIYIPTSVLWTIPFNWLQWLLIVVAMVISGSVLVITFWPAVRDDTKLTAFATVAVIVALHALLAVGCKLYFFHTAEDTRSPHPGQHITPASNHTTAL 302          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf1 (Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040822-35])

HSP 1 Score: 163.696 bits (413), Expect = 6.263e-48
Identity = 92/272 (33.82%), Postives = 151/272 (55.51%), Query Frame = 3
Query:   87 EYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITK------SSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFK-----MIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSSSL 866
            E T + ID D   +  +      +F   E+   +N   TK       S   W+F++YQ LFD+DT  V  R++ S +P P   +++  +   PDLYGPFW C TL+  IAI+GNI+++  H     + +  DFGK+++AA AIYSY  ++PL +WG   ++      +   SF++++ ++GYSL+IYIP  ++W+I     +W  + VA+ LSG VL++  W +      ++   I++ + ++H LLAVG    FF    T  P A+++  L
Sbjct:   25 ESTTVTID-DPIKSRKQRNAAGTDFEGEEDDPLENSDKTKLLSGERKSAPFWTFEYYQTLFDVDTHQVKSRILGSVVPWPRRNFVEVYLRSNPDLYGPFWICATLVFAIAISGNISSFLRHHGQPKYKYVPDFGKVTMAATAIYSYALLVPLALWGFLTWRNRTIASLVSYSFMQIVCVYGYSLSIYIPAVIVWIIPSEGLRWCSIAVAMCLSGSVLVMTFWPAIREDKPRIIIAILSTIVILHVLLAVGCKACFFSTYETD-PSADNNEPL 294          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf1 (Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040822-35])

HSP 1 Score: 159.844 bits (403), Expect = 1.121e-46
Identity = 86/250 (34.40%), Postives = 140/250 (56.00%), Query Frame = 3
Query:   87 EYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITK------SSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVG 800
            E T + ID D   +  +      +F   E+   +N   TK       S   W+F++YQ LFD+DT  V  R++ S +P P   +++  +   PDLYGPFW C TL+  IAI+GNI+++  H     + +  DFGK+++AA AIYSY  ++PL +WG           +   SF++++ ++GYSL+IYIP  ++W+I     +W  + VA+ LSG VL++  W +      ++   I++ + ++H LLAVG
Sbjct:   25 ESTTVTID-DPIKSRKQRNAAGTDFEGEEDDPLENSDKTKLLSGERKSAPFWTFEYYQTLFDVDTHQVKSRILGSVVPWPRRNFVEVYLRSNPDLYGPFWICATLVFAIAISGNISSFLRHHGQPKYKYVPDFGKVTMAATAIYSYALLVPLALWGFLTWRNRTIASLVSYSFMQIVCVYGYSLSIYIPAVIVWIIPSEGLRWCSIAVAMCLSGSVLVMTFWPAIREDKPRIIIAILSTIVILHVLLAVG 273          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf1 (Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040822-35])

HSP 1 Score: 102.064 bits (253), Expect = 1.308e-25
Identity = 58/156 (37.18%), Postives = 88/156 (56.41%), Query Frame = 3
Query:   87 EYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITK------SSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWG 533
            E T + ID D   +  +      +F   E+   +N   TK       S   W+F++YQ LFD+DT  V  R++ S +P P   +++  +   PDLYGPFW C TL+  IAI+GNI+++  H     + +  DFGK+++AA AIYSY  ++PL +WG
Sbjct:   25 ESTTVTID-DPIKSRKQRNAAGTDFEGEEDDPLENSDKTKLLSGERKSAPFWTFEYYQTLFDVDTHQVKSRILGSVVPWPRRNFVEVYLRSNPDLYGPFWICATLVFAIAISGNISSFLRHHGQPKYKYVPDFGKVTMAATAIYSYALLVPLALWG 179          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf2 (Yip1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-040724-124])

HSP 1 Score: 97.8265 bits (242), Expect = 3.773e-24
Identity = 51/147 (34.69%), Postives = 83/147 (56.46%), Query Frame = 3
Query:   96 KLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWG 533
            +L++  DE N    S+ L                  K +   W+F++YQ+ F++DT  VL R+  S +P P   ++K  I   PDLYGPFW C TL+ ++AI+GN++ +     N  +H+R  F ++S+AA+ ++ Y W++PL VWG
Sbjct:   46 RLDLSDDEENQQESSELLGGE---------------KKTGGFWTFEYYQSFFNVDTVQVLDRIKGSVMPLPGRNFIKHHIRSNPDLYGPFWICVTLVFSLAISGNLSTFLSEMGNPEYHYRPQFHRVSIAAVTVFLYAWLVPLGVWG 177          
BLAST of Protein YIPF vs. Ensembl Xenopus
Match: rab33b (RAB33B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-491301])

HSP 1 Score: 182.57 bits (462), Expect = 4.208e-55
Identity = 98/249 (39.36%), Postives = 150/249 (60.24%), Query Frame = 3
Query:  123 NNDLRSQPLNANFNSSEE-----SVADNEQI---TKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
              + RS+    N +  ++      V+D  ++    K     W+F +YQ  FDIDT  VL R+  S +P P   +++  +   PDLYGPFW C TLI TI I+GN++N+  H     +H+  +F K+S+AA AIY+Y W++PL +WG      SK   +   SFLE++ ++GYSL IYIPTS++W+I     +W+L+ +A++LSG VLIL  W +    N++++   + V+ L+H LLAVGF+ YFF  P
Sbjct:   32 ETESRSKGHRGNRSQEDDHLMSGEVSDKTELLGGQKKQAPFWTFDYYQTFFDIDTLQVLDRIKGSVLPMPGRNFIRLYVRSNPDLYGPFWICATLIFTITISGNLSNFLLHQGKPKYHYVPEFRKVSIAATAIYAYTWLVPLALWGFLTWRQSKVMSMVSYSFLEIVCVYGYSLFIYIPTSIMWIIHAETLRWVLMALAMSLSGAVLILTFWPAVREENRKIAVTTLVVIMLLHALLAVGFVEYFFDPP 280          
BLAST of Protein YIPF vs. Ensembl Xenopus
Match: ddit3 (DNA damage inducible transcript 3 [Source:Xenbase;Acc:XB-GENE-1011286])

HSP 1 Score: 171.014 bits (432), Expect = 1.161e-50
Identity = 87/214 (40.65%), Postives = 137/214 (64.02%), Query Frame = 3
Query:  204 KSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANR-NHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKM-----IKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            K + + W+FQ+YQ+ FDIDT  VL R+  S +P P   ++++ +   PDLYGPFW CTTL++T+ I GN+  Y    ++  + +  +F KLS+A +AIYSY W +PL +WG  +++      +   SF+E + ++GYSL+ Y+P ++L V+    F+W+L++VA++LS LVL+LA W      NK V   ++ ++  +H LLAVG  LYFF  P
Sbjct:   64 KKTSSFWTFQYYQDFFDIDTYQVLDRIRGSILPIPGKNFVRNHLRNNPDLYGPFWICTTLVITVTIMGNLGTYMLLHDQEGYQYSPEFHKLSVAGVAIYSYAWAVPLGLWGFLQWRKGVTPEVSSYSFMETVCIYGYSLSAYVPATVLCVVPQDIFRWILILVAMSLSSLVLVLAFWPHIRRDNKVVVISLMAIMVALHVLLAVGCKLYFFRQP 277          
BLAST of Protein YIPF vs. Ensembl Xenopus
Match: ddit3 (DNA damage inducible transcript 3 [Source:Xenbase;Acc:XB-GENE-1011286])

HSP 1 Score: 170.629 bits (431), Expect = 3.098e-50
Identity = 87/214 (40.65%), Postives = 137/214 (64.02%), Query Frame = 3
Query:  204 KSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANR-NHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKM-----IKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            K + + W+FQ+YQ+ FDIDT  VL R+  S +P P   ++++ +   PDLYGPFW CTTL++T+ I GN+  Y    ++  + +  +F KLS+A +AIYSY W +PL +WG  +++      +   SF+E + ++GYSL+ Y+P ++L V+    F+W+L++VA++LS LVL+LA W      NK V   ++ ++  +H LLAVG  LYFF  P
Sbjct:   88 KKTSSFWTFQYYQDFFDIDTYQVLDRIRGSILPIPGKNFVRNHLRNNPDLYGPFWICTTLVITVTIMGNLGTYMLLHDQEGYQYSPEFHKLSVAGVAIYSYAWAVPLGLWGFLQWRKGVTPEVSSYSFMETVCIYGYSLSAYVPATVLCVVPQDIFRWILILVAMSLSSLVLVLAFWPHIRRDNKVVVISLMAIMVALHVLLAVGCKLYFFRQP 301          
BLAST of Protein YIPF vs. Ensembl Mouse
Match: Yipf1 (Yip1 domain family, member 1 [Source:MGI Symbol;Acc:MGI:1915532])

HSP 1 Score: 181.415 bits (459), Expect = 1.303e-54
Identity = 94/237 (39.66%), Postives = 147/237 (62.03%), Query Frame = 3
Query:  135 RSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
              + L  N +S E  +   ++  +SSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   +   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG VL++  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   51 EDEELLGNNDSDETELLAGQK--RSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPVPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFQKVSIAATVIYAYAWLVPLALWGFLLWRNSKVMSMVSYSFLEIVCVYGYSLFIYIPTAVLWIIPQRVVRWVLVMIALGVSGSVLVMTFWPAVREDNRRVALATIVTIVLLHVLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. Ensembl Mouse
Match: Yipf1 (Yip1 domain family, member 1 [Source:MGI Symbol;Acc:MGI:1915532])

HSP 1 Score: 159.844 bits (403), Expect = 8.305e-47
Identity = 91/250 (36.40%), Postives = 142/250 (56.80%), Query Frame = 3
Query:  114 DEFNND---LRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLF---DIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            +EF +    L + P     N  + SV+   Q     P     +  + L    D D  +V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   +   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG VL++  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   10 EEFGDGATLLAANPDATTINIEDPSVSFGHQ--PRPPGSVGREEDEELLGNNDSDETEVFDRIKGSLLPVPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFQKVSIAATVIYAYAWLVPLALWGFLLWRNSKVMSMVSYSFLEIVCVYGYSLFIYIPTAVLWIIPQRVVRWVLVMIALGVSGSVLVMTFWPAVREDNRRVALATIVTIVLLHVLLSVGCLAYFFDAP 257          
BLAST of Protein YIPF vs. Ensembl Mouse
Match: Yipf2 (Yip1 domain family, member 2 [Source:MGI Symbol;Acc:MGI:1922016])

HSP 1 Score: 145.976 bits (367), Expect = 4.599e-41
Identity = 88/251 (35.06%), Postives = 132/251 (52.59%), Query Frame = 3
Query:  150 NANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFF------HV---PATSKPGAN 851
             A     E+      Q  K  P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I IY Y W++PL +WG  +++          +FLE + ++GYSL ++IPT +LW+I V W QWL   + L LS   L+  +W       + V+  +++ V L+H LLA+G  LYFF      HV   P  + P  N
Sbjct:   51 GAEVGEEEDDKTSLLQEEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGFLRWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWIQWLFGALGLALSAAGLVFTLWPVVREDTRLVAAALLSTVVLLHALLALGCKLYFFQPLPLDHVVPAPQATPPSPN 299          
BLAST of Protein YIPF vs. Ensembl Mouse
Match: Yipf2 (Yip1 domain family, member 2 [Source:MGI Symbol;Acc:MGI:1922016])

HSP 1 Score: 145.976 bits (367), Expect = 4.599e-41
Identity = 88/251 (35.06%), Postives = 132/251 (52.59%), Query Frame = 3
Query:  150 NANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFF------HV---PATSKPGAN 851
             A     E+      Q  K  P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I IY Y W++PL +WG  +++          +FLE + ++GYSL ++IPT +LW+I V W QWL   + L LS   L+  +W       + V+  +++ V L+H LLA+G  LYFF      HV   P  + P  N
Sbjct:   51 GAEVGEEEDDKTSLLQEEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGFLRWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWIQWLFGALGLALSAAGLVFTLWPVVREDTRLVAAALLSTVVLLHALLALGCKLYFFQPLPLDHVVPAPQATPPSPN 299          
BLAST of Protein YIPF vs. Ensembl Mouse
Match: Yipf2 (Yip1 domain family, member 2 [Source:MGI Symbol;Acc:MGI:1922016])

HSP 1 Score: 145.976 bits (367), Expect = 4.599e-41
Identity = 88/251 (35.06%), Postives = 132/251 (52.59%), Query Frame = 3
Query:  150 NANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFF------HV---PATSKPGAN 851
             A     E+      Q  K  P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I IY Y W++PL +WG  +++          +FLE + ++GYSL ++IPT +LW+I V W QWL   + L LS   L+  +W       + V+  +++ V L+H LLA+G  LYFF      HV   P  + P  N
Sbjct:   51 GAEVGEEEDDKTSLLQEEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGFLRWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWIQWLFGALGLALSAAGLVFTLWPVVREDTRLVAAALLSTVVLLHALLALGCKLYFFQPLPLDHVVPAPQATPPSPN 299          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q91VU1|YIPF1_MOUSE (Protein YIPF1 OS=Mus musculus OX=10090 GN=Yipf1 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 9.112e-54
Identity = 94/237 (39.66%), Postives = 147/237 (62.03%), Query Frame = 3
Query:  135 RSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
              + L  N +S E  +   ++  +SSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   +   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG VL++  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   51 EDEELLGNNDSDETELLAGQK--RSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPVPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFQKVSIAATVIYAYAWLVPLALWGFLLWRNSKVMSMVSYSFLEIVCVYGYSLFIYIPTAVLWIIPQRVVRWVLVMIALGVSGSVLVMTFWPAVREDNRRVALATIVTIVLLHVLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q6P6G5|YIPF1_RAT (Protein YIPF1 OS=Rattus norvegicus OX=10116 GN=Yipf1 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.752e-53
Identity = 100/260 (38.46%), Postives = 153/260 (58.85%), Query Frame = 3
Query:   66 KMSFKNVEYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
             +SFK+       + ++E       + L  N +   E +A  +   KSSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   I   SFLE++ ++GYSL IYIPT++LW+I     +W+LV +AL +SG VL +  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   34 SVSFKHQPRPPGSLGREE-----DEELLGTNDSDETELLAGQK---KSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPVPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFQKVSIAATVIYAYAWLVPLALWGFLLWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAVLWIIPQRVIRWVLVTIALGISGSVLAMTFWPAVREDNRRVALATIVTIMLLHVLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q9Y548|YIPF1_HUMAN (Protein YIPF1 OS=Homo sapiens OX=9606 GN=YIPF1 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.543e-52
Identity = 98/264 (37.12%), Postives = 152/264 (57.58%), Query Frame = 3
Query:   81 NVEYTKLEI-DKDEFNNDLRSQPLNANFNSSEESVADNEQ--------ITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            N + T + I D  E        P  +     +E + +++           KSSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + +H+  +F K+S+AA  IY+Y W++PL +WG      SK   I   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG +L +  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   22 NPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDDSDKTELLAGQKKSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGSLLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q5RBL0|YIPF1_PONAB (Protein YIPF1 OS=Pongo abelii OX=9601 GN=YIPF1 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.932e-52
Identity = 98/264 (37.12%), Postives = 151/264 (57.20%), Query Frame = 3
Query:   81 NVEYTKLEI-DKDEFNNDLRSQPLNANFNSSEESVADNEQ--------ITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVP 827
            N + T + I D  E        P  +     +E + +++           KSSP  W+F++YQ  FD+DT  V  R+  S +P P   +++  I   PDLYGPFW C TL+  IAI+GN++N+  H   + + +  +F K+S+AA  IY+Y W++PL +WG      SK   I   SFLE++ ++GYSL IYIPT++LW+I     +W+LV++AL +SG VL +  W +    N++V+   I  + L+H LL+VG + YFF  P
Sbjct:   22 NPDATTVNIEDPGETPKHQSGSPRGSGREEDDELLGNDDSDKTELLAGQKKSSP-FWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDLYGPFWICATLVFAIAISGNLSNFLIHLGEKTYRYVPEFRKVSIAATTIYAYAWLVPLALWGFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGSVLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAP 284          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q99LP8|YIPF2_MOUSE (Protein YIPF2 OS=Mus musculus OX=10090 GN=Yipf2 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.217e-40
Identity = 88/251 (35.06%), Postives = 132/251 (52.59%), Query Frame = 3
Query:  150 NANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNH---HWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFF------HV---PATSKPGAN 851
             A     E+      Q  K  P  W+F +YQ+ FD+DT  VL R+  S +P P   +++  +  +PDLYGPFW C TL   +A+ GN+      A R     H+   F K+++A I IY Y W++PL +WG  +++          +FLE + ++GYSL ++IPT +LW+I V W QWL   + L LS   L+  +W       + V+  +++ V L+H LLA+G  LYFF      HV   P  + P  N
Sbjct:   51 GAEVGEEEDDKTSLLQEEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLT--LVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGFLRWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWIQWLFGALGLALSAAGLVFTLWPVVREDTRLVAAALLSTVVLLHALLALGCKLYFFQPLPLDHVVPAPQATPPSPN 299          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A0B7BA63 (Protein YIPF (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF175703 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 2.424e-69
Identity = 122/286 (42.66%), Postives = 182/286 (63.64%), Query Frame = 3
Query:   69 MSFKNVEYTKLEIDKDE---FNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSSS---------LHRPM*SD 887
            ++F+++ +     DK E   F N   S   + + NS +  +  +E   K + + W+F +YQ  FD++T+ V +R++ S IP PN  YL   I   PDLYGPFW CTTL+ T AIAGN+ANYF  A ++++W+YDF K++ AA AI+SYWW++PL ++G+  ++  +   +FLE++ ++GYSLAIYIP S+LW IQVSW QW LV+V   LSG VL+   W S    NK+++  ++  + +MHT LA GF+LYFFHVPA + P   +S++         LHR +  D
Sbjct:   24 LNFQDIPHESRTKDKGETHEFTNFPHSAADSDDENSDQAKLLQDE---KRASSFWTFTYYQQFFDVETKQVGQRILGSMIPKPNRNYLVKQIRPNPDLYGPFWICTTLVFTTAIAGNLANYFSSAGKDYNWKYDFHKVTFAATAIFSYWWLIPLILFGVLWWRGSQTKFTFLEIICVYGYSLAIYIPISVLWAIQVSWLQWTLVVVGAVLSGSVLLQTFWPSVSEDNKKIAVGVMLFIFIMHTALAAGFVLYFFHVPAATTPAIPASNTTNITIPSSVLHRKVNQD 306          
BLAST of Protein YIPF vs. TrEMBL
Match: R7TLQ3 (Yip1 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178563 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.819e-68
Identity = 124/293 (42.32%), Postives = 184/293 (62.80%), Query Frame = 3
Query:   57 SVAKMSFKNVEYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNE------QITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMP-----LFVWGISKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPA--------TSKPGANSSSSLHRPM 878
            S   + F+++ ++ +E    +    +++     +F + ++S  + +      Q  K SP+ W+F +YQ+ FD+DT  VL+R++ S +P+P   YL   I   PDLYGPFW CTTLI T AIAGN+ANYF FA +++ W YDF K+S AA A++ YWW++P     LF W  S+  +    SF E+L ++GYSLAIY+P S+LWVI V W +WLLV+  + LSG VL+L  WS+    + +V++  +  + L+H LLAVGF+LYFFHVP+        TS+P AN +SS H P+
Sbjct:   22 STDDLQFQDIPHSGVEPTSSKPAPKIQTHTFT-DFPNPDDSDDEQDRSNLLLQGVKKSPSFWTFDYYQSFFDVDTHQVLKRILGSMVPNPKVNYLDHTIRPNPDLYGPFWICTTLIFTTAIAGNLANYFAFAGKDYEWIYDFHKVSFAATAVFLYWWLVPTGLYTLFWWRGSQAGV----SFTEILCVYGYSLAIYVPISILWVIPVDWLRWLLVMAGMVLSGSVLVLTFWSAIKHDDVKVAYPCMAAIVLLHGLLAVGFVLYFFHVPSPPAAVIQPTSEPLANLTSSNHLPL 309          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A1S3JVS9 (Protein YIPF OS=Lingula unguis OX=7574 GN=LOC106176574 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.813e-68
Identity = 115/254 (45.28%), Postives = 167/254 (65.75%), Query Frame = 3
Query:  108 DKDEFNNDLRSQPLNANFNSSEESVADNEQI--TKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSS 860
            D+D   +   + P  A+   SE+ V    Q+   K  P+ W+F++YQ LFD+DT  V+ R++ S +P P   YL+S I   PDLYGPFW C TLI T AI GN+ANYFH   R++ W+YDF K++ +A AI+SYW ++PL +WG   ++      SFLE+L ++GYSLAIY+P S+LWVI +SW Q+LLVI+++ LSG VL++  W +    +K+V+   + V+ L+H LLAVGFMLYFF   + S   +N ++
Sbjct:   36 DEDGQTHTFTTFPAAAD--DSEDEVEGKPQLLTDKKQPSFWTFEYYQTLFDVDTIQVVIRILNSVVPRPKSNYLQSYIRPNPDLYGPFWICATLIFTTAITGNLANYFHTEGRDYEWKYDFHKVTFSATAIFSYWLLVPLALWGFLWWRRSSAGYSFLEILCVYGYSLAIYVPVSILWVINISWLQYLLVILSMVLSGTVLVIVFWPAVKEDDKKVALGTLLVIFLLHGLLAVGFMLYFFRFASESGSSSNVTT 287          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A0L8FHV6 (Protein YIPF OS=Octopus bimaculoides OX=37653 GN=OCBIM_22019791mg PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 7.083e-68
Identity = 116/269 (43.12%), Postives = 173/269 (64.31%), Query Frame = 3
Query:   66 KMSFKNVEYTKLEIDKDEFNNDLRSQPLNANF---NSSEESVADNEQITKSSPAL---WSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGAN 851
            ++ F +++++     KD+ + +       +NF     S+E   D  ++ K    L   W F +YQ  FD+D+  V  R++ S  P+P   +LKS I   PDLYGPFW CTTL+ T AIAGN+ANYF    +N+HW+YDF K++ AA AI+SYWWI+P  ++G+  ++      SFLE+++++GYSLAIYIP S+LWV+Q++WFQWLLVI+  +LSG VL+   W +     K++++  + ++ L H LLAVGF+LYFFHVPA    G+ 
Sbjct:   24 ELQFHDIDHSLSGSRKDDIDMEKAQTHTFSNFPHSAESDEEEGDKTELLKDEKRLYPFWKFDYYQQFFDVDSNQVFWRIMGSMTPNPRRNFLKSQIRPNPDLYGPFWICTTLVFTTAIAGNLANYFQSKGQNYHWQYDFHKVTFAATAIFSYWWIIPTMLFGLLWWRGSSAGYSFLEMISVYGYSLAIYIPISILWVVQINWFQWLLVIIGASLSGGVLLFTFWPAVREDEKKIAWGAMFLILLFHALLAVGFVLYFFHVPAPIPSGSG 292          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A210QJG4 (Protein YIPF OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08732 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.184e-67
Identity = 116/271 (42.80%), Postives = 170/271 (62.73%), Query Frame = 3
Query:   69 MSFKNVEYTKLEIDKDEFNNDLRSQ-PLNANFNSSEESVADNEQITKSS---PALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSSSL 866
            + F +  Y   + DK +    + +  P  A  +  EE++ D  ++ K     P+ W+FQ+YQ  FD++T  VL R++ S +P P   YLK+ I   PDLYGPFW CTTLI T AIAGN+ANY     + + WRYDF K++ AA AI+SYWW++P  ++    ++      SFL+LL+++GYSLAIYIP S+LWV+QV W QW+LV+V  TLSG VL L  W  +   NK+ ++ ++ ++ L+H  LAVGF LYFF+  A +  G  +S+ +
Sbjct:   19 LQFHDGGYPSTKEDKKKTQTHMFTNFPHTAASDDDEENILDKSELLKDEKPPPSFWTFQYYQQFFDVETYQVLNRILGSMVPRPGSNYLKTHIQPNPDLYGPFWICTTLIFTTAIAGNLANYLQSGGKEYEWRYDFHKVTFAAAAIFSYWWLVPTGLFAFLWWRGTNAGYSFLDLLSVYGYSLAIYIPISILWVVQVDWLQWILVLVGTTLSGTVLTLIFWPVFRDGNKRTAWAVVIIIFLLHASLAVGFKLYFFNAQAGTAVGVTTSAPV 289          
BLAST of Protein YIPF vs. Ensembl Cavefish
Match: yipf2 (Yip1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-040724-124])

HSP 1 Score: 182.185 bits (461), Expect = 4.916e-55
Identity = 97/257 (37.74%), Postives = 150/257 (58.37%), Query Frame = 3
Query:   96 KLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGA 848
            KL++  DE N    S+ L                  K S   W+F++YQ+ F++DT  VL R+  S +P P   ++K  I   PDLYGPFW C TL+ ++AI+GN++ +     N  +H+R  F ++++AA+A++ Y W++PL VWG   ++   E      SFLE + ++GYSL IYIPTS+LW+I   W QWLL++VA+ +SG VL++  W       K  +F+ +  + L+H LLA+G  +YFF    T++P A
Sbjct:   43 KLDLSDDEENQQESSELLGGE---------------KQSGGFWTFEYYQSFFNVDTMQVLDRIKASVMPLPGRNFVKHHIRNNPDLYGPFWICATLVFSVAISGNLSTFLSEMGNPRYHYRPHFHRVTVAAVAVFLYAWLVPLGVWGFMTWRQNAERQTSAYSFLETVCVYGYSLFIYIPTSILWIIPFGWLQWLLILVAMVISGSVLVITFWPVVRDDTKTTAFVSMAAIVLLHALLAIGCKMYFFQ---TAEPIA 281          
BLAST of Protein YIPF vs. Ensembl Cavefish
Match: yipf1 (Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040822-35])

HSP 1 Score: 135.191 bits (339), Expect = 2.621e-37
Identity = 76/204 (37.25%), Postives = 119/204 (58.33%), Query Frame = 3
Query:  210 SPALWSFQFYQNLFDIDTRDVLR-RVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVG 800
            S   W F+    L +   R +++ R+V S +P P   +++  I   PDLYGPFW C TL+  I I+GNI+++  H     + +  +F K+++AA AIYSY W++PL +WG      SK   +   SFLE++ ++GYSL+IYIP  +LW+I     +W  +++AL LSG VL+L  W +    + +V   +   +  +H LLAVG
Sbjct:   22 SALFWLFKMNCKLNEGSLRSLVKDRIVGSVLPWPGKNFVRHYIRNNPDLYGPFWICATLVFAIGISGNISSFLVHHGQPQYKYVPEFRKVTIAATAIYSYAWLVPLALWGFLMWRNSKVSRMVSYSFLEIVCVYGYSLSIYIPAVVLWIIPSEGLRWCSIVLALCLSGSVLMLTFWPAIRDDHPRVVLAVTVTIVTLHVLLAVG 225          
BLAST of Protein YIPF vs. Ensembl Sea Lamprey
Match: yipf1 (Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040822-35])

HSP 1 Score: 185.652 bits (470), Expect = 3.770e-57
Identity = 99/248 (39.92%), Postives = 148/248 (59.68%), Query Frame = 3
Query:  102 EIDKDEFNNDLRSQPLNANFNSSEESVADNEQI---TKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFF 818
            ++     N   + QP         ES  D+E++    K S   W+F +Y+  FD+DT  VL R+  S IP P  ++++  I   PDLYGPFW C TL+  I+I+GN++N F   +   +H+  DF K+S+AA AIYSY W++PL +WG      ++   +   SFLE++  +GYSL IYIPT++LW I     QW+L++VA+ LSG VL L  W ++   +K+++     V+ L++TLLAVG  LYFF
Sbjct:   33 DVGPPPRNQRPQQQPARVAERGGGESDDDDEELLSEEKKSAPFWTFDYYKTFFDVDTHQVLDRIKGSMIPFPGRSFVRKHIRGNPDLYGPFWICATLVFAISISGNLSNLFTQGSGSEYHYVADFRKVSIAATAIYSYAWLVPLGMWGFLLWRSNRTMGVMSFSFLEIVCAYGYSLFIYIPTAVLWTIPSGILQWILIVVAMALSGSVLALTFWPAFRDDDKRIAVATTVVIFLLNTLLAVGCKLYFF 280          
BLAST of Protein YIPF vs. Ensembl Nematostella
Match: EDO34481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP80])

HSP 1 Score: 68.9366 bits (167), Expect = 4.070e-13
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  237 YQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLA 482
            YQ   D+DT  V  R++ S +P+    +L S I   PDLYGPFW C TL+ T AIAGN+A+Y      +H W YDF K+S+ 
Sbjct:  273 YQAFLDVDTYQVGHRILGSMVPAYKRNFLISHIRPNPDLYGPFWVCATLVFTTAIAGNLASYL-VHTGDHEWVYDFHKVSVG 353          
BLAST of Protein YIPF vs. Ensembl Medaka
Match: yipf2 (protein YIPF1 [Source:NCBI gene;Acc:101155322])

HSP 1 Score: 167.933 bits (424), Expect = 8.970e-50
Identity = 85/213 (39.91%), Postives = 132/213 (61.97%), Query Frame = 3
Query:  222 WSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYF-HFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKES-----SFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKP 842
            W+F++YQ+ F++DT  VL RV  + +P P  ++LK  +   PDLYGPFW C TL+ ++AI+GN++ +     N  +H+R  F ++++AA  I+ Y W++P+ +W    ++   E      SFLE + ++GYSL IYIPTS+LW I V W QW+LV+V++ +SG VL+L  W       K ++   +  + ++HTLLAVG  LYFF       P
Sbjct:   64 WTFEYYQSFFNVDTMQVLERVRGAVMPVPGRSFLKHHVRTGPDLYGPFWICVTLVFSMAISGNVSTFLSQTGNPEYHYRPQFHRVTIAAAVIFMYAWLVPVALWAFLTWRRGAERQIGGYSFLETVCVYGYSLFIYIPTSVLWSIPVQWLQWVLVLVSMGVSGSVLVLTFWPVVRDDTKVMAAATLATILVLHTLLAVGCKLYFFQASEKGAP 276          
BLAST of Protein YIPF vs. Ensembl Medaka
Match: yipf1 (Yip1 domain family member 1 [Source:NCBI gene;Acc:101170413])

HSP 1 Score: 144.05 bits (362), Expect = 1.466e-40
Identity = 89/269 (33.09%), Postives = 153/269 (56.88%), Query Frame = 3
Query:   81 NVEYTKLEIDKDEFNNDLRSQPLNANF--NSSEESVA---DNEQI---TKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGI-----SKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGA 848
            N E T ++I+    + D++ Q     F  ++ +E  A   D E++    K S   W+F++YQ  FDI+T  V  R++ S +P P   +++  + K PDLYGPFW CTTL+  + I+GNI+N+         +   F K+++AA  I+SY W +PL +WG      +K   +   SF+E++ ++GYSL+ YIP  +L +  + W +W +++VA  LSG +L++  W +    + +V+  +++ + L+  +LAV   +YFF     S+PGA
Sbjct:   23 NREATTIKIE----DEDVKRQTKAPGFVHDAEDEYSAHSDDREELLSGQKKSAPFWTFEYYQKFFDIETHHVRERILGSLLPWPRKNFIQFYLRKNPDLYGPFWICTTLVFAVFISGNISNFMA-----GKYNPQFRKVTIAATMIFSYAWFVPLGLWGFLLWRNNKILNLVSYSFMEVVCVYGYSLSAYIPAVVLCIAPLEWLRWCIMVVAFGLSGSILVMTFWPALREDHPKVAMAMVSAIVLLDVVLAVVCKMYFF-----SRPGA 277          
BLAST of Protein YIPF vs. Planmine SMEST
Match: SMESG000025076.1 (SMESG000025076.1)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 270/270 (100.00%), Postives = 270/270 (100.00%), Query Frame = 3
Query:   69 MSFKNVEYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCXXXXXXXXXXGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSSSLHRPM 878
            MSFKNVEYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCTTLILTIAIAGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSSSLHRPM
Sbjct:    1 MSFKNVEYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPALWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFWTCTTLILTIAIAGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMPLFVWGISKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLVIVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFFHVPATSKPGANSSSSLHRPM 270          
The following BLAST results are available for this feature:
BLAST of Protein YIPF vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YIPF13.213e-5337.12Yip1 domain family member 1 [Source:HGNC Symbol;Ac... [more]
YIPF13.213e-5337.12Yip1 domain family member 1 [Source:HGNC Symbol;Ac... [more]
YIPF21.289e-3738.86Yip1 domain family member 2 [Source:HGNC Symbol;Ac... [more]
YIPF21.289e-3738.86Yip1 domain family member 2 [Source:HGNC Symbol;Ac... [more]
YIPF22.501e-2738.46Yip1 domain family member 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y25C1A.76.555e-3734.20pep chromosome:WBcel235:II:3065219:3071080:-1 gene... [more]
Y25C1A.76.555e-3734.20pep chromosome:WBcel235:II:3065219:3071381:-1 gene... [more]
Y25C1A.76.555e-3734.20pep chromosome:WBcel235:II:3064929:3071062:-1 gene... [more]
Y25C1A.77.246e-3734.20pep chromosome:WBcel235:II:3064929:3070942:-1 gene... [more]
Y25C1A.76.387e-3635.00pep chromosome:WBcel235:II:3062542:3071080:-1 gene... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG46452.825e-4442.86gene:FBgn0030435 transcript:FBtr0343649[more]
CG46452.825e-4442.86gene:FBgn0030435 transcript:FBtr0073692[more]
CG46452.825e-4442.86gene:FBgn0030435 transcript:FBtr0346316[more]
back to top
BLAST of Protein YIPF vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yipf21.505e-5536.03Yip1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
yipf16.263e-4833.82Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-... [more]
yipf11.121e-4634.40Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-... [more]
yipf11.308e-2537.18Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-... [more]
yipf23.773e-2434.69Yip1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rab33b4.208e-5539.36RAB33B, member RAS oncogene family [Source:Xenbase... [more]
ddit31.161e-5040.65DNA damage inducible transcript 3 [Source:Xenbase;... [more]
ddit33.098e-5040.65DNA damage inducible transcript 3 [Source:Xenbase;... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Yipf11.303e-5439.66Yip1 domain family, member 1 [Source:MGI Symbol;Ac... [more]
Yipf18.305e-4736.40Yip1 domain family, member 1 [Source:MGI Symbol;Ac... [more]
Yipf24.599e-4135.06Yip1 domain family, member 2 [Source:MGI Symbol;Ac... [more]
Yipf24.599e-4135.06Yip1 domain family, member 2 [Source:MGI Symbol;Ac... [more]
Yipf24.599e-4135.06Yip1 domain family, member 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Protein YIPF vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91VU1|YIPF1_MOUSE9.112e-5439.66Protein YIPF1 OS=Mus musculus OX=10090 GN=Yipf1 PE... [more]
sp|Q6P6G5|YIPF1_RAT1.752e-5338.46Protein YIPF1 OS=Rattus norvegicus OX=10116 GN=Yip... [more]
sp|Q9Y548|YIPF1_HUMAN1.543e-5237.12Protein YIPF1 OS=Homo sapiens OX=9606 GN=YIPF1 PE=... [more]
sp|Q5RBL0|YIPF1_PONAB1.932e-5237.12Protein YIPF1 OS=Pongo abelii OX=9601 GN=YIPF1 PE=... [more]
sp|Q99LP8|YIPF2_MOUSE3.217e-4035.06Protein YIPF2 OS=Mus musculus OX=10090 GN=Yipf2 PE... [more]
back to top
BLAST of Protein YIPF vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BA632.424e-6942.66Protein YIPF (Fragment) OS=Arion vulgaris OX=10286... [more]
R7TLQ33.819e-6842.32Yip1 domain-containing protein OS=Capitella teleta... [more]
A0A1S3JVS94.813e-6845.28Protein YIPF OS=Lingula unguis OX=7574 GN=LOC10617... [more]
A0A0L8FHV67.083e-6843.12Protein YIPF OS=Octopus bimaculoides OX=37653 GN=O... [more]
A0A210QJG42.184e-6742.80Protein YIPF OS=Mizuhopecten yessoensis OX=6573 GN... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yipf24.916e-5537.74Yip1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
yipf12.621e-3737.25Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yipf13.770e-5739.92Yip1 domain family, member 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein YIPF vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO344814.070e-1346.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yipf28.970e-5039.91protein YIPF1 [Source:NCBI gene;Acc:101155322][more]
yipf11.466e-4033.09Yip1 domain family member 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein YIPF vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025076.10.000e+0100.00SMESG000025076.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000858 ID=SMED30000858|Name=Protein YIPF|organism=Schmidtea mediterranea sexual|type=transcript|length=953bp
CTTAGTGGCAACATTTATTTATAATTTATTACATATTTTACATTAATTAA
TAAAATTCAGTCGCTAAGATGTCTTTTAAAAATGTTGAGTATACAAAATT
GGAAATTGACAAAGATGAATTTAATAATGATTTGCGATCACAACCTTTAA
ATGCAAATTTTAATAGTTCAGAAGAAAGTGTTGCAGACAATGAACAAATT
ACTAAATCTTCCCCAGCATTGTGGAGTTTTCAATTTTATCAAAATCTTTT
TGATATAGACACCAGAGATGTGTTAAGGCGAGTTGTATATTCTTTCATTC
CAAGCCCCAATGGTACATATTTGAAATCAATCATAAATAAAAAGCCTGAT
TTATACGGACCGTTTTGGACATGCACAACTCTTATTTTGACAATTGCTAT
CGCTGGAAACATTGCAAATTATTTCCATTTCGCTAATCGGAATCATCATT
GGCGATACGACTTCGGGAAATTGTCCCTGGCGGCCATCGCCATCTACAGC
TATTGGTGGATCATGCCGCTGTTCGTCTGGGGGATCTCCAAATTCAAGAT
GATCAAAGAATCCTCATTCCTGGAATTGCTGACTCTGTTTGGATATTCAC
TGGCAATATATATTCCAACATCTATGCTGTGGGTGATCCAGGTCAGTTGG
TTCCAATGGCTCCTTGTTATTGTTGCGTTGACTCTGTCGGGGCTAGTGCT
GATACTGGCTATGTGGTCAAGCTATGGCACAGCTAATAAGCAGGTCAGTT
TCCTCATCATCACGGTAGTCGCCCTCATGCACACTCTGCTCGCGGTTGGG
TTTATGCTTTATTTCTTTCATGTTCCTGCCACCAGCAAGCCCGGTGCCAA
TTCATCAAGTAGTCTCCATCGGCCGATGTGATCAGATCTTTATTATATTG
AGTGATTTGATCTATTTGTGATAGCAATAAATTGTTTTCTAAATGAAAAA
AAA
back to top

protein sequence of SMED30000858-orf-1

>SMED30000858-orf-1 ID=SMED30000858-orf-1|Name=SMED30000858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MSFKNVEYTKLEIDKDEFNNDLRSQPLNANFNSSEESVADNEQITKSSPA
LWSFQFYQNLFDIDTRDVLRRVVYSFIPSPNGTYLKSIINKKPDLYGPFW
TCTTLILTIAIAGNIANYFHFANRNHHWRYDFGKLSLAAIAIYSYWWIMP
LFVWGISKFKMIKESSFLELLTLFGYSLAIYIPTSMLWVIQVSWFQWLLV
IVALTLSGLVLILAMWSSYGTANKQVSFLIITVVALMHTLLAVGFMLYFF
HVPATSKPGANSSSSLHRPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016192vesicle-mediated transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR039765Yip5/YIPF1/YIPF2
IPR006977Yip1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006977Yip1 domainPFAMPF04893Yip1coord: 62..220
e-value: 1.9E-13
score: 50.5
IPR039765Protein Yip5/YIPF1/YIPF2PANTHERPTHR12822UNCHARACTERIZEDcoord: 12..250
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 170..192
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 197..219
NoneNo IPR availableTMHMMTMhelixcoord: 135..157