Secreted peptide prohormone-15

Overview
NameSecreted peptide prohormone-15
Smed IDSMED30000854
Length (bp)548
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secreted peptide prohormone-15 (SMED30000854) t-SNE clustered cells

Violin plots show distribution of expression levels for Secreted peptide prohormone-15 (SMED30000854) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secreted peptide prohormone-15 (SMED30000854) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secreted peptide prohormone-15 (SMED30000854) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000854

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30000854h1SMcG0019731 Contig45750uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000854h1SMcG0019731 Contig45750newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000854h1SMcG0019730 Contig45750uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000854h1SMcG0019730 Contig45750newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30000854 BK007013smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30000854 BK007013smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30000854 BK007013smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secreted peptide prohormone-15 vs. TrEMBL
Match: E3CTI8 (Secreted peptide prohormone-15 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.538e-41
Identity = 89/160 (55.62%), Postives = 97/160 (60.62%), Query Frame = 1
Query:    4 MQFRFSKMTHVTLLITVGLFHVISGYPQVNYM**Y*N**NISL*RPMSLISLIEDIIRSCLTKDLILFNLENDLIQYNLVSDLIQFNLEKDLILYNLENDLIQYN-------LVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            MQFRFSKMTHVTLLITVGLFHVISGYPQ                          ++ +S      ILF+   D IQ+    D IQF    D I +    D IQ+          +RFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR
Sbjct:    1 MQFRFSKMTHVTLLITVGLFHVISGYPQTY------------------------ELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 136          

HSP 2 Score: 124.02 bits (310), Expect = 5.079e-33
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 3
Query:  135 KTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +TYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK
Sbjct:   28 QTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 91          

HSP 3 Score: 87.4261 bits (215), Expect = 8.865e-19
Identity = 42/52 (80.77%), Postives = 49/52 (94.23%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YERVE 480
            +RFDPIQFGKRFDPIQFGKRFDPIQFGK+FDPIQFGKRFDPI FG+ ++ ++
Sbjct:   46 KRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQ 97          

HSP 4 Score: 77.0258 bits (188), Expect = 1.144e-14
Identity = 45/82 (54.88%), Postives = 56/82 (68.29%), Query Frame = 1
Query:  235 NLVSDLIQFNLEKDLILYNLENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YERVE 480
              V+ LI   L   +  Y    +L Q +  R + PI F KRFDPIQFGKRFDPIQFGK+FDPIQFGKRFDPI FG+ ++ ++
Sbjct:    9 THVTLLITVGLFHVISGYPQTYELNQSD--RGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQ 88          
BLAST of Secreted peptide prohormone-15 vs. TrEMBL
Match: A0A193PE80 (Neuropeptide-23 (Fragment) OS=Dugesia japonica OX=6161 GN=DjNp23 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 5.505e-23
Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 3
Query:  135 KTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKTI*SNSIW 350
            K ++  Q  + + PI+F KRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK    +SIW
Sbjct:   12 KRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFEPDSIW 83          

HSP 2 Score: 88.5817 bits (218), Expect = 7.738e-20
Identity = 45/56 (80.36%), Postives = 50/56 (89.29%), Query Frame = 3
Query:  162 RGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKT 329
            + + PI+F KRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK 
Sbjct:    3 KKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKK 58          

HSP 3 Score: 87.8113 bits (216), Expect = 1.578e-19
Identity = 50/89 (56.18%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  205 FNLENDLIQYNLVSDLIQFNLEKDLILYNLENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YE 471
            F  + D I +    D IQF  + D I++            +RFDPIQFGK+FDPI FGKRFDPIQFGKKFDPI FGKRFDPI FG+ +E
Sbjct:    1 FGKKFDPIMFGKRFDPIQFGKKFDPIMFG-----------KRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFE 78          

HSP 4 Score: 87.0409 bits (214), Expect = 3.254e-19
Identity = 46/70 (65.71%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKTI*SNSIWKTI*SNTIW 377
            + PI F K+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGK        K    ++IW
Sbjct:   14 FDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFEPDSIW 83          

HSP 5 Score: 87.0409 bits (214), Expect = 3.586e-19
Identity = 44/74 (59.46%), Postives = 58/74 (78.38%), Query Frame = 1
Query:  259 FNLEKDLILYNLENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YERVE 480
            F  + D I++    D IQ+   ++FDPI FGKRFDPIQFGK+FDPI FGK+FDPIQFGK+FDPIMFG+ ++ ++
Sbjct:    1 FGKKFDPIMFGKRFDPIQFG--KKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQ 72          

HSP 6 Score: 80.4925 bits (197), Expect = 1.419e-16
Identity = 41/48 (85.42%), Postives = 44/48 (91.67%), Query Frame = 3
Query:  183 FDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            F K+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGK
Sbjct:    1 FGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGK 48          
BLAST of Secreted peptide prohormone-15 vs. TrEMBL
Match: A0A193PE85 (Neuropeptide-51 (Fragment) OS=Dugesia japonica OX=6161 GN=DjNp51 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.290e-20
Identity = 50/96 (52.08%), Postives = 66/96 (68.75%), Query Frame = 1
Query:  193 DLILFNLENDLIQYNLVSDLIQFNLEKDLILYNLENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YERVE 480
            D  +F  + D  ++    D IQF  + D I++    D IQ+   ++FDPI FGKRFDPIQFGK+FDPI FGK+FDPIQFGK+FDPI FG+ +  +E
Sbjct:   16 DPKMFGDKFDSYRFEKRFDPIQFGKKFDPIMFGKRFDPIQFG--KKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIQFGKRFYPIE 109          

HSP 2 Score: 91.6633 bits (226), Expect = 1.860e-20
Identity = 50/90 (55.56%), Postives = 63/90 (70.00%), Query Frame = 1
Query:  193 DLILFNLENDLIQYNLVSDLIQFNLEKDLILYNLENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            D I F  + D I +    D IQF  + D I++    D IQ+   ++FDPI FGKRFDPIQFGK+FDPIQFGK+F PI+F +RFDPIMFG+
Sbjct:   34 DPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFG--KKFDPIMFGKRFDPIQFGKKFDPIQFGKRFYPIEFSRRFDPIMFGK 121          

HSP 3 Score: 89.3521 bits (220), Expect = 1.379e-19
Identity = 47/65 (72.31%), Postives = 54/65 (83.08%), Query Frame = 3
Query:  135 KTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKT 329
            K ++  Q  + + PI+F KRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK 
Sbjct:   31 KRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKK 95          

HSP 4 Score: 86.6557 bits (213), Expect = 1.199e-18
Identity = 46/77 (59.74%), Postives = 57/77 (74.03%), Query Frame = 1
Query:  247 DLIQFNLEKDLILYNLENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YERV 477
            D  QF ++ D  ++  + D   Y   +RFDPIQFGK+FDPI FGKRFDPIQFGKKFDPI FGKRFDPI FG+ ++ +
Sbjct:    7 DPSQFRMKFDPKMFGDKFD--SYRFEKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPI 81          

HSP 5 Score: 84.7297 bits (208), Expect = 7.290e-18
Identity = 44/51 (86.27%), Postives = 47/51 (92.16%), Query Frame = 3
Query:  174 PILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            PI F K+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPIQFGK
Sbjct:   53 PIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIQFGK 103          

HSP 6 Score: 83.9593 bits (206), Expect = 1.513e-17
Identity = 53/104 (50.96%), Postives = 67/104 (64.42%), Query Frame = 3
Query:   15 IFKDDTCHFTYNCRFIPRHIWIPTGKLYVIILELIKHFIIKTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +F D    + +  RF P    I  GK +  I+        K ++  Q  + + PI+F KRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPIQFGKRF PI+F +
Sbjct:   19 MFGDKFDSYRFEKRFDP----IQFGKKFDPIM------FGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIQFGKRFYPIEFSR 112          

HSP 7 Score: 83.9593 bits (206), Expect = 1.796e-17
Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 3
Query:  183 FDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKT 329
            F+KRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGKRFDPIQFGK 
Sbjct:   29 FEKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGKRFDPIQFGKK 77          

HSP 8 Score: 78.5666 bits (192), Expect = 1.762e-15
Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 3
Query:  174 PILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            PI F K+FDPI FGKRFDPIQFGK+FDPIQFGKRF PI+F +RFDPI FGK
Sbjct:   71 PIQFGKKFDPIMFGKRFDPIQFGKKFDPIQFGKRFYPIEFSRRFDPIMFGK 121          

HSP 9 Score: 75.0998 bits (183), Expect = 4.629e-14
Identity = 40/64 (62.50%), Postives = 49/64 (76.56%), Query Frame = 3
Query:  135 KTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            K ++ +Q    + P +F  +FD  +F KRFDPIQFGK+FDPI FGKRFDPIQFGK+FDPI FGK
Sbjct:    4 KRFDPSQFRMKFDPKMFGDKFDSYRFEKRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIMFGK 67          

HSP 10 Score: 68.5514 bits (166), Expect = 1.311e-11
Identity = 36/55 (65.45%), Postives = 44/55 (80.00%), Query Frame = 3
Query:  135 KTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 299
            K ++  Q  + + PI+F KRFDPIQFGK+FDPIQFGKRF PI+F +RFDPI FGK
Sbjct:   67 KRFDPIQFGKKFDPIMFGKRFDPIQFGKKFDPIQFGKRFYPIEFSRRFDPIMFGK 121          

HSP 11 Score: 62.003 bits (149), Expect = 3.761e-9
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 3
Query:  180 LFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +F KRFDP QF  +FDP  FG +FD  +F KRFDPIQFGK+FDPI FGK
Sbjct:    1 MFGKRFDPSQFRMKFDPKMFGDKFDSYRFEKRFDPIQFGKKFDPIMFGK 49          

HSP 12 Score: 60.4622 bits (145), Expect = 1.354e-8
Identity = 30/52 (57.69%), Postives = 41/52 (78.85%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YERVE 480
            +RFDP QF  +FDP  FG +FD  +F K+FDPIQFGK+FDPIMFG+ ++ ++
Sbjct:    4 KRFDPSQFRMKFDPKMFGDKFDSYRFEKRFDPIQFGKKFDPIMFGKRFDPIQ 55          
BLAST of Secreted peptide prohormone-15 vs. TrEMBL
Match: A0A267F9T2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017459g1 PE=4 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 3.010e-15
Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 3
Query:  156 SDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPI 314
            S + + P+L  KRFDP+   KRFDP+   KRFDP+   KRFDP+   KRFDP+
Sbjct:   48 STKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPL 100          

HSP 2 Score: 54.299 bits (129), Expect = 3.010e-15
Identity = 23/45 (51.11%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  322 VRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMF 456
            ++RFDP+   KRFDP+   KR+DP+ F K++DP+ F KR+DP++F
Sbjct:  103 MKRFDPLLSMKRFDPLLSMKRYDPLLFRKRYDPLLFRKRYDPLLF 147          

HSP 3 Score: 58.151 bits (139), Expect = 2.227e-7
Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  132 IKTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQF 320
            +K ++   S + + P+L  KRFDP+   KRFDP+   KR+DP+ F KR+DP+ F KR+DP+ F
Sbjct:   85 MKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRYDPLLFRKRYDPLLFRKRYDPLLF 147          

HSP 4 Score: 57.3806 bits (137), Expect = 3.512e-7
Identity = 30/65 (46.15%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  132 IKTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +K ++   S + + P+L  KRFDP+   KRFDP+   KRFDP+   KR+DP+ F KR+DP+ F K
Sbjct:   76 MKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRYDPLLFRKRYDPLLFRK 140          

HSP 5 Score: 55.8398 bits (133), Expect = 1.386e-6
Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 3
Query:  132 IKTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +K ++   S + + P+L  KRFDP+   KRFDP+   KRFDP+   KRFDP+   KR+DP+ F K
Sbjct:   67 MKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRYDPLLFRK 131          

HSP 6 Score: 54.6842 bits (130), Expect = 4.126e-6
Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = 3
Query:  132 IKTYELNQSDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPI 314
            +K ++   S + + P+L  KRFDP+   KRFDP+   KRFDP+   KRFDP+   KRFDP+
Sbjct:   58 MKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPL 118          

HSP 7 Score: 54.299 bits (129), Expect = 5.334e-6
Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 3
Query:  156 SDRGYYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPI 314
            S + + P+L  KRFDP+   KRFDP+   KRFDP+   KRFDP+   KRFDP+
Sbjct:   57 SMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPLLSMKRFDPL 109          

HSP 8 Score: 53.5286 bits (127), Expect = 9.094e-6
Identity = 24/50 (48.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  322 VRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR*YE 471
            ++RFDP+   KRFDP+   KRFDP+   K++DP+ F KR+DP++F + Y+
Sbjct:   94 MKRFDPLLSMKRFDPLLSMKRFDPLLSMKRYDPLLFRKRYDPLLFRKRYD 143          
BLAST of Secreted peptide prohormone-15 vs. TrEMBL
Match: A0A267GJK4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013678g1 PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.362e-14
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:   96 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 148          

HSP 2 Score: 50.8322 bits (120), Expect = 1.362e-14
Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF+   FGK+F+   FGKRF+  MFG+
Sbjct:  148 KRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 193          

HSP 3 Score: 56.225 bits (134), Expect = 1.672e-14
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:  114 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 166          

HSP 4 Score: 56.225 bits (134), Expect = 1.672e-14
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:  123 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 175          

HSP 5 Score: 56.225 bits (134), Expect = 1.672e-14
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:  132 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 184          

HSP 6 Score: 50.447 bits (119), Expect = 1.672e-14
Identity = 24/46 (52.17%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF+   FGK+F+   FGKRF   MFG+
Sbjct:  202 KRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFSGGMFGK 247          

HSP 7 Score: 50.447 bits (119), Expect = 1.672e-14
Identity = 24/46 (52.17%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF+   FGK+F    FGKRF+  MFG+
Sbjct:  211 KRFNGGMFGKRFNGGMFGKRFNGGMFGKRFSGGMFGKRFNGGMFGK 256          

HSP 8 Score: 50.447 bits (119), Expect = 1.672e-14
Identity = 24/46 (52.17%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF    FGK+F+   FGKRF+  MFG+
Sbjct:  220 KRFNGGMFGKRFNGGMFGKRFSGGMFGKRFNGGMFGKRFNGGMFGK 265          

HSP 9 Score: 56.225 bits (134), Expect = 3.411e-14
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:  105 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 157          

HSP 10 Score: 56.225 bits (134), Expect = 3.411e-14
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:  141 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 193          

HSP 11 Score: 49.2914 bits (116), Expect = 3.411e-14
Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF+   FGK+F+   FGKRF+  MFG+
Sbjct:  166 KRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGIFGKRFNGGMFGK 211          

HSP 12 Score: 49.2914 bits (116), Expect = 3.411e-14
Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF+   FGK+F+   FGKRF+  MFG+
Sbjct:  193 KRFNGGIFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 238          

HSP 13 Score: 54.299 bits (129), Expect = 5.181e-14
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 3
Query:  171 YPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +  L +KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:   88 HGGLQEKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 139          

HSP 14 Score: 50.8322 bits (120), Expect = 5.181e-14
Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRFDPIMFGR 462
            +RF+   FGKRF+   FGKRF+   FGK+F+   FGKRF+  MFG+
Sbjct:  139 KRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGK 184          

HSP 15 Score: 54.6842 bits (130), Expect = 1.411e-11
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  168 YYPILFDKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGKRFDPIQFGK 326
            +   +F KRF+   FGKRF+   FGKRF+   FGKRF+   FGKRF+   FGK
Sbjct:  150 FNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGMFGKRFNGGIFGK 202          

HSP 16 Score: 41.9726 bits (97), Expect = 1.411e-11
Identity = 20/38 (52.63%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  325 RRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKR 438
            +RF+   FGKRF    FGKRF+   FGK+F+   FGKR
Sbjct:  229 KRFNGGMFGKRFSGGMFGKRFNGGMFGKRFNGGMFGKR 266          
The following BLAST results are available for this feature:
BLAST of Secreted peptide prohormone-15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3CTI87.538e-4155.63Secreted peptide prohormone-15 OS=Schmidtea medite... [more]
A0A193PE805.505e-2369.44Neuropeptide-23 (Fragment) OS=Dugesia japonica OX=... [more]
A0A193PE851.290e-2052.08Neuropeptide-51 (Fragment) OS=Dugesia japonica OX=... [more]
A0A267F9T23.010e-1552.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GJK41.362e-1450.94Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone-15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000854 ID=SMED30000854|Name=Secreted peptide prohormone-15|organism=Schmidtea mediterranea sexual|type=transcript|length=548bp
CTAATGCAATTTAGATTTTCAAAGATGACACATGTCACTTTACTTATAAC
TGTAGGTTTATTCCACGTCATATCTGGATACCCACAGGTAAATTATATGT
AATAATATTAGAATTGATAAAACATTTCATTATAAAGACCTATGAGCTTA
ATCAGTCTGATAGAGGATATTATCCGATCCTGTTTGACAAAAGATTTGAT
CCTATTCAATTTGGAAAACGATTTGATCCAATACAATTTGGTAAGCGATT
TGATCCAATTCAATTTGGAAAAAGATTTGATCCTATACAATTTGGAAAAC
GATTTGATCCAATACAATTTGGTAAGACGATTTGATCCAATTCAATTTGG
AAAACGATTTGATCCAATACAATTTGGTAAGCGATTTGATCCGATTCAAT
TCGGAAAAAAATTTGATCCTATTCAATTTGGAAAAAGATTTGATCCAATA
ATGTTTGGCAGATAATATGAAAGAGTAGAATGAAAATAATTATTTGAATA
ATTCAATTGGGATTGTTTCTTTTTTTAAATAAATAAAGGTTATTTATT
back to top

protein sequence of SMED30000854-orf-1

>SMED30000854-orf-1 ID=SMED30000854-orf-1|Name=SMED30000854-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MSLISLIEDIIRSCLTKDLILFNLENDLIQYNLVSDLIQFNLEKDLILYN
LENDLIQYNLVRRFDPIQFGKRFDPIQFGKRFDPIQFGKKFDPIQFGKRF
DPIMFGR*
back to top
Aliases
The feature 'Secreted peptide prohormone-15' has the following synonyms
Synonym
spp-15
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway