cGMP-dependent protein kinase

Overview
NamecGMP-dependent protein kinase
Smed IDSMED30000852
Length (bp)2999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cGMP-dependent protein kinase (SMED30000852) t-SNE clustered cells

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30000852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cGMP-dependent protein kinase (SMED30000852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30000852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000852SMESG000008788.1 dd_Smed_v4_8259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000852SMESG000008788.1 dd_Smed_v4_8259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000852SMESG000008788.1 dd_Smed_v4_8259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000852SMESG000008788.1 dd_Smed_v4_8259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000852SMESG000008788.1 dd_Smed_v4_7174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000852SMESG000008788.1 dd_Smed_v4_7174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000852SMESG000008788.1 dd_Smed_v6_7174_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 332/684 (48.54%), Postives = 446/684 (65.20%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +IE L  +  L  E   EL++K+  I++LQ E++K  SV+     + ++    +S    + R+K+Q +S E      +D +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK L + KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  L+KL ++LE   +E GE IIRQG   D FFII  G+V VT+     E  +  RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPA--TQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWD 683          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 326/674 (48.37%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  893 QLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            ++K  ++ L+EK   I+EL+R+++K  SVL            + S +     ++ QG+S E    ++         K+ KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK L + KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  L+KL ++LE   +E GE IIRQG   D FFII  G+V VT+     E  +  RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   18 RIKELEKRLSEKEEEIQELKRKLHKCQSVLP-----------VPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWD 668          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 344/766 (44.91%), Postives = 475/766 (62.01%), Query Frame = 2
Query:  773 AMGPYHSKHIES--------CFKHK--EISSVLRPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREI-------NKLTSVL----------DQTQISLESNDMISSVNSIQNR-SKKQGVSGESNKDQTNL--------KLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELK--------NKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVK-----------LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++ P HSKH +           ++K  E+   LR    EI E E       LK  +E+L+++ + I EL  E+       NKL  V+             ++ LE +   S + S+ +R   K GVS E      +L        +  + +K +S K L+ +++ KN  L  L   Q+ +M+E MY R   +G Y+I +GE G+H++V   G  EV++ E+LL  +     FGELA+LYNC RTASVKA+T+ K W LDREVFQ IM RT   R E+   FL+SV LLK LPE KL K+++ LE++ +++G+ IIR+GE    FFI+  G VKVTQ  +G  + Q+I+TL  GEYFGEKAL+S + R+AN+ A  +    L + R+ F + +G   EL+        N N +DEK    +S S   +     +E ++ +K            ++LE++ TLGVGGFGRVELV++ +++ + +A+KC++K HIV TKQQ+HV SEK+IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+  +KFC+ CV EAFDYLH  GIIYRDLKPENL++   GYLKL DFGFAK+IG G++TWTFCGTPEYV+PE+ILNK HDF+ D+WS+GIL YELLTG PPF+G D M  Y LILKGIE  D    R+IT R    I+ LC+ N  ERLGN   G+ +IK H++  GF+WE ++ + L SP   ++    DHS FD +  E  +PPDE SGWD++
Sbjct:    5 SVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREY-----HLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLE-MIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVA-FAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDF--PRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKD 761          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 344/766 (44.91%), Postives = 475/766 (62.01%), Query Frame = 2
Query:  773 AMGPYHSKHIES--------CFKHK--EISSVLRPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREI-------NKLTSVL----------DQTQISLESNDMISSVNSIQNR-SKKQGVSGESNKDQTNL--------KLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELK--------NKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVK-----------LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++ P HSKH +           ++K  E+   LR    EI E E       LK  +E+L+++ + I EL  E+       NKL  V+             ++ LE +   S + S+ +R   K GVS E      +L        +  + +K +S K L+ +++ KN  L  L   Q+ +M+E MY R   +G Y+I +GE G+H++V   G  EV++ E+LL  +     FGELA+LYNC RTASVKA+T+ K W LDREVFQ IM RT   R E+   FL+SV LLK LPE KL K+++ LE++ +++G+ IIR+GE    FFI+  G VKVTQ  +G  + Q+I+TL  GEYFGEKAL+S + R+AN+ A  +    L + R+ F + +G   EL+        N N +DEK    +S S   +     +E ++ +K            ++LE++ TLGVGGFGRVELV++ +++ + +A+KC++K HIV TKQQ+HV SEK+IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+  +KFC+ CV EAFDYLH  GIIYRDLKPENL++   GYLKL DFGFAK+IG G++TWTFCGTPEYV+PE+ILNK HDF+ D+WS+GIL YELLTG PPF+G D M  Y LILKGIE  D    R+IT R    I+ LC+ N  ERLGN   G+ +IK H++  GF+WE ++ + L SP   ++    DHS FD +  E  +PPDE SGWD++
Sbjct:    5 SVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREY-----HLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLE-MIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVA-FAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDF--PRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKD 761          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 331/755 (43.84%), Postives = 458/755 (60.66%), Query Frame = 2
Query:  773 AMGPYHSKHIES--------CFKHK--EISSVLRPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREI-------NKLTSVL----------DQTQISLESNDMISSVNSIQNR-SKKQGVSGESNKDQTNL--------KLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELK--------NKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++ P HSKH +           ++K  E+   LR    EI E E       LK  +E+L+++ + I EL  E+       NKL  V+             ++ LE +   S + S+ +R   K GVS E      +L        +  + +K +S K L+ +++ KN  L  L   Q+ +M+E MY R   +G Y+I +GE G+H++V   G  EV++ E+LL  +     FGELA+LYNC RTASVKA+T+ K W LDREVFQ IM RT   R E+   FL+SV LLK LPE KL K+++ LE++ +++G+ IIR+GE    FFI+  G VKVTQ  +G  + Q+I+TL  GEYFGEKAL+S + R+AN+ A  +    L + R+ F + +G   EL+        N N +DEK    +S S   +     +E ++ +K                  E V++ +++ + +A+KC++K HIV TKQQ+HV SEK+IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+  +KFC+ CV EAFDYLH  GIIYRDLKPENL++   GYLKL DFGFAK+IG G++TWTFCGTPEYV+PE+ILNK HDF+ D+WS+GIL YELLTG PPF+G D M  Y LILKGIE  D    R+IT R    I+ LC+ N  ERLGN   G+ +IK H++  GF+WE ++ + L SP   ++    DHS FD +  E  +PPDE SGWD++
Sbjct:    5 SVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREY-----HLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLE-MIQLK------------------EKVKVKNENVA-FAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDF--PRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKD 732          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 338/747 (45.25%), Postives = 474/747 (63.45%), Query Frame = 2
Query:  791 SKHIESCFKHKEISSVLRPIGDEIYEM-EIENLHNQLK----------LTQEELNEKNI-RIEEL-------QREINKLTSVLDQTQISLE----------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            S+H    F   +  + L  +G   +E  E++ L  QL+            Q+ + E +I RI EL       QRE +KL SVL+Q   S                   ND+    +   + +Q R+KK  VS E +N +     L  Y K+   K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +   LL  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +L+ FL  V + + L E +++K+ ++++   ++ G  IIRQGE  D FF+I SG VKVTQ+ +GE +   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL  LK K+Y D++ L        S V I +D   E+   V LK+++ + TLGVGGFGRVELV ++ D   T+ALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  +GYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV++  D +NFD++  ++++PPDE+SGWDE
Sbjct:    5 SRHHMDSFSSNDGGAFLVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQ-RAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFR-EEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDE 747          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 338/747 (45.25%), Postives = 474/747 (63.45%), Query Frame = 2
Query:  791 SKHIESCFKHKEISSVLRPIGDEIYEM-EIENLHNQLK----------LTQEELNEKNI-RIEEL-------QREINKLTSVLDQTQISLE----------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            S+H    F   +  + L  +G   +E  E++ L  QL+            Q+ + E +I RI EL       QRE +KL SVL+Q   S                   ND+    +   + +Q R+KK  VS E +N +     L  Y K+   K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +   LL  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +L+ FL  V + + L E +++K+ ++++   ++ G  IIRQGE  D FF+I SG VKVTQ+ +GE +   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL  LK K+Y D++ L        S V I +D   E+   V LK+++ + TLGVGGFGRVELV ++ D   T+ALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  +GYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV++  D +NFD++  ++++PPDE+SGWDE
Sbjct:    5 SRHHMDSFSSNDGGAFLVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQ-RAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFR-EEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDE 747          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 338/747 (45.25%), Postives = 474/747 (63.45%), Query Frame = 2
Query:  791 SKHIESCFKHKEISSVLRPIGDEIYEM-EIENLHNQLK----------LTQEELNEKNI-RIEEL-------QREINKLTSVLDQTQISLE----------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            S+H    F   +  + L  +G   +E  E++ L  QL+            Q+ + E +I RI EL       QRE +KL SVL+Q   S                   ND+    +   + +Q R+KK  VS E +N +     L  Y K+   K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +   LL  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +L+ FL  V + + L E +++K+ ++++   ++ G  IIRQGE  D FF+I SG VKVTQ+ +GE +   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL  LK K+Y D++ L        S V I +D   E+   V LK+++ + TLGVGGFGRVELV ++ D   T+ALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  +GYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV++  D +NFD++  ++++PPDE+SGWDE
Sbjct:    5 SRHHMDSFSSNDGGAFLVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQ-RAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFR-EEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDE 747          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 322/679 (47.42%), Postives = 448/679 (65.98%), Query Frame = 2
Query:  938 IEELQREINKLTSVLDQTQISLE----------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            +  LQRE +KL SVL+Q   S                   ND+    +   + +Q R+KK  VS E +N +     L  Y K+   K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +   LL  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +L+ FL  V + + L E +++K+ ++++   ++ G  IIRQGE  D FF+I SG VKVTQ+ +GE +   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL  LK K+Y D++ L        S V I +D   E+   V LK+++ + TLGVGGFGRVELV ++ D   T+ALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  +GYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV++  D +NFD++  ++++PPDE+SGWDE
Sbjct:   61 VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQ-RAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFR-EEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDE 735          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 322/679 (47.42%), Postives = 448/679 (65.98%), Query Frame = 2
Query:  938 IEELQREINKLTSVLDQTQISLE----------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            +  LQRE +KL SVL+Q   S                   ND+    +   + +Q R+KK  VS E +N +     L  Y K+   K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +   LL  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +L+ FL  V + + L E +++K+ ++++   ++ G  IIRQGE  D FF+I SG VKVTQ+ +GE +   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL  LK K+Y D++ L        S V I +D   E+   V LK+++ + TLGVGGFGRVELV ++ D   T+ALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  +GYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV++  D +NFD++  ++++PPDE+SGWDE
Sbjct:   61 VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQ-RAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFR-EEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDE 735          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: Pkg21D (gene:FBgn0000442 transcript:FBtr0078042)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 319/629 (50.72%), Postives = 429/629 (68.20%), Query Frame = 2
Query: 1052 KKQGVSGES----NKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDA-KLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRY---DGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKL----VNVKLKDLELVCTLGVGGFGRVELVRLSH-DHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            KKQGVS ES     +   ++ + KY+K  S K  ++++I+ N  L N+   QV E+++ MY + I  G +VI EGE G HLYV+ +G+F V +  ++L  +   + FGELA+LYNC RTAS++ L++A ++WVLDR VFQ IMM TG+QR E  + FL+SVPLL  L E  L K+ ++LEL+ +  G  IIRQG + D FF+I  G+V+VTQ+      EE  +RTL+ G+YFGE+AL++ + RTAN+ A S   + L L R  F  LIGDL ELK K+Y DE   L+   ++ S C D   E+L     ++KL DLE+V TLG+GGFGRVELV+  H D    +ALKC+KK HIV TKQ++H+ SE+ I+L  RS FICRLY TF+D K+VYML+E C+GGE+WT LRD+  F+D   +F +GCVL+AF+YLH+RGIIYRDLKPENL++   GY+K+ DFGFAK+IG   +TWTFCGTPEYV+PEIILNK HD   DYW++GIL +ELL GTPPF+  DPM+ Y LILKGI+   I   + I+  A   I+ LC+   +ERLG   GG+++IK HK+F GFDW+ +  Q L+ PF   +   TD   FD F  +   PPDE SGWD +
Sbjct:  142 KKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQES-CRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDM--IAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDAD 767          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 291/606 (48.02%), Postives = 400/606 (66.01%), Query Frame = 2
Query: 1046 RSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVT--QRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLY--RKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNF 2839
            R +  G+S E   + +    ++   KY K    + L++ +IL N  + NL   Q+ E+++ MY  +      +I EG+ G  +YV E G  EV +  + L  L G +  GELA+LYNC+RTA++ A+T+  LW ++R+ FQ IMMRTG+ RQ E   FLKSVP+ K L E  L K+ ++LE   ++ G+ I+RQG   D FFII  G V+VT  Q+   EE+ IR L  G++FGEKAL   + RTAN+   S+   V CL   R+ F +LI +L+E+K++ Y+DE  +  +  +          E+  ++ L DL ++ TLGVGGFGRVELV+ + D   ++ALK MKK  IV+T+QQ H++SEK+I+ E    FI +L+ TFKD K++YMLME CLGGELWT LRDK +FDD  T+F   CV+EAFDYLHSR IIYRDLKPENLL+   GY+KL DFGFAK++  G++TWTFCGTPEYV+PE+ILN+ HD ++DYWS+G+L +ELLTGTPPFTG+DPM+ Y +ILKGI+A +    R IT  AS+ I+ LC+ N AERLG   GG+ EI+ HK+F GF W  ++   L  P  P V S  D +NF
Sbjct:  475 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESA-DGVSCLVIDRETFNQLISNLDEIKHR-YDDEGAMERRKIN----------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEF--PRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNF 1066          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089312)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 291/606 (48.02%), Postives = 400/606 (66.01%), Query Frame = 2
Query: 1046 RSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVT--QRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLY--RKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNF 2839
            R +  G+S E   + +    ++   KY K    + L++ +IL N  + NL   Q+ E+++ MY  +      +I EG+ G  +YV E G  EV +  + L  L G +  GELA+LYNC+RTA++ A+T+  LW ++R+ FQ IMMRTG+ RQ E   FLKSVP+ K L E  L K+ ++LE   ++ G+ I+RQG   D FFII  G V+VT  Q+   EE+ IR L  G++FGEKAL   + RTAN+   S+   V CL   R+ F +LI +L+E+K++ Y+DE  +  +  +          E+  ++ L DL ++ TLGVGGFGRVELV+ + D   ++ALK MKK  IV+T+QQ H++SEK+I+ E    FI +L+ TFKD K++YMLME CLGGELWT LRDK +FDD  T+F   CV+EAFDYLHSR IIYRDLKPENLL+   GY+KL DFGFAK++  G++TWTFCGTPEYV+PE+ILN+ HD ++DYWS+G+L +ELLTGTPPFTG+DPM+ Y +ILKGI+A +    R IT  AS+ I+ LC+ N AERLG   GG+ EI+ HK+F GF W  ++   L  P  P V S  D +NF
Sbjct:  475 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESA-DGVSCLVIDRETFNQLISNLDEIKHR-YDDEGAMERRKIN----------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEF--PRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNF 1066          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089304)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 291/606 (48.02%), Postives = 400/606 (66.01%), Query Frame = 2
Query: 1046 RSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVT--QRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLY--RKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNF 2839
            R +  G+S E   + +    ++   KY K    + L++ +IL N  + NL   Q+ E+++ MY  +      +I EG+ G  +YV E G  EV +  + L  L G +  GELA+LYNC+RTA++ A+T+  LW ++R+ FQ IMMRTG+ RQ E   FLKSVP+ K L E  L K+ ++LE   ++ G+ I+RQG   D FFII  G V+VT  Q+   EE+ IR L  G++FGEKAL   + RTAN+   S+   V CL   R+ F +LI +L+E+K++ Y+DE  +  +  +          E+  ++ L DL ++ TLGVGGFGRVELV+ + D   ++ALK MKK  IV+T+QQ H++SEK+I+ E    FI +L+ TFKD K++YMLME CLGGELWT LRDK +FDD  T+F   CV+EAFDYLHSR IIYRDLKPENLL+   GY+KL DFGFAK++  G++TWTFCGTPEYV+PE+ILN+ HD ++DYWS+G+L +ELLTGTPPFTG+DPM+ Y +ILKGI+A +    R IT  AS+ I+ LC+ N AERLG   GG+ EI+ HK+F GF W  ++   L  P  P V S  D +NF
Sbjct:  475 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESA-DGVSCLVIDRETFNQLISNLDEIKHR-YDDEGAMERRKIN----------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEF--PRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNF 1066          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 291/606 (48.02%), Postives = 400/606 (66.01%), Query Frame = 2
Query: 1046 RSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVT--QRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLY--RKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNF 2839
            R +  G+S E   + +    ++   KY K    + L++ +IL N  + NL   Q+ E+++ MY  +      +I EG+ G  +YV E G  EV +  + L  L G +  GELA+LYNC+RTA++ A+T+  LW ++R+ FQ IMMRTG+ RQ E   FLKSVP+ K L E  L K+ ++LE   ++ G+ I+RQG   D FFII  G V+VT  Q+   EE+ IR L  G++FGEKAL   + RTAN+   S+   V CL   R+ F +LI +L+E+K++ Y+DE  +  +  +          E+  ++ L DL ++ TLGVGGFGRVELV+ + D   ++ALK MKK  IV+T+QQ H++SEK+I+ E    FI +L+ TFKD K++YMLME CLGGELWT LRDK +FDD  T+F   CV+EAFDYLHSR IIYRDLKPENLL+   GY+KL DFGFAK++  G++TWTFCGTPEYV+PE+ILN+ HD ++DYWS+G+L +ELLTGTPPFTG+DPM+ Y +ILKGI+A +    R IT  AS+ I+ LC+ N AERLG   GG+ EI+ HK+F GF W  ++   L  P  P V S  D +NF
Sbjct:  129 RQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESA-DGVSCLVIDRETFNQLISNLDEIKHR-YDDEGAMERRKIN----------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEF--PRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNF 720          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 331/684 (48.39%), Postives = 447/684 (65.35%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR--YDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +IE L  +  L  E   EL++K+  I++LQ E++K  SV+      +     +        R+K+Q +S E      +D +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  + D+   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+V+ LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  +GL E  L+KL ++LE   + +GE IIRQG   D FFII  G V VT+    +G    +R L  G++FGEKAL   + RTANV A  +VT  L + R+ F  LIG L+++ NK Y+D                +AE     N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A + I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L+ P  P V S TD SNFD F +D ++ PPD+ SGWD
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQVHKQSALQE----HQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKY---------EAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWD 681          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 329/676 (48.67%), Postives = 442/676 (65.38%), Query Frame = 2
Query:  893 QLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKK-QGVSGE-----SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR--YDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            ++K  +  L+ K   + EL+R+++K  SVL  T               I  R+++ QG+S E     S +D  +  L K+ KS   K L++E+IL N  + NL   Q+ E+++ MY  + D+   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+V+ LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  +GL E  L+KL ++LE   + +GE IIRQG   D FFII  G V VT+    +G    +R L  G++FGEKAL   + RTANV A  +VT  L + R+ F  LIG L+++ NK Y+D                +AE     N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A + I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L+ P  P V S TD SNFD F +D ++ PPD+ SGWD
Sbjct:   18 RIKEMERLLSAKEQEVNELKRKLHKYQSVLPST---------------IGPRTRRAQGISAEPQTARSFQDLKSEALRKHHKSVRSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKY---------EAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWD 666          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 322/667 (48.28%), Postives = 436/667 (65.37%), Query Frame = 2
Query:  908 QEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGE--SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR-YDGEEQV-IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +  L E+   I EL+R+++K  SVL   QI   ++             + QG+S E  +++D +N    +  KS+  K L++ +IL N  + NL   Q+ E+++ MY    D+   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+V+ ++  KLW +DR+ FQ IMMRTG+ +  E +  LKSV   +GLPE  L+KL ++LE   +E+G  IIRQG   D FFII  G V +T+    G+E V +R++  G+ FGEKAL   + RTANV A  +VT  L + R  +  LIG L ++ NK  ED +              +AE     N+ L D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+ +FDD  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A++ I+ LC+   +ERLGN   G+++I+ HK+F+GF+W+ +RK  L+ P  P VTSSTD SNFD F +D ++ PPD+ SGWD
Sbjct:   23 ERRLLEREDEISELKRKLHKCQSVLPSAQIGPRTH-------------RAQGISAEPQTHQDLSNQSFRRVAKSDRSKDLIKSAILDNDFMKNLEMSQIQEIVDCMYPVDYDKNSCIIKEGDVGSLVYVMEDGKVEVTKEGLKLCTMGPGKVFGELAILYNCTRTATVRTVSSVKLWAIDRQCFQTIMMRTGLIKHAEYMELLKSVLTFRGLPEEILSKLADVLEETHYEDGNYIIRQGARGDTFFIISKGKVTMTREDCPGQEPVYLRSMGRGDSFGEKALQGEDIRTANVIAAETVT-CLVIDRDSYKHLIGGLEDVSNKGCEDAEAKAKY---------EAENAFFSNLNLSDFNIIDTLGVGGFGRVELVQLKSDEMKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGNFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAANLIKKLCRDTPSERLGNLKNGVKDIQKHKWFEGFNWDGLRKGTLMPPIIPNVTSSTDTSNFDSFPEDNEDPPPDDNSGWD 664          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 327/743 (44.01%), Postives = 458/743 (61.64%), Query Frame = 2
Query:  851 GDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLES--------NDMISSVNSIQ----------------------NRSK--KQGVSGESNK---DQTNLKLIKYK-----KSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEE--QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKN--KNY-----EDEKHXXXXXXXXXXICNDAEMEKLVNVKLKD-----------LELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            G+ I  + +E L   LK   E+LN K ++I+ L+ ++ +    L +   +L S         D + S   +                       NR K  K GVS E +    D + +    ++     K  S+K LL +++ KN  L  L   QV +M+E MYER   +G YVI +GE G+HL+V   G  +V++  +LL  +     FGELA+LYNC RTASVKA ++ K W LDREVF  IM  T   R E+   FL+SV LL  LP  KL K+V+ LE++ + +G+ IIR+GE  + F+II +G +KVTQ     E  Q+I TL  G+YFGEKAL+S + R+AN+ A     + L + R+ F + +G  +ELK   ++Y      D+K   +K S   +  N      ++ +K ++           LE + TLGVGGFGRVELV+L +++  T+ALKC+KK HIV  +Q++H+ SE++ILLE    FI ++Y T+KD K+VYML+E CLGGE+W+ LRD+  F++   KFC+GCV EAFDYLH+ GIIYRDLKPENL++ T GY+KL DFGFAK++  G+RTWTFCGTPEYV+PEIILNK H  + D+WS+GIL +ELLTG+PPFTG+D M IYT ILKGIE  D    ++IT R    I+ LC+ N +ERLGN   G+ +IK H++F GF W  ++ ++L+SP   +V   TDHS FD +  E+E+PPDE SGWD +
Sbjct:   24 GESILRVRVEELETHLKKKDEDLNAKELQIKHLEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLTGLLRETLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLEVQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKNEN-VTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDF--PKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTD 763          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 325/741 (43.86%), Postives = 457/741 (61.67%), Query Frame = 2
Query:  857 EIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLES--------NDMISSVNSIQ----------------------NRSK--KQGVSGESNK---DQTNLKLIKYK-----KSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEE--QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKN--KNY-----EDEKHXXXXXXXXXXICNDAEMEKLVNVKLKD-----------LELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++  + +E L   LK   E+LN K ++I+ L+ ++ +    L +   +L S         D + S   +                       NR K  K GVS E +    D + +    ++     K  S+K LL +++ KN  L  L   QV +M+E MYER   +G YVI +GE G+HL+V   G  +V++  +LL  +     FGELA+LYNC RTASVKA ++ K W LDREVF  IM  T   R E+   FL+SV LL  LP  KL K+V+ LE++ + +G+ IIR+GE  + F+II +G +KVTQ     E  Q+I TL  G+YFGEKAL+S + R+AN+ A     + L + R+ F + +G  +ELK   ++Y      D+K   +K S   +  N      ++ +K ++           LE + TLGVGGFGRVELV+L +++  T+ALKC+KK HIV  +Q++H+ SE++ILLE    FI ++Y T+KD K+VYML+E CLGGE+W+ LRD+  F++   KFC+GCV EAFDYLH+ GIIYRDLKPENL++ T GY+KL DFGFAK++  G+RTWTFCGTPEYV+PEIILNK H  + D+WS+GIL +ELLTG+PPFTG+D M IYT ILKGIE  D    ++IT R    I+ LC+ N +ERLGN   G+ +IK H++F GF W  ++ ++L+SP   +V   TDHS FD +  E+E+PPDE SGWD +
Sbjct:   31 QVLRVRVEELETHLKKKDEDLNAKELQIKHLEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLTGLLRETLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLEVQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKNEN-VTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDF--PKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTD 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 331/671 (49.33%), Postives = 439/671 (65.42%), Query Frame = 2
Query:  908 QEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRS-KKQGVSGE-----SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR-YDGEEQV-IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +  L+EK   I+EL+R+++K  SVL            + S + I  R+ + QG+S E     S  D T     K+ KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  ++KL ++LE   +E G+ IIRQG   D FFII  G V VT+    GE+ + +RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +      N         +KL D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  FDD  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D ++ PPD+ SGWD
Sbjct:   23 ENRLSEKEKEIQELKRKLHKYQSVL-----------AMPSTSHIGPRTTRAQGISAEPQSFRSYHDLTRQAFKKFTKSERSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFGN---------LKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWD 670          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 331/684 (48.39%), Postives = 446/684 (65.20%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR-YDGEEQV-IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +IE L  +  L  E   EL++K+  I+ LQ E++K  SV+      +   +        + R+K+Q +S E      ++ +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  ++KL ++LE   +E G+ IIRQG   D FFII  G V VT+    GE+ + +RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +      N         +KL D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  FDD  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D ++ PPD+ SGWD
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQN---PTTLGEQRTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFGN---------LKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWD 682          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 331/684 (48.39%), Postives = 446/684 (65.20%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR-YDGEEQV-IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +IE L  +  L  E   EL++K+  I+ LQ E++K  SV+      +   +        + R+K+Q +S E      ++ +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  ++KL ++LE   +E G+ IIRQG   D FFII  G V VT+    GE+ + +RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +      N         +KL D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  FDD  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D ++ PPD+ SGWD
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQN---PTTLGEQRTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFGN---------LKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWD 682          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: ptafr (platelet activating factor receptor [Source:Xenbase;Acc:XB-GENE-968925])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 322/726 (44.35%), Postives = 450/726 (61.98%), Query Frame = 2
Query:  908 QEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSV------------------------------------NSIQNRSKKQGVSGE-------SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNEL--------KNKNYEDEK-HXXXXXXXXXXICNDAEMEKLVNV--------KLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            QE++ ++N  IEE+  E+      L++ Q+ +++ + IS+                                     NS + +  K+GVS E        +  + + +  + +K+ S K L+ +++ KN  +  +  +Q+ +M+E MYER   +G ++I +GE G  ++V   G  EV++  +LL  +     FGELA+LYNC RTASVKA+T  + W LDREVFQ IM +T   + EE L FLKSVPLLK LPE KL K+ + LEL+ +E  + IIR+GE    FFII  G VKVTQ  +G  E Q I+ L  G+YFGEKAL+S + R+AN+ A     + L + R+ F + +G   EL         N   +DE+ H  S  + +       E+ K+             ++LE+V TLGVGGFGRVELV++ +++   +ALKC+KK HIV  +QQ+H+ SEK IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+   KFC GCV EAF+YLH +G++YRDLKPENLL+ + GY+KL DFGFAK+I  G++TWTFCGTPEYV+PE+ILNK H F+ D+WS+GIL YELLTG+PPFTG D M IY LIL+GIE  + + N  IT R    I+ LC+ N AERLGN   G+ +IK H++F GF+WE +  + L SP  P++   TDHS FD +  ++E+PPDE SGWD++
Sbjct:   64 QEQIKKQNQVIEEMAEELQNKCVQLNKLQVVVQTQNGISTTPDLHKMLQPSPTKTLHALPTKSLKGSPLKTFSGLFSNSNKRKGAKEGVSAEPTSRYDGGDHPRFSFEKARVRKNTSEKILISDALNKNQFMKRMDHHQIQDMVECMYERIYLQGEFIIRQGEPGSQIFVLADGKAEVFQENKLLTSIPVWTTFGELAILYNCTRTASVKAITGVRTWALDREVFQNIMRKTAQSKHEEYLSFLKSVPLLKELPEHKLMKIADCLELEFYEMDDYIIREGEEGSTFFIISKGKVKVTQSTEGYKEPQYIKFLEKGDYFGEKALISDDVRSANILAYGDRVECLVMDRETFNKTVGTYEELMKCLEGYVANLTLDDERRHAKSPVNERHLRAVSMELNKMKQTLARFPSASPFENLEIVTTLGVGGFGRVELVKVKNENL-VFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVKLYCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYRDLKPENLLLDSEGYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGILLYELLTGSPPFTGPDQMIIYNLILQGIEKIEFYKN--ITKRPEDLIRRLCRENPAERLGNMKNGIADIKKHRWFNGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEEIPPDEVSGWDQD 786          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: tnpo2 (transportin 2 [Source:Xenbase;Acc:XB-GENE-968452])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 322/697 (46.20%), Postives = 443/697 (63.56%), Query Frame = 2
Query:  911 EELNEKNIRIEELQRE-------INKLTSVL--DQTQISLESNDMISSVNSIQNRSKKQGVSGES------NKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLE-LQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNK----------NYEDEKHXXXXXXXXXXICNDA--EMEKLVN-----VKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            +EL EK+ +I +L++E       I+KL   L  + TQ S + +     +++ + +  K+GVS E       N    N  +   +K +S K L+  +I+ N  L  L    V  M++ MYER   +   VI EG  G+HLYV   G  +V +  RLL  +     FGELA+LYNC+RTA+VKA+TD+K+WVLDR+VFQ IMM +   + +E   FL+      GL  + + +L+  ++    +++G+ IIR+GE  + FFII  G V VTQ  +G  E Q I+TL +G+YFGEKAL+S + R+AN+ A    T  L + R  F +++G   EL+            N  D ++        +S  N    ++ +LV+        + L+++ TLG GGFGRVELV+L  D   T+ALKC+KK HIV T QQ+HV  EK IL +    FI RLY TF+D K+VYML+EVCLGGELW+ LRD   F++   +FC GCVLEAFDYLH+RGI+YRDLKPENLL+ + GY+K+ DFGFAK+IG GK+TWTFCGTPEYV+PEII+N+ HDF +DYWS+GIL YELLTG+PPF+G DP+KIY ++LKGIE  D  H  RI  R+   I+ LC+ N AERLGN   G+ +I+ HK+FQGF+WE +R + L+SP   ++   TDHS FD+F  E E PPDE SGWD+
Sbjct:   53 KELQEKDEKILQLEKELEVKVIQIDKLQDALGYNVTQTSPKGSQKKKLLSAHRRQKAKEGVSAEPTSRHYYNPSSQNPDVTCVRKDSSAKKLITGAIMSNDFLRQLEASHVRCMVDCMYERVYSKSQLVIQEGAAGNHLYVLADGLLDVIQNSRLLGQMHPGTAFGELAILYNCKRTATVKAVTDSKIWVLDRQVFQNIMMSSAQAQHQEYFSFLRRYV---GLFSVMIYRLLYTIKNTDFYDKGDYIIREGEEGNTFFIIAKGKVCVTQAVEGSQEPQEIKTLGVGDYFGEKALISEDVRSANIIAEEDDTQCLVIDRDTFNQMVGTYQELQTYLREYVFQLALNDHDRRNARKSLHHSMSRDNSEVNQLRELVSKFSSTSPFRYLDVITTLGTGGFGRVELVKLK-DEDMTFALKCIKKKHIVDTHQQEHVYWEKNILQQINCSFIIRLYRTFRDAKYVYMLLEVCLGGELWSILRDTGPFEEGTARFCTGCVLEAFDYLHNRGIVYRDLKPENLLLDSEGYIKMVDFGFAKKIGPGKKTWTFCGTPEYVAPEIIMNRGHDFGADYWSLGILIYELLTGSPPFSGTDPIKIYNMVLKGIEKVDFPH--RIGRRSEDVIRRLCRINPAERLGNRKNGISDIRKHKWFQGFNWEGLRNRKLLSPLKREIKGITDHSYFDNFLPESEEPPDELSGWDK 743          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 331/684 (48.39%), Postives = 445/684 (65.06%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +IE L  +  L  E   EL++K+  I++LQ E++K  SV+     + ++    +S    + R+K+Q +S E      +D +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK L + KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LP+  L+KL ++LE   +E GE IIRQG   D FFII  G V VT+     E  +  RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPA--TQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWD 683          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 325/674 (48.22%), Postives = 435/674 (64.54%), Query Frame = 2
Query:  893 QLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            ++K  ++ L+EK   I+EL+R+++K  SVL            + S +     ++ QG+S E    ++         K+ KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK L + KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LP+  L+KL ++LE   +E GE IIRQG   D FFII  G V VT+     E  +  RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   18 RIKELEKRLSEKEEEIQELKRKLHKCQSVLP-----------VPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWD 668          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 338/761 (44.42%), Postives = 476/761 (62.55%), Query Frame = 2
Query:  773 AMGPYHSKHIES---CFKHKEISSVLRPIGDEIY--EMEIENLHNQLKLTQEELNEKNIRIEELQREI-------NKLTSVL----------DQTQISLESNDMISSVNSIQNR-SKKQGVSGESNKDQTNL--------KLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNK--------NYEDEKHXXXXXXXXXXICNDAEMEKLVNVK-----------LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++ P H+KH +       ++ + S +  +  E+   + E++     LK  +E+L ++ + I EL  E+       NKL  V+             ++ L+ +   S + S+ +R   K GVS E      +L        +  + +K +S K L+ +++ KN  L  L   Q+ +M+E MY R   +G YVI +GE G+H++V   G  EV++ E+LL  +     FGELA+LYNC RTASVKA+T+ K W LDREVFQ IM RT   R EE   FL+SV LLK LPE KL K+++ LE++ +++G+ IIR+GE    FFI+  G VKVTQ  +G  + Q+I+TL  GEYFGEKAL+S + R+AN+ A  +    L + R+ F + +G  +EL+          N +DEK    +S S   +     +E ++ +K            ++LE++ TLGVGGFGRVELV++ +++ + +A+KC++K HIV TKQQ+HV SEK+IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+  +KFC+ CV EAFDYLH  GIIYRDLKPENL++   GYLKL DFGFAK+IG G++TWTFCGTPEYV+PE+ILNK HDF+ D+WS+GIL YELLTG PPF+G D M  Y LILKGIE  D    R+IT R    I+ LC+ N  ERLGN   G+ +IK H++  GF+WE ++ + L SP   +++   DHS FD +  E  +PPDE SGWD++
Sbjct:    5 SVKPKHAKHPDGHSGNLSNEALRSKVLELERELRRKDAELQEREYHLKELREQLAKQTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLE-MIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENVA-FAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDF--PRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKD 761          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 325/750 (43.33%), Postives = 459/750 (61.20%), Query Frame = 2
Query:  773 AMGPYHSKHIES---CFKHKEISSVLRPIGDEIY--EMEIENLHNQLKLTQEELNEKNIRIEELQREI-------NKLTSVL----------DQTQISLESNDMISSVNSIQNR-SKKQGVSGESNKDQTNL--------KLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNK--------NYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++ P H+KH +       ++ + S +  +  E+   + E++     LK  +E+L ++ + I EL  E+       NKL  V+             ++ L+ +   S + S+ +R   K GVS E      +L        +  + +K +S K L+ +++ KN  L  L   Q+ +M+E MY R   +G YVI +GE G+H++V   G  EV++ E+LL  +     FGELA+LYNC RTASVKA+T+ K W LDREVFQ IM RT   R EE   FL+SV LLK LPE KL K+++ LE++ +++G+ IIR+GE    FFI+  G VKVTQ  +G  + Q+I+TL  GEYFGEKAL+S + R+AN+ A  +    L + R+ F + +G  +EL+          N +DEK    +S S   +     +E ++ +K                  E V++ +++ + +A+KC++K HIV TKQQ+HV SEK+IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+  +KFC+ CV EAFDYLH  GIIYRDLKPENL++   GYLKL DFGFAK+IG G++TWTFCGTPEYV+PE+ILNK HDF+ D+WS+GIL YELLTG PPF+G D M  Y LILKGIE  D    R+IT R    I+ LC+ N  ERLGN   G+ +IK H++  GF+WE ++ + L SP   +++   DHS FD +  E  +PPDE SGWD++
Sbjct:    5 SVKPKHAKHPDGHSGNLSNEALRSKVLELERELRRKDAELQEREYHLKELREQLAKQTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLE-MIQLK------------------EKVKVKNENVA-FAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDF--PRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKD 732          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 399.823 bits (1026), Expect = 2.938e-130
Identity = 200/382 (52.36%), Postives = 254/382 (66.49%), Query Frame = 2
Query: 1751 ETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC                     ++F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   31 DVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLC---------------------RWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWD 379          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|A8X6H1|EGL4_CAEBR (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae OX=6238 GN=egl-4 PE=3 SV=2)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 336/746 (45.04%), Postives = 476/746 (63.81%), Query Frame = 2
Query:  791 SKHIESCFKHKEISSVLRPIGDEIYEM-EIENLHNQLK----------LTQEELNEKNI-RIEEL-------QREINKLTSVLDQTQISLE---------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            S+H    F   + ++ L  +G   +E  E++ L  QL+            Q+ + E +I RI EL       QRE +KL SVL+Q   S                  ND+    +   +  Q R+KK  VS E +N +     L  Y K+ + K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +    L  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +++ FL  V +   L E +++K+ ++++   ++ G  I+RQGE  D FF+I SG VKVTQ+ +GE++   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL+ L+ K+Y D++ + +      S V I +D   E+  NV LK+++ + TLGVGGFGRVELV ++ D   TYALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  SGYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV +  D +NFD++  ++++PPDE+SGWDE
Sbjct:    5 SRHHLDSFSSNDGNAFLVQVGSRTFEAHELQKLIPQLEEAISRKDAQLRQQQSIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGQPPSPSPRTDQLGNDLQQKAVFPADGTQQRAKKIAVSAEPTNFENKPATLQHYNKTVAAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGATLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQIINFLSKVSIFANLTEDRISKIADVMDQDYYDGGHYILRQGEKGDAFFVINSGQVKVTQQIEGEKEAREIRILNQGDFFGERALLGDEVRTANIIAQAPGVEVLTLDRESFTKLIGDLDTLR-KDYGDKERVATLVREPPSPVKIVDDFR-EEFANVTLKNVKRLATLGVGGFGRVELVCVNGDKSKTYALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANSGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRTKTLKPPILPKVNNPADVTNFDNYPPDNDVPPDEFSGWDE 747          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|O76360|EGL4_CAEEL (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 322/679 (47.42%), Postives = 448/679 (65.98%), Query Frame = 2
Query:  938 IEELQREINKLTSVLDQTQISLE----------------SNDM----ISSVNSIQNRSKKQGVSGE-SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQV--IRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXX---XXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            +  LQRE +KL SVL+Q   S                   ND+    +   + +Q R+KK  VS E +N +     L  Y K+   K ++R+++ KN  L  L   Q+ E++  MYE +   G +VI EGE GD L+V   G+ +V +   LL  +      GELA+LYNC RTASV+ALTD +LWVLDR VFQ I  R G++R  +L+ FL  V + + L E +++K+ ++++   ++ G  IIRQGE  D FF+I SG VKVTQ+ +GE +   IR L  G++FGE+ALL  E RTAN+ A +   +VL L R+ F +LIGDL  LK K+Y D++ L        S V I +D   E+   V LK+++ + TLGVGGFGRVELV ++ D   T+ALK +KK HIV T+QQ+H+ +E+ I++E  + +I +LY TF+D KFVYML+EVCLGGELWT LRD+ HFDD   +F + CVLE  +YLH + I+YRDLKPEN L+  +GYLKL DFGFAK++  G++TWTFCGTPEYVSPEIILNK HD  +DYW++GI   EL+ G PPF  +DPMK YTLILKG++A +I  NRRI   A++ ++ LC+ N  ERLG+G+GG+ +I+ H++F GFDWE +R + L  P  PKV++  D +NFD++  ++++PPDE+SGWDE
Sbjct:  104 VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQ-RAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLK-KDYGDKERLAQVVREPPSPVKIVDDFR-EEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEI-PNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDE 778          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q13976|KGP1_HUMAN (cGMP-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PRKG1 PE=1 SV=3)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 326/674 (48.37%), Postives = 436/674 (64.69%), Query Frame = 2
Query:  893 QLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            ++K  ++ L+EK   I+EL+R+++K  SVL            + S +     ++ QG+S E    ++         K+ KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK L + KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  L+KL ++LE   +E GE IIRQG   D FFII  G+V VT+     E  +  RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   18 RIKELEKRLSEKEEEIQELKRKLHKCQSVLP-----------VPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWD 668          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|P00516|KGP1_BOVIN (cGMP-dependent protein kinase 1 OS=Bos taurus OX=9913 GN=PRKG1 PE=1 SV=2)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 326/674 (48.37%), Postives = 435/674 (64.54%), Query Frame = 2
Query:  893 QLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQT----NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            ++K  ++ L+EK   I+EL+R+++K  SVL            + S +     ++ QG+S E    ++         K+ KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK L + KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  + LPE  L+KL ++LE   +E GE IIRQG   D FFII  G V VT+     E  +  RTL  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ NK YED +      +               N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK+I+    S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++I   A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V S TD SNFD F +D DE PPD+ SGWD
Sbjct:   18 RIKELEKRLSEKEEEIQELKRKLHKCQSVLP-----------VPSTHIGPRTTRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAF---------FANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWD 668          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q13237|KGP2_HUMAN (cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2 PE=1 SV=1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 344/766 (44.91%), Postives = 475/766 (62.01%), Query Frame = 2
Query:  773 AMGPYHSKHIES--------CFKHK--EISSVLRPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREI-------NKLTSVL----------DQTQISLESNDMISSVNSIQNR-SKKQGVSGESNKDQTNL--------KLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELK--------NKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVK-----------LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++ P HSKH +           ++K  E+   LR    EI E E       LK  +E+L+++ + I EL  E+       NKL  V+             ++ LE +   S + S+ +R   K GVS E      +L        +  + +K +S K L+ +++ KN  L  L   Q+ +M+E MY R   +G Y+I +GE G+H++V   G  EV++ E+LL  +     FGELA+LYNC RTASVKA+T+ K W LDREVFQ IM RT   R E+   FL+SV LLK LPE KL K+++ LE++ +++G+ IIR+GE    FFI+  G VKVTQ  +G  + Q+I+TL  GEYFGEKAL+S + R+AN+ A  +    L + R+ F + +G   EL+        N N +DEK    +S S   +     +E ++ +K            ++LE++ TLGVGGFGRVELV++ +++ + +A+KC++K HIV TKQQ+HV SEK+IL E  S FI +LY TFKD K+VYML+E CLGGELW+ LRD+  FD+  +KFC+ CV EAFDYLH  GIIYRDLKPENL++   GYLKL DFGFAK+IG G++TWTFCGTPEYV+PE+ILNK HDF+ D+WS+GIL YELLTG PPF+G D M  Y LILKGIE  D    R+IT R    I+ LC+ N  ERLGN   G+ +IK H++  GF+WE ++ + L SP   ++    DHS FD +  E  +PPDE SGWD++
Sbjct:    5 SVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREY-----HLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLE-MIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVA-FAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDF--PRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKD 761          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A1S3HLV4 (cGMP-dependent protein kinase OS=Lingula unguis OX=7574 GN=LOC106156342 PE=3 SV=1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 365/693 (52.67%), Postives = 482/693 (69.55%), Query Frame = 2
Query:  857 EIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSV--NSIQ----NRSKKQGVSGES-NKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDA--EMEK-LVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            E Y+ ++E+L   L   + +       +++L+REI+KL SVL+ T       D+++++  +S+      R KKQGVSGES N  ++++ L  + K    K L++++IL N  L NL   Q+ E+I+ MYER   +G ++I EGE G HL+V+  G+  V K  R L  +   R FGELA+LYNC RTASVKAL+DA+LWVLDR VFQAIMM+TG+QRQ E ++FL+SV LLK LP  KL K+  +LE+    EGECIIR+GE+ D FFII  G V+V Q+  G  + Q IR L  G+YFGEKALLS + RTA+V A +   + L + R+ F +LIGDLNEL+ K+Y DE     ++S      +    +ME+ L NV L  LE++ TLG+GGFGRVEL++LS D   TYALKC+KK HIV+T+QQ+H+ SEKKI++  RS FI RLY TFKD K+VYMLME CLGGELWT LRD+ HFD++  +FC+ CV+EAFDYLHS+GIIYRDLKPENLL+ T GY+KL DFGFAKR+G G +TWTFCGTPEYV+PEIILNK HD   DYWS+GIL YELLTG+PPF+ +DPMK Y +ILKGI+  +    + I   A + I+ LC+ N AERLG    G+ +IK HK+FQGFDW  + +Q L  P  P+V   TD SNFD++  + ++P DE SGWD +
Sbjct:   65 EQYQYQVEDLTKSLAFKEND-------VQKLEREIDKLRSVLELTVHKDGKPDILATIQEDSVMVGQATRGKKQGVSGESTNFSRSSVALKHFDKDFRSKQLIKDAILDNDFLKNLDKAQLREVIDCMYERTTQKGQFIITEGEAGQHLFVSAEGELNVLKDGRSLGTMTAGRAFGELAILYNCTRTASVKALSDARLWVLDRSVFQAIMMKTGLQRQAENIKFLRSVSLLKRLPSEKLAKIASVLEMDFFHEGECIIREGEAGDTFFIINKGEVEVQQKLKGFSDPQKIRNLKRGDYFGEKALLSEDYRTASVVAKAPGVECLTIDRESFTQLIGDLNELREKDYGDEARNAQRASESDIPASPGRQKMERELANVGLHQLEVLATLGLGGFGRVELIQLSTDRTKTYALKCLKKKHIVETRQQEHIYSEKKIMMNARSNFIARLYRTFKDNKYVYMLMEACLGGELWTILRDRGHFDEVTARFCVACVIEAFDYLHSKGIIYRDLKPENLLLDTKGYVKLVDFGFAKRVGHGSKTWTFCGTPEYVAPEIILNKGHDHAVDYWSLGILMYELLTGSPPFSTSDPMKTYNIILKGIDVVEF--TQHIRKNAQNLIKKLCRDNPAERLGYQKNGIADIKKHKWFQGFDWHGLHRQILTPPIQPRVRGPTDFSNFDNYPKDKDIPQDELSGWDND 748          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: V3Z912 (cGMP-dependent protein kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127769 PE=3 SV=1)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 363/705 (51.49%), Postives = 493/705 (69.93%), Query Frame = 2
Query:  824 EISSVLRPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQN-------RSKKQGVSGESNKDQT-NLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEE--QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICN---DAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            E+ S L+    +I ++EIE+     +   +++NE N  I  L+ E++KL SVL          D+++++   +        RSKKQGVSGES+ +   N++L  + K    K L++++IL N  L NL + QV E+++ MY+++I  G Y+I EGE G+HLYV+  G+ EV K   +L  +   R FGELA+LYNC RTASVKALT+ ++WVLDR +FQAIMM+TGIQR++E +R+L+SVPLL+ LP  KL KL ++LE+  + EGE IIR+G + D FFI+  G VKVTQR  G    Q IR L  G+YFGEK+LLS + RTANV A     + L + R  F +LIGDLNEL+ K+Y DE    S+ S +++  +   D  +E+ VN+K+ DL++V TLG+GGFGRVELV+LS+D   TYALKC+KK HIV T+QQ+H+ SEK+I+L  R+ FI RL+ TF+D K+VYM+ME CLGGELWT LRD+  FDD  T+F + CV+EAF YLH +GIIYRDLKPENLL+   GY+KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD  +DYWS+GIL +ELLTG+PPF+G+DPMK Y +ILKGI+  +    R+I+  A + I+ LC+    ERLG G  G+ +IK HK+FQGFDWE +    +  P  PKV + TD+SNFD +  ++++P DE SGWD +
Sbjct:   28 EMKSELKDKDAKIRKLEIES-----RDKTKQINENNKEITRLKEEVHKLKSVLQLKVHKDGKPDILATIQETEPPVVVQEVRSKKQGVSGESSSNSQSNVELKHHDKDFRSKQLIKDAILDNDFLKNLDSTQVREIVDCMYDKKIKEGHYIIKEGESGNHLYVSADGEVEVQKEGTILGRMASGRAFGELAILYNCTRTASVKALTEVRVWVLDRAMFQAIMMKTGIQRRDENIRYLRSVPLLRDLPADKLAKLADVLEIDFYHEGEYIIREGATGDSFFILNKGEVKVTQRIQGHNNPQEIRKLKRGDYFGEKSLLSEDRRTANVIALPPGVECLTVDRDSFNQLIGDLNELRTKDYGDEARGASRLSGELTPGSRDKDRILEEFVNIKIDDLDVVATLGMGGFGRVELVQLSNDKMKTYALKCLKKKHIVDTRQQEHIYSEKQIMLTSRTPFIARLFKTFRDNKYVYMMMEACLGGELWTILRDRGSFDDKTTRFYVSCVVEAFKYLHHKGIIYRDLKPENLLLDNKGYIKLVDFGFAKKIGAGKKTWTFCGTPEYVAPEIILNKGHDHAADYWSLGILMFELLTGSPPFSGSDPMKTYNIILKGIDVIEF--PRKISRNAHALIKKLCRDAPVERLGYGKNGITDIKKHKWFQGFDWEGLLNHSITPPIIPKVKNPTDYSNFDSYPKDNDIPADETSGWDAD 725          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A5N4A4B0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_14115 PE=4 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 354/692 (51.16%), Postives = 487/692 (70.38%), Query Frame = 2
Query:  866 EMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSV---NSIQNR--------SKKQGVSGESNK---DQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWD 2893
            E+   NLH +L  +++E++ K  ++ +LQRE++KL SVL Q       +D+++S+   +++ NR        +KKQGVS ES+       ++ + K++K    K L++++I+ N  L +L + QV E+++ MY RQ + G YVI EG+ G HLYV+  GDFEV K +++L  +   + FGELA+LYNC RTAS++ +TD+K+WVLDR+VFQ IM+RTG+QR ++ + FL+SVPLL  L    L K+ ++LE++ +  G  I+RQG S D FFII SG+VK+TQR  G  +E+ IRTLT G+YFGE+ALL  E RTA+V A S   + L L R+ F++LIGDL+  K K+Y D++ +L + SS  S+C  AE ++   ++L DL+++ TLGVGGFGRVELV+ ++D   T+ALKC+KK HIV T+QQDH+ SEK I++ CRS FICRLY TF+D K+VYML+E CLGGE+WT LRD+  FDD  T+F   CV+EAFDYLH+RGIIYRDLKPENLL+   GY+KL DFGF+KR+G   +TWTFCGTPEYV+PE ILNK HD   DYW++GIL YELLTG+PPFT +DPMK Y LILKGI+  D F    ++  A S I+ LC+   +ERLG   GG+++IK HK+FQGFDW+ +R + L  P    V    D SNFD F  + ++PPDE S WD
Sbjct:  256 EVNYGNLHTKLLESRKEVHSKESQVIKLQREVHKLKSVLQQATCFSNESDILTSLQEQHAMANRVPPAAVTFNKKQGVSAESSDIIGPAGDIHVQKHEKDFRSKQLIKDAIMDNNFLKHLDSLQVREIVDSMYPRQCEAGSYVIREGDAGAHLYVSAEGDFEVIKDDKVLGRMGSGKAFGELAILYNCTRTASIRVVTDSKVWVLDRKVFQQIMVRTGLQRLQDNINFLRSVPLLANLSNDVLAKIADVLEVEFYPSGAYIVRQGASGDTFFIISSGNVKITQRISGGLDEEDIRTLTRGDYFGEQALLREECRTASVIAMSPGVECLTLDRESFIQLIGDLSVFKEKDYGDDQRMLMRPSSVASVC--AEKQEYDYMRLDDLDIIATLGVGGFGRVELVQYANDQSMTFALKCLKKQHIVDTQQQDHIFSEKMIMMCCRSPFICRLYRTFRDSKYVYMLLEACLGGEVWTILRDRACFDDHTTRFITACVIEAFDYLHNRGIIYRDLKPENLLLDNDGYVKLVDFGFSKRLGYSSKTWTFCGTPEYVAPETILNKGHDRAVDYWALGILMYELLTGSPPFTASDPMKTYNLILKGIDMID-FEKHNVSRSAQSLIKKLCRDLPSERLGYQRGGIQDIKKHKWFQGFDWDGLRARSLPVPITKLVRGPCDTSNFDCFDKDVDIPPDELSDWD 944          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: E0W2T9 (cGMP-dependent protein kinase, isozyme, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8236818 PE=4 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 360/709 (50.78%), Postives = 488/709 (68.83%), Query Frame = 2
Query:  827 ISSVLRPIGDEIYEME--IENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVN-------------SIQNRSKKQGVSGESNKDQTN---LKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWD 2893
            + +++  + +E  E E  I+ L  ++   ++EL +K+    +L REI+KL SVL   ++     D++SS+              +I N +KKQGVSGES+    N   +++ +++K    K L++++IL+N  L NL T QV E++E +Y ++  +G YV+ EGE G HLYV+  G+ EV K + +L  +   + FGELA+LYNCRRTAS+K ++DAK+WVLDR+VFQ IMM+TG+QR +E L FL+SVPLL+ L    L K+ ++LE+  +  GE IIRQG + D FFII SGSVKVTQ   G  EE+ IR L  G+YFGE+ALL  + RTANV A S   +VL L R+ F++LIGDL+EL+ K+Y DE    +K SS  S+ +  E E    ++L+DL+++ TLGVGGFGRVELV+ S +    +ALKC+KK HIV+T+QQ+HV SEK I++ C S FICRLY TFKD K+VYML E  LGGE+WT LR+K  FDD  TKF   CV+EAF+YLH+RGI+YRDLKPENLL+ + GY KL DFGF+KRIG   +TWTFCGTPEY++PEIILNK HD   DYWS+GIL +ELLTG PPF   DPM+ Y +ILKGI+  D    + IT  A S I+ LC+ + +ERLG   GG+++IK HK+FQGFDW  ++++ L+ P  P V S TD SNFD +  E  +PPDE+S WD
Sbjct:  339 LRTIVASLSNETNEQEEKIDFLQTEIFYLRKELKKKDRENVKLHREIHKLKSVLQDARVFKREGDLLSSLQESHGMPGQFQQVINIPNPNKKQGVSGESSDHGQNHHQIEIQRFEKDFRSKQLIKDAILENNFLKNLDTVQVREIVESVYPKKFSKGDYVVREGEAGSHLYVSAEGELEVIKDQNVLGRMGPGKAFGELAILYNCRRTASIKVVSDAKVWVLDRQVFQKIMMKTGLQRLQENLNFLRSVPLLQSLNNEVLAKIADVLEVDFYPSGEHIIRQGATGDTFFIISSGSVKVTQEKPGKDEEEEIRILNKGDYFGEQALLKEDCRTANVIALSPGVEVLTLDRESFIQLIGDLSELQEKDYGDESRNFAKFSSCSSLTDKQEFE---YIRLQDLDIITTLGVGGFGRVELVQYSKNKSMAFALKCLKKQHIVETRQQEHVYSEKNIMMACNSPFICRLYRTFKDSKYVYMLQEALLGGEVWTILREKGCFDDYTTKFITACVIEAFEYLHTRGIVYRDLKPENLLLDSIGYTKLVDFGFSKRIGFSSKTWTFCGTPEYLAPEIILNKGHDRAVDYWSLGILMHELLTGIPPFAAPDPMRTYNIILKGIDVIDF--PKHITKGAQSLIKRLCRDSPSERLGYQRGGIQDIKKHKWFQGFDWSGLKQRALIPPVAPIVRSPTDTSNFDSYSKETVVPPDEFSCWD 1042          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: D7EJR5 (Uncharacterized protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC006940 PE=4 SV=1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 357/715 (49.93%), Postives = 493/715 (68.95%), Query Frame = 2
Query:  827 ISSVLRPIGDEIYEMEIE--NLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSV---NSIQNRS-------------KKQGVSGESNKD---QTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG---EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            + +++  +  ++ E+E++  +L ++L  T+ +L  K   + +LQREI+KL SVL QT   ++  D+++S+   +++ NR+             KKQGVS ES++     +++ + K+ K    K L++++I+ N  L NL T QV E+++ MY ++  +G YVI EGE G HL+V+  GDFEV K +++L ++   + FGELA+LYNC RTAS++ + D+K+WVLDR+VFQ IM+RTG+QR ++ + FL+SVPLL+ L    L K+ ++LE++ +  G  IIRQG + D FFII SGSVKVTQR  G   +E+ IR L  G+YFGE+ALL  + RTAN+ A +   + L L R+ F +LIGDL+E+K KNY DE+ L  + +S    C  AE  +   + L DLE++ TLG+GGFGRVELV+  H+   T+ALKC+KK HIV T+QQDH+ SE+ I++ CRS FICR+Y TFKD K+VYML+E CLGGE+WT LRD+  FD+  TKF  GCVLEAFDYLHSRGIIYRDLKPENLL+  +GY+KL DFGF+KR+G   +TWTFCGTPEYV+PE ILNK HD   DYW++GIL +ELLTG PPFT +DPMK Y LILKGI+  D F    I   A S I+ LC+   +ERLG   GG+++IK HK+FQGFDW+ +  Q L SP    V    D +NFD F  ++++PPDE S WD E
Sbjct:  239 LKTIVARLKKDLAELEVKYGSLQSELYETRRQLTCKESEVLKLQREIHKLKSVLQQTTTFIQDGDILTSLQEKHAMANRAPQSQQSLTNSCVLKKQGVSAESSESTGQASDITIPKHDKDFRSKQLIKDAIMDNNFLQNLDTSQVREIVDCMYLKEYPQGSYVIKEGEAGAHLFVSAEGDFEVMKEDKVLGHMGPGKAFGELAILYNCTRTASIRVVVDSKVWVLDRKVFQQIMVRTGLQRLQDNINFLRSVPLLQNLSNEVLAKIADVLEVEFYPAGVYIIRQGANGDTFFIISSGSVKVTQRKQGSMEDEEEIRILQRGDYFGEQALLKEDCRTANIIAMNPGVECLTLDRESFKQLIGDLSEIKEKNYGDEQRLNRQINST---C--AENSEYDYISLDDLEVIATLGIGGFGRVELVQYVHNPSLTFALKCLKKQHIVDTQQQDHIFSERNIMMSCRSSFICRMYKTFKDSKYVYMLLEACLGGEVWTILRDRGCFDEDTTKFITGCVLEAFDYLHSRGIIYRDLKPENLLLDANGYVKLVDFGFSKRLGYSSKTWTFCGTPEYVAPETILNKGHDRAVDYWALGILMHELLTGNPPFTASDPMKTYNLILKGIDMID-FAKHHIGRAAQSLIKKLCRDAPSERLGYQKGGIQDIKKHKWFQGFDWDGLVNQTLPSPIRQPVRGCCDTTNFDCFGKDNDIPPDELSNWDLE 947          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 328/680 (48.24%), Postives = 437/680 (64.26%), Query Frame = 2
Query:  878 ENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGE-----SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVI--RTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            E+L   L L +E + E  +R+ E + EI +L   L + Q  L S  ++          + QG+S E     S +  T+  L K+ KS+  K L++E+IL N  + NL   Q+ E+            C +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+V+ LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP  +GL E  L+KL ++LE   +++GE IIRQG   D FFII  G V VT+     +  +  R L  G++FGEKAL   + RTANV A  +VT  L + R  F  LIG L+++ +K YED                +AE     N+KL D  ++ TLGVGGFGRVELV+L  +   T+A+K +KK HIV T+QQ+H+ SEK I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A++ I+ LC+ N +ERLGN   G+++I+ HK+F+GF+WE +RK  L  P  P V+S TD SNFD F +D ++ PPD+ SGWD
Sbjct:    6 EDLARLLLLKEERIREMELRLAEKEEEIAELKRKLHKCQSVLPSAPLMGP-----RTRRAQGISAEPQPFTSFQQLTSEALRKHAKSDRSKELIKEAILDNDFMKNLELSQIQEI----------ESC-IIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLAEEILSKLADVLEETHYDDGEYIIRQGARGDTFFIISKGKVNVTREDSPSDTPVYLRALGKGDWFGEKALQGEDIRTANVIAADAVT-CLVIDRDSFKHLIGGLDDVSSKGYEDAGAKAKY---------EAENAFFSNLKLADFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKHIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPDVSSPTDTSNFDSFPEDSEDPPPDDNSGWD 657          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 317/739 (42.90%), Postives = 463/739 (62.65%), Query Frame = 2
Query:  851 GDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESN-----------------DMISSVNSIQ---------------NRSKKQGVSGESNK---DQTNLKLIKYK-----KSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRY-DGEE-QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKN--KNY------EDEKHXXXXXXXXXXICNDAEMEKL--------VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWD 2893
            G +I  M++E L  QLK   EELN + ++I++L+ ++ +    +     +L +                  +++SS    +                +  K GVS E +    D +++    ++     K  S+K LL +++ KN  L  L   Q+ +M+E MYER   +G +VI +GE G+HL+V   G+ +V++  +LL  +     FGELA+LYNC RTASVKA +  + WVLDREVF  IM  T   R E+   FL+SV LL  LPE KL K+V+ LE++ +++G+ +IR+GE  + F+II  G VKVTQ   D EE QVI TL  G+YFGEKAL+S + R+AN+ A+    + L + R+ F + +G  +ELK   + Y      +D+K    +S S     +   ++++          +   +LE++ TLG+GGFGRVELV++ +++  T+ALKC+KK HIV  +Q++H+ SE++IL E  S FI ++Y TFKD K+VYML+E CLGGE+W+ LRD+  F++   KFC+GCV EAF+YLH++ IIYRDLKPENL++ + GY+KL DFGFAK++  G++TWTFCGTPEYV+PEIILNK H  + D+W++GIL +ELLTG+PPFTG+D M  YT ILKG+E  D    ++I+ R    I+ LCK N +ERLGN   G+ +IK H++F GF W  ++ + L SP   +V   TDHS FD++  EDE+PPDE SGWD
Sbjct:   29 GPQILRMKVEELEAQLKKKDEELNAQQLQIKQLEDQLAQQNQAIADISDALRNKCFQLTKLQEALKNQGDLELLSSPTKTKFSQRLSGLLRETLNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKVKNEN-VTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDF--PKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWD 764          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 327/735 (44.49%), Postives = 457/735 (62.18%), Query Frame = 2
Query:  857 EIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDM--------------ISSVNSIQNR------------SKKQGVSGESNK---------DQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYE--------DEKHXXXXXXXXXXICNDAEMEKLVNVK---------LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            E  ++ I  L  +L    +EL  + ++++ LQRE+      +D+ Q ++  N++              +S +N    R              K+GVS E               +++  + +K + IK L+ E+I+ N  L  L      EM++ MYE+       VI EGE G++LYV   G  EV +  +LL  +     FGELA+LYNC+RTA+VKA+T + +W LDR+ FQ+IMMR+   R EE   FL+SV LLK LPE KL K+V+ LE+   ++GE IIR+GE  + FFII  G V VTQ  +G  E   I+ L +G+YFGEKAL+S + R+AN+ A  + T  L + R  F +++G   EL+    E        DE+ + +  S        A   + ++ K         L+ L+++ TLG+GGFGRVELV+L ++  + +ALKC+KK HIV T+QQ+H+ SEK IL +    FI RL+ TF+D K+VYML+EVCLGGELW+ LRD   F++   +FC+GCVLEAFDYLH  GI+YRDLKPENLL+   GY+K+ DFGFAKRIG+GK+TWTFCGTPEYV+PE+I+NK HDF +D WS+GIL +ELL G+PPF+G+DP+KIYT++L GIE  DI   +RI+ R    I+ LCK N AERLGN   G+ +IK HK+FQGF+WE +R++ L SP   ++    DHS+FD F  E E PPDE SGWD++
Sbjct:   38 EHLKLRIARLEEELARRDQELRAQELQLQTLQRELEAKVLQIDKLQDAIGYNNLGRSPPAPARPSHRLLSVINQGSTRFHRVAVEVHRRLKAKEGVSAEPTSGHFCKEHRTQHVSIERTRIRKDSGIKKLINEAIMNNDFLKKLEPQHTREMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEGLLEVIQNGKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQSTEGYSEPLEIKILGVGDYFGEKALISEDVRSANIIAKENDTQCLVVDRDNFNQMVGTYEELQAYLREYVEQLSINDERRIAATQSPLYERSPQAAELRSLHEKAARLSSCSFLQQLQIIATLGMGGFGRVELVKLKNE-DTAFALKCIKKKHIVDTRQQEHIYSEKNILQQTNCNFIVRLFRTFRDEKYVYMLLEVCLGGELWSVLRDMSFFEEATARFCIGCVLEAFDYLHGMGIVYRDLKPENLLLDAEGYVKMTDFGFAKRIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGSPPFSGSDPIKIYTMVLHGIEKVDI--PKRISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWFQGFNWEGLRRRKLASPLRRELNGPLDHSHFDMFPPELEEPPDELSGWDKD 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 306/723 (42.32%), Postives = 438/723 (60.58%), Query Frame = 2
Query:  851 GDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESN-----------------DMISSVNSIQ---------------NRSKKQGVSGESNK---DQTNLKLIKYK-----KSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRY-DGEE-QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWD 2893
            G +I  M++E L  QLK   EELN + ++I++L+ ++ +    +     +L +                  +++SS    +                +  K GVS E +    D +++    ++     K  S+K LL +++ KN  L  L   Q+ +M+E MYER   +G +VI +GE G+HL+V   G+ +V++  +LL  +     FGELA+LYNC RTASVKA +  + WVLDREVF  IM  T   R E+   FL+SV LL  LPE KL K+V+ LE++ +++G+ +IR+GE  + F+II  G VKVTQ   D EE QVI TL  G+YFGEKAL+S + R+AN+ A+    + L + R+ F + +G  +ELK                +  +   A  +K  N K   L  VC+  V             +   T+ALKC+KK HIV  +Q++H+ SE++IL E  S FI ++Y TFKD K+VYML+E CLGGE+W+ LRD+  F++   KFC+GCV EAF+YLH++ IIYRDLKPENL++ + GY+KL DFGFAK++  G++TWTFCGTPEYV+PEIILNK H  + D+W++GIL +ELLTG+PPFTG+D M  YT ILKG+E  D    ++I+ R    I+ LCK N +ERLGN   G+ +IK H++F GF W  ++ + L SP   +V   TDHS FD++  EDE+PPDE SGWD
Sbjct:   29 GPQILRMKVEELEAQLKKKDEELNAQQLQIKQLEDQLAQQNQAIADISDALRNKCFQLTKLQEALKNQGDLELLSSPTKTKFSQRLSGLLRETLNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKK-------------YLQGYVETLARDDKKRNAKWF-LIAVCSSQVK----------VKNENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDF--PKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWD 725          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 308/739 (41.68%), Postives = 445/739 (60.22%), Query Frame = 2
Query:  851 GDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESN-----------------DMISSVNSIQ---------------NRSKKQGVSGESNK---DQTNLKLIKYK-----KSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRY-DGEE-QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKN--KNY------EDEKHXXXXXXXXXXICNDAEMEKL--------VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWD 2893
            G +I  M++E L  QLK   EELN + ++I++L+ ++ +    +     +L +                  +++SS    +                +  K GVS E +    D +++    ++     K  S+K LL +++ KN  L  L   Q+ +M+E MYER   +G +VI +GE G+HL+V   G+ +V++  +LL  +     FGELA+LYNC RTASVKA +  + WVLDREVF  IM  T   R E+   FL+SV LL  LPE KL K+V+ LE+                          VKVTQ   D EE QVI TL  G+YFGEKAL+S + R+AN+ A+    + L + R+ F + +G  +ELK   + Y      +D+K    +S S     +   ++++          +   +LE++ TLG+GGFGRVELV++ +++  T+ALKC+KK HIV  +Q++H+ SE++IL E  S FI ++Y TFKD K+VYML+E CLGGE+W+ LRD+  F++   KFC+GCV EAF+YLH++ IIYRDLKPENL++ + GY+KL DFGFAK++  G++TWTFCGTPEYV+PEIILNK H  + D+W++GIL +ELLTG+PPFTG+D M  YT ILKG+E  D    ++I+ R    I+ LCK N +ERLGN   G+ +IK H++F GF W  ++ + L SP   +V   TDHS FD++  EDE+PPDE SGWD
Sbjct:   29 GPQILRMKVEELEAQLKKKDEELNAQQLQIKQLEDQLAQQNQAIADISDALRNKCFQLTKLQEALKNQGDLELLSSPTKTKFSQRLSGLLRETLNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEV--------------------------VKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKVKNEN-VTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDF--PKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWD 738          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 377.481 bits (968), Expect = 5.641e-123
Identity = 170/312 (54.49%), Postives = 228/312 (73.08%), Query Frame = 2
Query: 1964 LELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++++ TLGVGGFGRV+LV+L  D   T+ALKC+KK  +V+++QQ+HV SEK+IL EC   FI R Y TF+D KFV++LME CLGGELW+ LRD   F ++  +FC+ CV+EA  YLH+RGI+YRDLKPENLL+   GY+K+ DFGFAK++  G++ WTFCGTPEYV PE+I+N+ HD  +D W++G+L YELL G PPF+G DPMK Y  IL G+E    F N  +  RA   I+ LC+ N +ERLGN   G+ +++ HK+FQGFDWES+R   L SP   +V+  TD  NFD F ++ ++PPDE SGWD +
Sbjct:   34 MDVIATLGVGGFGRVQLVKLK-DSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVH-FPN-EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHD 342          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002201.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 314.694 bits (805), Expect = 3.347e-100
Identity = 152/309 (49.19%), Postives = 203/309 (65.70%), Query Frame = 2
Query: 1973 VCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            + TLGVGGFGRV+LV+L  D   T+ALKC+KK  +V+++QQ+HV SEK+IL EC   FI R                   GG           F ++  +FC+ CV+EA  YLH+RGI+YRDLKPENLL+   GY+K+ DFGFAK++  G++ WTFCGTPEYV PE+I+N+ HD  +D W++G+L YELL G PPF+G DPMK Y  IL G+E    F N  +  RA   I+ LC+ N +ERLGN   G+ +++ HK+FQGFDWES+R   L SP   +V+  TD  NFD F ++ ++PPDE SGWD +
Sbjct:    1 IATLGVGGFGRVQLVKLK-DSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVR-------------------GG-----------FQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVH-FPN-EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHD 276          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.328 bits (573), Expect = 4.949e-67
Identity = 109/271 (40.22%), Postives = 170/271 (62.73%), Query Frame = 2
Query: 2048 ALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDED 2860
            +LK  K+  +V+ KQ +H ++EK+IL      F+ RL  +FKD   +YM++E   GGE+++ LR    F +  ++F    ++ AF+YLHS  +IYRDLKPENLLI   GY+++ DFGFAKR  +  RTWT CGTPEY++PEIIL+K ++   D+W++G+L YE+  G PPF  + P++IY  I+ G     +      +      ++ L + +  +R GN   G+ +IK+HK+F   DW +I ++ + +PF PK     D SNFDD+++E+
Sbjct:    8 SLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKR--VKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG----KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEEE 272          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.185 bits (461), Expect = 4.214e-50
Identity = 109/316 (34.49%), Postives = 171/316 (54.11%), Query Frame = 2
Query: 1919 NDAEMEKL-----VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLE-CRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKR-IGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRAS-SFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFD 2842
            NDA+   L     +  K  D + +  LG G FG+V L +   D    YA+K MKK  I+Q K++ H+++E+ +L++  R  F+  L+ +F+    +Y +M+   GGEL+  L+ +  F +   +F    +  A  YLHS  I+YRDLKPEN+L+   G++ L DFG  K  I     T TFCGTPEY++PE++    +D T D+W +G + YE+L G PPF   +  ++Y  IL           R  T  A+ S ++ L   +  +RLG     + EIK+H +F   +W  +  + + SP++P V+   D  NFD
Sbjct:   72 NDADHINLGPSANLQAKPSDFDFLTVLGKGSFGKVLLAKHKSD-GIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILH-----QPLQLRPCTTNAAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 4.886e-50
Identity = 107/316 (33.86%), Postives = 169/316 (53.48%), Query Frame = 2
Query: 1949 VKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHS-RGIIYRDLKPENLLITTSGYLKLCDFGFAKR-IGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDD---FQDEDELPPDEY 2881
            V + + + +  LG G FG+V LVR     Q  YA+K +KK  IV   +  H ++E ++L   +  F+  L  +F+    +  +ME   GGEL+  L  +  F +  T+F    ++ A DYLH+ + ++YRDLK ENL++   G++K+ DFG  K  I  G    TFCGTPEY++PE++ +  +    D+W +G++ YE++ G  PF   D  K++ LIL      DI   R ++  A + +  L K +  +RLG G    +EI  H +F G  W+ +  + +  PF P+V S TD   FD+    Q     PPD +
Sbjct:  145 VTMNNFDYLKLLGKGTFGKVILVREKATGQY-YAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL----MEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDRF 455          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 237.654 bits (605), Expect = 2.003e-70
Identity = 118/303 (38.94%), Postives = 182/303 (60.07%), Query Frame = 2
Query: 1955 LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKG-IEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSST-DHSNFDDFQDE 2857
            L D +++ TLG G FGRV LVR  H+ +  YA+K +KK  +V+ KQ +H   E+++L      F+ R++ TF+D + ++M+M+   GGEL++ LR    F + + KF    V+ A +YLH+  IIYRDLKPEN+L+  +G++K+ DFGFAK +     TWT CGTP+Y++PE+I  K ++ + D+WS+G+L YE+L G  PF    PMK Y  IL+G +     FH   +       +  L   +   R+GN   G  +IK+H +F    WE +  +D+ +P+ P +TS   D S FD + +E
Sbjct:   67 LHDFQIMRTLGTGSFGRVHLVRSVHNGRY-YAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT--VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVV-----DLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 229.95 bits (585), Expect = 1.775e-67
Identity = 118/304 (38.82%), Postives = 185/304 (60.86%), Query Frame = 2
Query: 1955 LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKG-IEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSST-DHSNFDDFQDED 2860
            L D +++ TLG G FGRV L+R +H+ +  YALK +KK+ IV+ KQ +H   E+++L      FI R++ TF+D + V+M+M+   GGEL++ LR    F + + KF    V  A +YLHS+ IIYRDLKPEN+L+  +G++K+ DFGFAK   +   T+T CGTP+Y++PE++  K ++ + D+WS G+L YE+L G  PF  ++ MK Y  IL   ++    FH       A   ++ L   + +ERLGN   G E++K+H +F    WE +  + + +P+ P +     D S FD + +E+
Sbjct:   85 LSDFQILRTLGTGSFGRVHLIRSNHNGR-FYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY--VPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHP-----DAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEE 380          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 227.254 bits (578), Expect = 1.494e-66
Identity = 115/303 (37.95%), Postives = 182/303 (60.07%), Query Frame = 2
Query: 1955 LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSST-DHSNFDDFQDED 2860
            L+D +++ TLG G FGRV L+R  H+ +  YA+K +KK  +V+ KQ +H   E+ +L      FI R++ TF+D + ++M+M+   GGEL++ LR    F + + KF    V  A +YLHS+ IIYRDLKPEN+L+  +G++K+ DFGFAK   +   T+T CGTP+Y++PE++  K ++ + D+WS GIL YE+L G  PF  ++ MK Y  IL        F N  +       +  L   + ++RLGN   G E++K+H +F+   WE +  +++ +P+ P +     D S FD + +ED
Sbjct:   84 LQDFQILRTLGTGSFGRVHLIRSRHNGR-YYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY--VPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDV----KDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEED 379          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 189.119 bits (479), Expect = 1.121e-50
Identity = 107/302 (35.43%), Postives = 168/302 (55.63%), Query Frame = 2
Query: 1949 VKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAK-RIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILK-GIEATDIFHNRRITFRASSFIQALCKFNAAERLG-NGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDD 2845
            + + D +L+  +G G FG+V  VR   D Q  YALK ++K +IV   +  H ++E+ +L      FI  L  +F+  + +Y ++    GGEL+  L+ +  FD    +F    +L A D LH   ++YRDLKPEN+L+   G++ LCDFG  K  +    +T TFCGTPEY++PE++L   +    D+W++G+L YE+LTG PP+   D  K+Y  IL+  +   D F        A   +  L   +   RLG NGA   +EI++H +F    W+ +  +  + P+ P V++S D SNFD+
Sbjct:  342 LSIDDFDLLKVIGKGSFGKVMQVR-KKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDR-----DAKDLLIGLLSRDPTRRLGYNGA---DEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDE 634          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 186.037 bits (471), Expect = 9.074e-50
Identity = 105/311 (33.76%), Postives = 170/311 (54.66%), Query Frame = 2
Query: 1913 ICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAK-RIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFD 2842
            I  D +  K   + + D +L+  +G G FG+V  VR   D Q  YALK ++K +IV   +  H ++E+ +L      FI  L  +F+  + +Y+++    GGEL+  L+ +  F    ++F +  +L A D LH   +IYRDLKPEN+L+   G++ LCDFG  K  +    +T TFCGTPEY++PEI+L + +  T D+W++GIL YE++TG PP+   +   +Y  IL+      +         A   +  L   + + RL  G  G +EI++H +F+   W+ +  +  + P+ P V S  D +NFD
Sbjct:  327 ITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ----QPLLFPDGFDPAAKDLLIGLLSRDPSRRL--GVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFD 630          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 330/670 (49.25%), Postives = 456/670 (68.06%), Query Frame = 2
Query:  908 QEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQ----TNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYD--GEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            ++EL  K+  I  L+ E++K  SVL     +             + R+++QG+S E    +    ++  L ++ K++  K L++E+IL N  L NL   QV E++E M ER   R  Y+I E E G HLYV E G  +V K   +L ++   + FGELA+LYNC RTASV+A T  KLW +DR+ FQ IMM+TG+ R  E + FL+SV LLK L E  L K+ +++E   +EEGE IIRQG   D FFII+SG+V +TQR +   +   +R L+ G YFGEKAL   + RTAN  A       L L R+ F++ IG+L++++   Y+D +  +   ++       A+ ++  NV+L+DL +V TLG+GGFGRVELV+++ D + T+ALK +KK+HIV+T+QQDH++SEKKI++E  S FI RL+ TFKD K++YML+EVCLGGELWT LRD+  FDD  T+F +GCV+EAF YLHS+GI+YRDLKPENLL+   GY KL DFGFAK+IG G++TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL YELLTG+PPF+G DPMK Y +ILKGI+  D    R+IT  A + I+ LC+ N  ERLG   GGL++I  HK+F GF+W+ +R + L SP  PK+ S  D SNFDD+  +D++PPD+ +GWD++
Sbjct:    4 EQELRRKDELIRRLESELDKYRSVLQPPASA-------GPGGRSRARNQRQGISAEPQSAKQVADSSKPLQRHPKNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRNLSKGAYFGEKALKGEDLRTANCIAGKGGVTCLVLDREAFVQFIGNLDDIQRDQYDDSQRGVDPQTASHL---RAQQDEFANVRLEDLTVVKTLGIGGFGRVELVQVAGD-KRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDF--PRKITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKIKSPVDASNFDDYPADDDIPPDDMTGWDKD 660          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 313/645 (48.53%), Postives = 422/645 (65.43%), Query Frame = 2
Query: 1046 RSKKQGVSGESN-----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGE--EQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKY-FQGFDWESIRKQDL------------------VSPFH--PKVTSSTDHSNFDDFQDEDELPPDEYSGWDE 2896
            + K+Q VSGES+     + +T  +L ++ K    K L++++I +N  L NL   QV E+++ MY     R   +I EG+ G+ LY    G  +V +  ++L  +     FGELA+LYNCRRTA+V A+   KLW +DR VFQ IMMRTG+ RQ E + FLKSVPLLK LP  +L+KL ++LE+  +  G+ IIR+ E  D F+II  GS +VTQR +G+   + IR L  G+YFGEKALLS + RTANV A  +  + L + R  F+ +IG+++EL+ K+Y DEK    ++            E   ++ L+DLE+V TLG GGFGRVELV        TYALKC+KK HI+ T+QQ+HV SEK+IL+E  S FIC++Y TFKD K+VYML+E CLGGELWT LRD+  F+D   +FC+ CV+E F+YLHS+GI+YRDLKPENLL+   GY+KL DFGFAK+IG G++TWTFCGTPEYV+PEIILNK HD +SDYWS+GIL +ELLTG+PPF+ +DPMK Y +IL+G++  +    +RI     + I+ LCK N  ERLG    GL +IK HKY    F      ++D                    SP +   +V SSTD+SNFD +  + ++PPDE SGWDE
Sbjct:   19 KEKRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGMVFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGDYFGEKALLSEDRRTANVIAEENGVECLVVDRTVFMTVIGNMDELREKDYGDEKRGAKRTLDVPEEERKVSKE-FADLTLEDLEVVATLGTGGFGRVELV--------TYALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEF--PKRIGRNPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKYVVPWFPLAGTHRRDPRTSNQTRFWLMTTTLSFKTSPIYLLIRVESSTDYSNFDVYSKDMDIPPDEMSGWDE 652          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 243.432 bits (620), Expect = 7.957e-73
Identity = 130/303 (42.90%), Postives = 178/303 (58.75%), Query Frame = 2
Query: 1955 LKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKG-IEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDED 2860
            L+D EL  TLG G FGRV L R        YALK M    +++ KQ +HV +EK IL+     FI  L  T  D  F+YML+E   GGEL+T LR    F++    F    ++ A DYLH   I+YRDLKPEN+L+   G++KL DFGFAK   +  +TWT CGTPEY++PEII +K H+   D+W++GIL YE+L G PPF  ++P  IY  IL G +E      N      A   I+ L   +   RLG+   G E++K+HK+F+  DW  + ++ L  P +PK++   D  NFDD+ +ED
Sbjct:   15 LQDFELSKTLGTGTFGRVLLAR-DRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKE--VHDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNT----SAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEED 310          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 211.075 bits (536), Expect = 2.490e-58
Identity = 117/311 (37.62%), Postives = 178/311 (57.23%), Query Frame = 2
Query: 1964 LELVCTLGVGGFGRVELVR--LSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFD-DF-----QDEDELPP 2872
             EL+  LG G FG+V LVR  +  D  + YA+K +KK   ++ + +   + E+ IL++ +  FI RL   F+    VY++++   GG+L+T L  +I F +   KF L  +  A D+LH  GIIYRDLKPEN+L+  SG++ L DFG +K     ++T++FCGT EY++PE++  + H   +D+WS G+L +E+LTG+ PF G D      +ILK       F    +T  A S ++ L K N   RLG G  G+E+IK H +F   +WE + K+++  PF P    + D   FD +F     QD   +PP
Sbjct:    9 FELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVLKK-ATLKVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKAKLGMPQF----LTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFDPEFTSKTPQDSPAVPP 314          

HSP 2 Score: 85.1149 bits (209), Expect = 5.728e-17
Identity = 54/168 (32.14%), Postives = 84/168 (50.00%), Query Frame = 2
Query: 2147 ICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLG---------CVLEAFDYLHSRGIIYRDLKPENLLIT----TSGYLKLCDFGFAKRI-GIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGI 2608
            I  L + ++  K VY++ME+  GGEL          D I+   CL           +     +LH  G+++RDLKP N++      T   L++ DFGFAK++        T C T  +V+PE++  + +D   D WS+G+L Y +L+G  PF    P    ++ILK I
Sbjct:  410 IVHLRDAYEAGKQVYIVMELMRGGEL---------LDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPFAVG-PEDTPSVILKRI 567          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 195.282 bits (495), Expect = 1.614e-54
Identity = 115/303 (37.95%), Postives = 170/303 (56.11%), Query Frame = 2
Query: 1949 VKLKDLELVCTLGVGGFGRVELVRLSHDH--QSTYALKCMKKYHIVQT-KQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCL-RDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKR-IGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFD 2842
            V  +  EL+  LG GG+G+V LV+ +H H  +  +A+K +KK  I+++ K   H  +E+ IL   +  FI  L   F+    +Y+++E   GGEL+  L R+ I  +D    F L  +  A ++LH +GI+YRDLKPEN+L+  +G++KL DFG  K  I     T TFCGT EY++PEI+    H    D+WS+G L Y++LTGTPPF  ++  K    ILKG     +     +T  A  FI+ L K +   RLG  AG    IK+H +F+   WE +  + +  PF P ++   D S FD
Sbjct:   60 VGPESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTAC-FYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKG----KLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFD 357          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 326/684 (47.66%), Postives = 440/684 (64.33%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR--YDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDF-QDEDELPPDEYSGWD 2893
            +IE L  +  L  E   EL++K+  I+ LQ E++K  SV+      +   + +      Q R+K+Q +S E      +D +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP    L E  L+KL ++LE   +  GE IIRQG   D FFII  G V VT+    +GE   +R+L  G++FGEKAL   + RTA+V A  +VT  L + R  F  LIG L ++ +K ++D                +AE     ++ L D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL +ELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A + I+ LC+ N  ERLGN   G+++I+ HK+F+GF+WE ++K  L  P  P VTS  D SNFD F +D ++ PPD+ SGWD
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNELHE----QQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKY---------EAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVTSPVDTSNFDSFPEDNEDPPPDDNSGWD 681          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 330/709 (46.54%), Postives = 452/709 (63.75%), Query Frame = 2
Query:  893 QLKLTQEELNEKNIRIEELQREINKLTSV-LDQTQISLESNDMISSVNS---------IQNRSK-KQGVSGESNKDQTNLKLIKYK-----------KSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKN--KNY------EDEKHXXXXXXXXXXICNDAEMEKL--------VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            QL+  Q+EL  K  +IE+LQ  I+   +V L  T +   S    S++N          +  R + K+GVS E      +  L +Y+           K++  K L+ E+IL N  L  L    + EM++ MYE+    G  VI EG+ G++LYV   G  EV +  +LL  +     FGELA+LYNC+RTA+VKA+  + +W L+R+ FQ IMM+T   R +E   FL+SV LLK LPE KL ++V+ LE++  E+GE IIR+GE  + FFII  G V VTQ  +G  + Q I+TL +G+YFGE+AL+S + R+AN+  N + T  L + R  F +++G   EL+   K Y       DE+      S +       E+ +L         N   ++LE++ TLG+GGFGRVELV+L  D +ST+ALKC+KK H+V T+QQ H+ SEKKIL +  S FI RL+ TF+D K++YML+EVCLGGELWT LRD   F++   +FC+GCVLEAFDYLHS GIIYRDLKPENLL+   GY+K+ DFGFAK+IGIG++TWTFCGTPEYV+PE+I+NK HDF +D WS+GIL +ELLTG PPF+G+DP+KIYT++L GI+  D    +RI  R    I+ LCK N  ER+GN   G+ +IK HK+FQGF+WE ++ + L SP   ++    DHSNFD F    E  PDE SGWD++
Sbjct:   64 QLRRLQKELETKVSQIEKLQDAIHSHQTVGLSPTALCHHSCRHFSAINQGRFHKVAVEVHRRLRAKEGVSAEP--PSADNFLWRYRPSSVSTARTVHKNSDTKRLINEAILSNDFLKKLEPQHMREMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEGLLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSSEGFTQPQEIKTLGVGDYFGERALISEDVRSANIICNENDTQCLVVDRDNFNQMVGTYEELQTYLKEYVGELSKSDERRHFLPHSQQSDSPEAQELSRLRERTARIPANQPFQELEVIATLGMGGFGRVELVKLK-DEESTFALKCIKKKHVVDTRQQQHIYSEKKILQQTNSSFIIRLFRTFRDNKYIYMLLEVCLGGELWTVLRDMSCFEEQTARFCIGCVLEAFDYLHSMGIIYRDLKPENLLLDADGYVKMADFGFAKQIGIGRKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILVFELLTGNPPFSGSDPIKIYTMVLHGIDRVDF--PKRIGKRPDDLIRRLCKLNPVERIGNKKNGIMDIKKHKWFQGFNWEGLQGRKLPSPLKRELRGPMDHSNFDMFPPNSEEAPDELSGWDKD 767          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:101158535])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 327/753 (43.43%), Postives = 462/753 (61.35%), Query Frame = 2
Query:  842 RPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQ------------------------------------NRSK--KQGVSGE---SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEE--QVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVN-----------VKLKD-------------LELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            +P  D +  + +E L  ++KL  EEL  +   I+ LQ ++ K T VL +    L +  +  ++N +Q                                    NR K  K GVS E   S+  + + +  +  K  S+K LL +++ KN  L  L   Q+ +M+E MYER   +G  VI +GE G+HL+V   G  EV++  +LL ++     FGELA+LYNC RTASV+A+   K W LDRE FQ IM RT   R E+   FL+SV LL  LP+ KL+K+V+ LE++ +++GE IIR+GE    F+II  G VKVTQ  +  +  Q+I  L  G+YFGEKAL+S + R+AN+ A+ +  + L + R+ F + +G+ NEL       +KHL    +S         ++K V+           ++LKD             LE++ TLGVGGFGRVELV++  +   T+ALK +KK H+V+ KQ++H+ SE++IL E RS FI RLY TFKD K+VYML+E CLGGE+W+ LRD+  FDD   KFC+GCV EAF+YLH +G++YRDLKPENLL+   GY+KL DFGFAK+I  G++TWTFCGTPEYV+PEIILNK H+F+ D+W++GIL +ELLTG+PPF+G+D M IYT ILKGIE  D    + I+ R    I+ LC+ N +ERLGN   G+ +IK H++F GF+WE ++ + L SP   ++    DHS FD +  +++ PPDE SGWDE+
Sbjct:   29 QPTRDSL-RVRVEELEREVKLKDEELGAREQHIKALQEQLAKQTQVLSELSEELHAKSI--TLNMLQDAMRSEPSTGLAFRPASVRASGKSSPNLSVRTKDTPNRRKGAKSGVSAEPTSSSLQKFSFEKARVPKDASVKKLLTDALNKNQYLRRLELQQIKDMVECMYERNYQQGECVIKQGEPGNHLFVLAEGKLEVFQHNKLLTWITVWTTFGELAILYNCTRTASVRAVNKVKTWALDREAFQNIMRRTAETRHEQYRNFLRSVSLLANLPDDKLSKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVTQTTEAHKLPQIINALQKGDYFGEKALVSDDVRSANIIADDNGVECLVIDRETFDQTVGNFNEL-------QKHLQGYVASLDRDDKKRHLKKSVSRHQSQSLSPGFMQLKDMVSLFTSSRPFHHLEVIATLGVGGFGRVELVKVKGE-DVTFALKAIKKKHVVENKQEEHIHSERRILAEARSPFIVRLYRTFKDSKYVYMLLEACLGGEVWSLLRDRGSFDDPTAKFCIGCVTEAFEYLHRKGVLYRDLKPENLLLDMEGYVKLVDFGFAKKIRSGQKTWTFCGTPEYVAPEIILNKGHNFSVDFWALGILVFELLTGSPPFSGSDQMTIYTFILKGIEKMDF--PKMISKRPEDLIRKLCRRNPSERLGNLKNGITDIKKHRWFTGFNWEGLKARTLASPLKRELKGPMDHSYFDSYPPDEDSPPDELSGWDED 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 313/658 (47.57%), Postives = 424/658 (64.44%), Query Frame = 2
Query:  872 EIENLHNQLKLTQE---ELNEKNIRIEELQREINKLTSVLD-QTQISLESNDMISSVNSIQNRSKKQGVSGESN----KDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR--YDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVT 2815
            +IE L  +  L  E   EL++K+  I+ LQ E++K  SV+   TQ   + N++       Q R+K+Q +S E      +D +++ L  Y KS   K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP    L E  L+KL ++LE   +  GE IIRQG   D FFII  G V VT+    +GE   +R+L  G++FGEKAL   + RTA+V A  +VT  L + R  F  LIG L ++ +K ++D                +AE     ++ L D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL +ELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A + I+ LC+ N  ERLGN   G+++I+ HK+F+GF+WE ++K  L  P  P V+
Sbjct:   14 KIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNELHE-----QQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKY---------EAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVS 654          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 305/641 (47.58%), Postives = 416/641 (64.90%), Query Frame = 2
Query:  908 QEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKK-QGVSGE--SNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR--YDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVT 2815
            +  L ++   I+EL+R+++K  SVL   Q+             I  R+++ QG+S E  +++D +   L +Y KS+  K L++E+IL N  + NL   Q+ E+++ MY  +  +   +I EG+ G  +YV E G  EV K    LC +   + FGELA+LYNC RTA+VK LT+ KLW +DR+ FQ IMMRTG+ +  E + FLKSVP    L E  L+KL ++LE   +  GE IIRQG   D FFII  G V VT+    +GE   +R+L  G++FGEKAL   + RTA+V A  +VT  L + R  F  LIG L ++ +K ++D                +AE     ++ L D  ++ TLGVGGFGRVELV+L  D   T+A+K +KK HIV T+QQ+H+ SEK I+ E  S FI RLY TFKD K++YMLME CLGGELWT LRD+  F+D  T+F   CV+EAF YLHS+GIIYRDLKPENL++   GY KL DFGFAK+IG GK+TWTFCGTPEYV+PEIILNK HD ++DYWS+GIL +ELLTG+PPF+G DPMK Y +IL+GI+  +    ++IT  A + I+ LC+ N  ERLGN   G+++I+ HK+F+GF+WE ++K  L  P  P V+
Sbjct:   23 ERRLADREDEIQELKRKLHKCQSVLPSAQL-------------IGPRTRRAQGISAEPQTHQDLSRQALRRYPKSDWSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKY---------EAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEF--PKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVS 638          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008788.1 (SMESG000008788.1)

HSP 1 Score: 1703.72 bits (4411), Expect = 0.000e+0
Identity = 861/862 (99.88%), Postives = 861/862 (99.88%), Query Frame = 2
Query:  314 MSHGLYQSAVSNKSSDNDPFFHVVERFAIREASDNLSRSMGXXXXXXXXXXXXAHSRNESFNTTDIQTITESINHHGXXXXXXXXXXXXXAVSYSGNECGLSNNNKYQLFIDENNQPVTPSYRFSCSCWKDFAENKSSIYRGFHSEPSLNFPPAMGPYHSKHIESCFKHKEISSVLRPIGDEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            MSHGLYQSAVSNKSSDNDPFFHVVERFAIREASDNLSRSMGSNLVNQSSNNSSAHSRNESFNTTDIQTITESINHHGNLLQNQVQLNLDNAVSYSGNECGLSNNNKYQLFIDENNQPVTPSYRFSCSCWKDFAENKSSIYRGFHSEPSLNFPPAMGPYHSKHIESCFKHKEISSVLRPIGDEIYEMEIENL NQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHLLSKSSSKVSICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE
Sbjct:    1 MSHGLYQSAVSNKSSDNDPFFHVVERFAIREASDNLSRSMGSNLVNQSSNNSSAHSRNESFNTTDIQTITESINHHGNLLQNQVQLNLDNAVSYSGNECGLSNNNKYQLFIDENNQPVTPSYRFSCSCWKDFAENKSSIYRGFHSEPSLNFPPAMGPYHSKHIESCFKHKEISSVLRPIGDEIYEMEIENLRNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHLLSKSSSKVSICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 862          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000007783.1 (SMESG000007783.1)

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 406/682 (59.53%), Postives = 510/682 (74.78%), Query Frame = 2
Query:  854 DEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            + +  +E E   + L+  + E++EKN++IEELQREI+KL SVLDQT   L  +   SS+N I+ RSK+ G+SGES+  Q    L K+ KSN +K ++R++I+ N LL+ L   QV+E+IE MYE+     CYVI EGEEG+ LYVA+ G+FEV+K E+L+  +   +CFGELALLYNC+RTASVKAL    LWVLDR +FQ IMM+TG++RQ++L  FL+SV L + L E KL K+VEL+E+Q + +G+CIIRQGE AD FFII++G VKVTQ+ +G+E  +R ++ GEYFGEKALL    RTAN+YA    T+VLCLYR+ F ELIG+LN L+ K Y+DE       S       ++   K  +  L D E+V TLG GGFGRVELV  S D   +YALK MKK +IVQTKQQDHV+SEKKILLEC+S +ICRLY TF D K+VY+L EVCLGGELW  LRD+IHFDD IT FCL CVLEA  YLHSRGI+YRDLKPENLL+  SGYLKLCDFGFAK+IGIG RTWTFCGTPEYV+PEIILNKSHDF+ D+WS+GILTYELL G PPF  NDPMKIY + LKGIE ++I HN +IT +A+S IQ LC++   ERLGNG  G+EEI+ HKYFQGFDWE ++   + SPF+PK+    D SNFD F +E ++PPDE SGWD++
Sbjct:   34 NSVSNVEAEKHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTHSDLSFDHDSSSLNDIKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCYVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGELNVLQAKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITSFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPIDTSNFDKFTNESDIPPDENSGWDKD 715          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 316/681 (46.40%), Postives = 439/681 (64.46%), Query Frame = 2
Query:  896 LKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQ-TNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGE-----EQVIRTLTMGEYFGEKALLSAETRTANVYA-NSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKL------VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            +K  ++ L +K+ +I EL  +++K  SV   TQ   + N++ S  ++ Q R +  G+S E    +  N +   ++K +  K L++ SIL+N  + NL   Q+  +++ M   +      +I EGE G  +YV E G   V K    L  +     FGELA+LYNC RTA+V A+TD KLW +DR  FQ+IMMRTG+ + EE L FLKSVP+ K L E  L K+  +LE   +  G+ IIRQG   D FFII SG V+VT++   +     EQ IR +  GE+FGEKAL   + RTAN+ A + +  D L L R+ +++LIGDL  L+ + YED               ND+  E L       N+ LKDL ++ TLG+GGFGRVELV++  + + TYALK +KK+HIV+T+QQ+H+++E+ IL   +S FI RL+ TFKD KF+YMLMEVCLGGELW+ LRD+  FD+  TKF   CV+EA  YLHSRGI+YRDLKPENLL+   G+ K+ DFGFAK+IG G++TWTFCGTPEYV+PEIILNK HD  +D WS+GIL +ELLTG PPFT  DPMKIY +ILKGI+A +    ++I+  A + I+ LC+ N  ER+G G GG++E + H + + F+W+ +    +  P  P++ S TD SNFD++  E E+PPD+ SGWD +
Sbjct:   19 VKKLEKLLQQKDEKIAELTSQLDKYQSVFSATQ---KQNNVQSGPHNNQTRVRGLGISAEPQTAKIANFQPSFFQKDSKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDG-------------VNDSPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEF--PKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRD 680          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 325/735 (44.22%), Postives = 449/735 (61.09%), Query Frame = 2
Query:  908 QEELNEKNIRIEELQREINKLTSVLD-----QTQIS---------------LESNDMISS---VNSIQN-----------------------------------RSKKQGVSGESNKDQTNLKLIKY-KKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDGE-----EQVIRTLTMGEYFGEKALLSAETRTANVYA-NSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKL------VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            +EEL++K++ IE LQR+++K  S+L      + QIS               +  +  IS+   +NS QN                                   R K+  +SGES    ++ +++ Y +K    K L++ SIL+N  + NL   Q+  +++ M   +      +I EGE G  +YV E G   V K    L  +     FGELA+LYNC RTA+V A+TD KLW +DR  FQ+IMMRTG+ + EE L FLKSVP+ K L E  L K+  +LE   +  G+ IIRQG   D FFII SG V+VT++   +     EQ IR +  GE+FGEKAL   + RTAN+ A + +  D L L R+ +++LIGDL  L+ + YED               ND+  E L       N+ LKDL ++ TLG+GGFGRVELV++  + + TYALK +KK+HIV+T+QQ+H+++E+ IL   +S FI RL+ TFKD KF+YMLMEVCLGGELW+ LRD+  FD+  TKF   CV+EA  YLHSRGI+YRDLKPENLL+   G+ K+ DFGFAK+IG G++TWTFCGTPEYV+PEIILNK HD  +D WS+GIL +ELLTG PPFT  DPMKIY +ILKGI+A +    ++I+  A + I+ LC+ N  ER+G G GG++E + H + + F+W+ +    +  P  P++ S TD SNFD++  E E+PPD+ SGWD +
Sbjct:   75 EEELDQKDLLIENLQRQLDKYRSILQSPMQIKPQISSIYNEDFQLFTPNGDVSHDSSISTGEMLNSSQNNQVLCYNCGAKLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDG-------------VNDSPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEF--PKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRD 793          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000074822.1 (SMESG000074822.1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 318/697 (45.62%), Postives = 450/697 (64.56%), Query Frame = 2
Query:  854 DEIYEMEIENLHNQLKLTQEELNEKNIRIEELQREIN-------KLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESI--LKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHXXXXXXXXXXICNDAEMEKLVN----VKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEE 2899
            + +   EIE LH ++        EK+ RI +L  E+N       K+ SVL Q    +E N +  S +++  RSKKQ V GES    +++++  ++KS S   L+  +I   ++  L  L   Q+ ++ + MY + +    Y+I EGE G H+YV  SG  EV K  + L  +     FGELA+L NC RTASVKA+T+A  W ++R+V+QAI+ ++ +Q+ EE  +FL+SV L K L + +L K+V+ L ++ +  GE I+++GE    F+II++G VKV Q   G  E Q IRTLT G+YFGE+ALL  E RTA+V A+S   +VL L R+ F+ LIG   EL +K YED K    +SS+        +   + N    ++  DLE++ TLGVGGFG+VELVR  +DH   +ALK + K +IV+ KQ++H+ISE+KILLE +  FIC LY TF+D K+VY+LME CLGGE+WT LR+K  FDD +TKF LG  + A  YLHS+ IIYRDLKPEN++    G++KLCDFGFAK IG G++T+TFCGTPEYV+PEIILNK HD + D W++GIL +ELLTG+PPF G++PM +Y  ILKG+E  +    R+I   A   I+ LCK N  ERLG G  G+  I +HKYF GF+WE++  +++     PK+ ++ D   FD F +++ +P DE SGWD+E
Sbjct:   92 NNVLSQEIEELHKRI-------TEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNL--RSKKQVVYGESF-SLSSIEMKIHEKSESATLLIEMAIKSCQDDFLKKLEQQQIKQICQCMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKNGKVKVVQNVQGVVEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTKKDNIIIKNKYQIIQKNDLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLKPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF--GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDE 776          
The following BLAST results are available for this feature:
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKG10.000e+048.54protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG10.000e+048.37protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG20.000e+044.91protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+044.91protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+043.84protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-40.000e+045.25cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.25cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.25cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+047.42cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+047.42cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkg21D0.000e+050.72gene:FBgn0000442 transcript:FBtr0078042[more]
for0.000e+048.02gene:FBgn0000721 transcript:FBtr0089310[more]
for0.000e+048.02gene:FBgn0000721 transcript:FBtr0089312[more]
for0.000e+048.02gene:FBgn0000721 transcript:FBtr0089304[more]
for0.000e+048.02gene:FBgn0000721 transcript:FBtr0446099[more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+048.39protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1b0.000e+048.67protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1a0.000e+048.28protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg20.000e+044.01protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg20.000e+043.86protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk40.000e+049.33calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+048.39calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+048.39calcium/calmodulin-dependent protein kinase IV [So... [more]
ptafr0.000e+044.35platelet activating factor receptor [Source:Xenbas... [more]
tnpo20.000e+046.20transportin 2 [Source:Xenbase;Acc:XB-GENE-968452][more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkg10.000e+048.39protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg10.000e+048.22protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg20.000e+044.42protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg20.000e+043.33protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg12.938e-13052.36protein kinase, cGMP-dependent, type I [Source:MGI... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8X6H1|EGL4_CAEBR0.000e+045.04cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|O76360|EGL4_CAEEL0.000e+047.42cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|Q13976|KGP1_HUMAN0.000e+048.37cGMP-dependent protein kinase 1 OS=Homo sapiens OX... [more]
sp|P00516|KGP1_BOVIN0.000e+048.37cGMP-dependent protein kinase 1 OS=Bos taurus OX=9... [more]
sp|Q13237|KGP2_HUMAN0.000e+044.91cGMP-dependent protein kinase 2 OS=Homo sapiens OX... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HLV40.000e+052.67cGMP-dependent protein kinase OS=Lingula unguis OX... [more]
V3Z9120.000e+051.49cGMP-dependent protein kinase OS=Lottia gigantea O... [more]
A0A5N4A4B00.000e+051.16Uncharacterized protein OS=Photinus pyralis OX=705... [more]
E0W2T90.000e+050.78cGMP-dependent protein kinase, isozyme, putative O... [more]
D7EJR50.000e+049.93Uncharacterized protein OS=Tribolium castaneum OX=... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+048.24protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg20.000e+042.90protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
ENSAMXT00000002114.20.000e+044.49cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkg20.000e+042.32protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg20.000e+041.68protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002200.15.641e-12354.49pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000002201.13.347e-10049.19pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 ... [more]
ENSPMAT00000001814.14.949e-6740.22pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000006766.14.214e-5034.49pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.14.886e-5033.86pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK22.003e-7038.94cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK31.775e-6738.82cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK11.494e-6637.95cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK11.121e-5035.43S/T protein kinase; phosphorylates, downregulates ... [more]
YPK29.074e-5033.76Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384070.000e+049.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383990.000e+048.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352287.957e-7342.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318952.490e-5837.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411661.614e-5437.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg10.000e+047.66protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
ENSORLT00000001302.20.000e+046.54cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
prkg20.000e+043.43protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg10.000e+047.57protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg10.000e+047.58protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008788.10.000e+099.88SMESG000008788.1[more]
SMESG000007783.10.000e+059.53SMESG000007783.1[more]
SMESG000016927.10.000e+046.40SMESG000016927.1[more]
SMESG000016927.10.000e+044.22SMESG000016927.1[more]
SMESG000074822.10.000e+045.62SMESG000074822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000852 ID=SMED30000852|Name=cGMP-dependent protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2999bp
TAGAAAAAAATATGAATTGAGAAAATTTTATTGGTTGTACTATATTGTAT
ATTGAATCCTATTTTCATTTCTGTCTTGATTGCTATTTTCCTACCCCTAA
TACTGAATTCGACGGTGTAATGAAAACTATATAGAGTATGTATGTTTTTT
TGATTAATTCATGTTTTTAAAATAAAAATTTTCTTTTCATTTTGATTTGA
AGCATAGAAAATTTTTGATTCGTGTTTCTTTTGCACACAATATTCAACAG
GTAAGGATTGAAAATAAACATTAAAAAGTGGATTAAATTTATGTTCAACT
TTCGACTGGATACATGTCACATGGATTATATCAGAGCGCTGTCAGTAATA
AAAGTAGCGATAATGATCCCTTTTTTCATGTAGTTGAGAGATTCGCAATT
AGAGAAGCTAGTGACAATTTATCGCGTTCCATGGGAAGCAATTTGGTTAA
CCAGTCATCAAATAATTCATCAGCACACAGTAGAAATGAAAGTTTTAATA
CAACAGATATCCAAACAATAACTGAGTCCATCAATCATCATGGGAATTTG
TTACAAAACCAAGTCCAATTAAATCTTGACAACGCTGTGTCTTATTCCGG
CAATGAATGCGGCCTCAGTAACAATAATAAATATCAGCTTTTCATCGATG
AAAATAATCAGCCAGTAACACCAAGTTACCGGTTTTCTTGTAGTTGTTGG
AAAGACTTTGCCGAAAATAAAAGTTCAATTTATCGAGGTTTTCACTCGGA
ACCAAGCCTAAATTTCCCACCTGCCATGGGACCATACCACAGCAAACATA
TTGAAAGCTGCTTCAAACACAAAGAAATAAGTTCGGTATTAAGGCCTATT
GGAGATGAAATTTACGAAATGGAAATAGAAAATCTGCACAACCAATTGAA
GTTAACTCAAGAAGAATTAAATGAGAAAAATATTCGAATTGAAGAACTAC
AAAGAGAAATTAATAAATTAACTTCAGTTCTTGATCAAACTCAAATTAGT
TTAGAATCTAATGACATGATAAGTTCTGTAAATTCAATTCAGAATCGATC
AAAAAAACAAGGAGTTTCTGGAGAATCAAATAAAGATCAAACAAATTTGA
AGCTCATTAAATATAAAAAAAGTAATAGTATCAAATCCCTTTTACGAGAA
TCCATTTTGAAAAATCTTCTCCTCAGCAACTTGCCAACTTATCAAGTGGA
TGAAATGATTGAATATATGTATGAAAGGCAAATTGACAGAGGCTGTTATG
TCATCATTGAAGGAGAAGAAGGAGATCACTTATATGTTGCCGAAAGTGGA
GACTTTGAAGTTTGGAAAGCGGAGCGCTTATTATGCTACCTGGATGGTAA
TAGGTGTTTTGGCGAGTTAGCTCTATTATACAATTGTCGAAGAACCGCCT
CAGTCAAAGCATTAACCGATGCAAAATTATGGGTTCTAGACAGAGAAGTA
TTTCAGGCAATAATGATGAGAACAGGAATTCAGAGACAAGAAGAACTTCT
TCGGTTTTTAAAAAGTGTTCCCCTTCTTAAAGGATTACCGGAAATTAAGT
TAAATAAACTGGTCGAGCTATTGGAATTGCAGAGACACGAAGAAGGAGAA
TGTATTATCCGACAAGGTGAATCCGCAGACTGTTTCTTCATTATTCAATC
TGGATCAGTTAAAGTTACTCAAAGATATGACGGAGAAGAGCAAGTCATTC
GAACTCTAACTATGGGAGAATATTTTGGAGAAAAGGCTTTGTTATCGGCC
GAAACGAGAACTGCCAATGTTTATGCCAATAGCTCAGTGACAGACGTTCT
TTGTCTTTATCGCAAACCATTCTTGGAACTAATAGGTGATTTAAATGAAC
TGAAAAACAAGAATTACGAAGACGAGAAACATCTCCTTTCTAAATCAAGT
TCAAAGGTTTCAATTTGTAATGATGCAGAAATGGAGAAATTAGTAAATGT
CAAACTGAAAGATTTGGAATTAGTTTGTACTTTAGGAGTCGGAGGTTTCG
GAAGAGTTGAATTGGTTCGATTGTCACACGACCATCAGTCAACTTATGCT
CTGAAATGTATGAAAAAGTACCACATTGTCCAGACAAAACAACAAGATCA
TGTAATTTCAGAGAAAAAGATTTTATTGGAATGCCGATCAATTTTTATTT
GCAGGTTATATAACACATTCAAAGATGTTAAATTTGTCTATATGCTCATG
GAAGTTTGCCTCGGTGGAGAATTATGGACATGCTTACGAGATAAAATACA
TTTCGATGACATAATTACGAAGTTCTGCCTTGGATGTGTCCTTGAAGCAT
TTGATTACCTTCATTCTAGAGGAATTATTTATCGAGATTTAAAGCCAGAA
AATCTTTTGATCACAACTTCAGGATATCTGAAATTGTGTGATTTTGGTTT
CGCAAAAAGAATCGGAATAGGTAAGCGGACTTGGACATTTTGTGGAACAC
CCGAATATGTATCCCCTGAAATAATACTTAATAAAAGTCACGATTTCACT
TCCGATTATTGGTCGGTCGGAATACTTACGTATGAGCTCTTAACTGGAAC
ACCTCCTTTTACGGGAAATGATCCAATGAAGATATATACACTTATTCTCA
AAGGGATAGAAGCAACAGATATATTTCACAACCGTCGAATTACATTTCGA
GCGTCAAGTTTTATTCAGGCTCTATGCAAATTCAATGCAGCCGAAAGGCT
TGGTAATGGCGCTGGTGGTCTAGAGGAAATCAAATCCCATAAGTATTTTC
AAGGCTTCGACTGGGAAAGTATCAGAAAACAGGATTTGGTGTCACCATTT
CATCCAAAAGTTACCAGTTCAACCGATCATTCGAACTTTGATGATTTCCA
AGATGAAGATGAATTGCCTCCAGATGAATATTCGGGTTGGGATGAAGAAT
TTTAAATTATTCTTTACTTCTTTTTATTGCCAATTTAACTTCATCACAAC
TAAATAATTTCCTTTATTCTGATTTGTGTTCGAAGCACATGTACGCTAT
back to top

protein sequence of SMED30000852-orf-1

>SMED30000852-orf-1 ID=SMED30000852-orf-1|Name=SMED30000852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=864bp
MSHGLYQSAVSNKSSDNDPFFHVVERFAIREASDNLSRSMGSNLVNQSSN
NSSAHSRNESFNTTDIQTITESINHHGNLLQNQVQLNLDNAVSYSGNECG
LSNNNKYQLFIDENNQPVTPSYRFSCSCWKDFAENKSSIYRGFHSEPSLN
FPPAMGPYHSKHIESCFKHKEISSVLRPIGDEIYEMEIENLHNQLKLTQE
ELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSVNSIQNRSKKQG
VSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIE
YMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFG
ELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLK
SVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVK
VTQRYDGEEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYR
KPFLELIGDLNELKNKNYEDEKHLLSKSSSKVSICNDAEMEKLVNVKLKD
LELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISE
KKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDI
ITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRI
GIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFT
GNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGA
GGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDE
LPPDEYSGWDEEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002374cGMP_dep_kinase
IPR035014STKc_cGK
IPR000595cNMP-bd_dom
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR014710RmlC-like_jellyroll
IPR017441Protein_kinase_ATP_BS
IPR018488cNMP-bd_CS
IPR008271Ser/Thr_kinase_AS
IPR018490cNMP-bd-like
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0004692cGMP-dependent protein kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030553cGMP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 181..229
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 481..492
score: 35.0
coord: 469..478
score: 66.33
coord: 322..336
score: 29.56
coord: 307..321
score: 40.22
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 636..837
e-value: 1.5E-97
score: 328.1
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 548..844
e-value: 1.5E-97
score: 328.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 843..863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 832..863
NoneNo IPR availablePANTHERPTHR24353:SF90coord: 185..863
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 185..863
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 813..863
e-value: 6.9E-5
score: 32.2
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 813..863
score: 12.192
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 551..812
e-value: 9.5E-79
score: 277.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 555..812
e-value: 1.3E-62
score: 211.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 551..812
score: 40.668
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 404..525
e-value: 2.2E-26
score: 103.7
coord: 286..399
e-value: 3.9E-21
score: 86.2
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 305..386
e-value: 3.2E-15
score: 55.9
coord: 423..507
e-value: 1.4E-20
score: 73.1
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 286..401
score: 31.884
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 404..520
score: 31.011
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 404..518
e-value: 6.53472E-27
score: 103.945
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 286..395
e-value: 1.48394E-23
score: 94.3149
IPR002374cGMP-dependent kinasePIRSFPIRSF000559cGMP-dep_kinasecoord: 159..863
e-value: 2.0E-274
score: 909.9
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 253..390
e-value: 6.2E-41
score: 141.2
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 391..538
e-value: 6.2E-36
score: 125.2
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 557..581
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 431..447
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 471..488
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 349..366
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 671..683
IPR035014cGMP-dependent protein kinase, catalytic domainCDDcd05572STKc_cGKcoord: 557..818
e-value: 6.59893E-146
score: 428.953
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 255..386
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 391..513
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 539..851